RPSBLAST alignment for GI: 254781060 and conserved domain: cd03266

>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.. Length = 218
 Score = 64.9 bits (158), Expect = 2e-11
 Identities = 62/243 (25%), Positives = 106/243 (43%), Gaps = 38/243 (15%)

Query: 1   MLEIKNL--RAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
           M+    L  R + V    + + G++  V+P EV  ++GPNG+GK+T   +L+G    E  
Sbjct: 1   MITADALTKRFRDVKKTVQAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGL--LEPD 58

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL- 117
           AG     G                F   + P E    +        L ++  AR   E  
Sbjct: 59  AGFATVDG----------------FDVVKEPAEARRRLGFVSDSTGLYDRLTARENLEYF 102

Query: 118 -----LIPD-FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCIL 171
                L  D  T ++ ++   LG+  ++L R +  GFS G ++   I +  + +P + +L
Sbjct: 103 AGLYGLKGDELTARLEELADRLGME-ELLDRRVG-GFSTGMRQKVAIARALVHDPPVLLL 160

Query: 172 DETDSGLDIDALKIAAQGVNALRSQDRSFLIITH----YQRLLNYIKPDTIHVLHNGKII 227
           DE  +GLD+ A +   + +  LR+  +  L  TH     +RL      D + VLH G+++
Sbjct: 161 DEPTTGLDVMATRALREFIRQLRALGKCILFSTHIMQEVERLC-----DRVVVLHRGRVV 215

Query: 228 KTG 230
             G
Sbjct: 216 YEG 218