RPSBLAST alignment for GI: 254781060 and conserved domain: cd03213

>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.. Length = 194
 Score = 78.7 bits (194), Expect = 1e-15
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 48/229 (20%)

Query: 5   KNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILY 64
             +++    +  ++++ ++ K +P E+ AIMGP+G+GKSTL   L+G +     +G++L 
Sbjct: 11  VTVKSSPSKSGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLGVSGEVLI 70

Query: 65  KGESILDWSIVERASKGIFLAFQYPVEIPGII--MMQFLKIALNEQRKARNEKELLIPDF 122
            G  +                         II  + Q                ++L P  
Sbjct: 71  NGRPL------------------DKRSFRKIIGYVPQ---------------DDILHPTL 97

Query: 123 T-RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           T R+     A+L             G SGGE+K   I    +  PSL  LDE  SGLD  
Sbjct: 98  TVRETLMFAAKLR------------GLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSS 145

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
           +       +  L    R+ +   H      +   D + +L  G++I  G
Sbjct: 146 SALQVMSLLRRLADTGRTIICSIHQPSSEIFELFDKLLLLSQGRVIYFG 194