RPSBLAST alignment for GI: 254781060 and conserved domain: COG4525

>gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259
 Score = 51.4 bits (123), Expect = 2e-07
 Identities = 44/208 (21%), Positives = 86/208 (41%), Gaps = 22/208 (10%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML + +L           +  ++L +   E+V ++GP+G GK+TL  L++G         
Sbjct: 3   MLNVSHLSLSYEGKPRSALEDVSLTIASGELVVVLGPSGCGKTTLLNLIAGFVTPS---- 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G   L+   +E       + FQ    +P + ++  +   L  +   + ++     
Sbjct: 59  ----RGSIQLNGRRIEGPGAERGVVFQNEALLPWLNVIDNVAFGLQLRGIEKAQR----- 109

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
                  ++ A +G+     K    L  SGG ++   I +   +EP L +LDE    L  
Sbjct: 110 --REIAHQMLALVGLEGAEHKYIWQL--SGGMRQRVGIARALAVEPQLLLLDEPFGAL-- 163

Query: 181 DAL---KIAAQGVNALRSQDRSFLIITH 205
           DAL   ++    ++  +   +  L+ITH
Sbjct: 164 DALTREQMQELLLDLWQETGKQVLLITH 191