RPSBLAST alignment for GI: 254781060 and conserved domain: cd03218

>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232
 Score = 82.1 bits (203), Expect = 1e-16
 Identities = 57/230 (24%), Positives = 108/230 (46%), Gaps = 14/230 (6%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L  +NL  +      +++ G++L V+  E+V ++GPNG+GK+T  Y++ G    +  +G 
Sbjct: 1   LRAENLSKRY--GKRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGL--VKPDSGK 56

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  G+ I    + +RA  GI    Q       + + + +   L  +  ++ E+E     
Sbjct: 57  ILLDGQDITKLPMHKRARLGIGYLPQEASIFRKLTVEENILAVLEIRGLSKKERE----- 111

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
              K+ ++  E  I    L++      SGGE++  EI +     P   +LDE  +G+D  
Sbjct: 112 --EKLEELLEEFHI--THLRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPI 167

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
           A++   + +  L+ +    LI  H  R    I  D  ++++ GK++  G 
Sbjct: 168 AVQDIQKIIKILKDRGIGVLITDHNVRETLSIT-DRAYIIYEGKVLAEGT 216