RPSBLAST alignment for GI: 254781060 and conserved domain: cd03297

>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 214
 Score = 55.6 bits (134), Expect = 1e-08
 Identities = 55/217 (25%), Positives = 92/217 (42%), Gaps = 25/217 (11%)

Query: 22  LNLKVE-PSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSI---VER 77
           L +  +   EV  I G +G+GKSTL   ++G +  +   G I+  G  + D      +  
Sbjct: 15  LKIDFDLNEEVTGIFGASGAGKSTLLRCIAGLE--KPDGGTIVLNGTVLFDSRKKINLPP 72

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
             + I L FQ     P + + + L   L  +RK   E  +        V ++   LG+  
Sbjct: 73  QQRKIGLVFQQYALFPHLNVRENLAFGL--KRKRNREDRIS-------VDELLDLLGL-- 121

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQD 197
           D L        SGGEK+   + +    +P L +LDE  S LD  AL++       L+   
Sbjct: 122 DHLLNRYPAQLSGGEKQRVALARALAAQPELLLLDEPFSALD-RALRLQLL--PELKQIK 178

Query: 198 RSF----LIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
           ++     + +TH      Y+  D I V+ +G++   G
Sbjct: 179 KNLNIPVIFVTHDLSEAEYLA-DRIVVMEDGRLQYIG 214