RPSBLAST alignment for GI: 254781060 and conserved domain: KOG0054

>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381
 Score = 42.6 bits (100), Expect = 1e-04
 Identities = 57/254 (22%), Positives = 105/254 (41%), Gaps = 59/254 (23%)

Query: 13  DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTL-------SYLLSGHKDYEITAGDILYK 65
           ++    ++ +N +++  ++VA++GP GSGKS+L          LSG        G + Y 
Sbjct: 531 ESPEPTLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSV---AVNGSVAYV 587

Query: 66  GES--ILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARN-EKELLIPD- 121
            +   I + ++ E       + F  P                +E+R  +  +   L  D 
Sbjct: 588 PQQPWIQNGTVREN------ILFGSP---------------YDEERYDKVIKACALKKDL 626

Query: 122 --FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLL--EPSLCILDETDSG 177
                       E GIN+           SGG+K    I   R +  +  + +LD+  S 
Sbjct: 627 EILPFGDLTEIGERGINL-----------SGGQK--QRISLARAVYQDADIYLLDDPLSA 673

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           +D    K   +       + ++ +++TH  + L +   D I VL +GKI+++G Y    +
Sbjct: 674 VDAHVGKHIFEECIRGLLRGKTVILVTHQLQFLPHA--DQIIVLKDGKIVESGTYE---E 728

Query: 238 LEENG--YAELIKE 249
           L ++G  +AEL  E
Sbjct: 729 LLKSGGDFAELAHE 742