RPSBLAST alignment for GI: 254781060 and conserved domain: cd03254

>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229
 Score = 85.6 bits (212), Expect = 1e-17
 Identities = 66/220 (30%), Positives = 103/220 (46%), Gaps = 15/220 (6%)

Query: 13  DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDW 72
           D    +++ +N  ++P E VAI+GP G+GK+TL  LL     Y+   G IL  G  I D 
Sbjct: 13  DEKKPVLKDINFSIKPGETVAIVGPTGAGKTTLINLLMRF--YDPQKGQILIDGIDIRDI 70

Query: 73  SIVERASKGIFLAFQYPVEIPGIIM--MQFLKIALNEQRKARNEKELLIPDFTRKVRKIT 130
           S  +     I +  Q      G IM  ++  +    ++      KE    DF  K+    
Sbjct: 71  SR-KSLRSMIGVVLQDTFLFSGTIMENIRLGRPNATDEEVIEAAKEAGAHDFIMKLPN-- 127

Query: 131 AELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGV 190
              G +  + +   NL  S GE+++  I +  L +P + ILDE  S +D +  K+  + +
Sbjct: 128 ---GYDTVLGENGGNL--SQGERQLLAIARAMLRDPKILILDEATSNIDTETEKLIQEAL 182

Query: 191 NALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
             L  + R+ +II H  RL      D I VL +GKII+ G
Sbjct: 183 EKLM-KGRTSIIIAH--RLSTIKNADKILVLDDGKIIEEG 219