RPSBLAST alignment for GI: 254781060 and conserved domain: cd03265

>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220
 Score = 64.1 bits (156), Expect = 4e-11
 Identities = 53/230 (23%), Positives = 99/230 (43%), Gaps = 17/230 (7%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           +E++NL  K    D E +RG++ +V   E+  ++GPNG+GK+T   +L+     + T+G 
Sbjct: 1   IEVENLVKKY--GDFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTL--LKPTSGR 56

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
               G  ++      R   GI   FQ       +   + L I          E+      
Sbjct: 57  ATVAGHDVVREPREVRRRIGI--VFQDLSVDDELTGWENLYIHARLYGVPGAER------ 108

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
              ++ ++   +G+ ++   R +   +SGG ++  EI +  +  P +  LDE   GLD  
Sbjct: 109 -RERIDELLDFVGL-LEAADRLVK-TYSGGMRRRLEIARSLVHRPEVLFLDEPTIGLDPQ 165

Query: 182 ALKIAAQGVNAL-RSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
                 + +  L      + L+ THY      +  D + ++ +G+II  G
Sbjct: 166 TRAHVWEYIEKLKEEFGMTILLTTHYMEEAEQLC-DRVAIIDHGRIIAEG 214