BLAST/BLAST alignment of GI: 254781060 and GI: 254780340
>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348
 Score = 32.0 bits (71), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 101/227 (44%), Gaps = 42/227 (18%)

Query: 23  NLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL------YKGESILDWSIVE 76
           NL+V+  E++ +MG +G+GKSTL   ++G     +  G++L      +      D +++ 
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLA--PVVRGEVLVDTDKGFVNPYAADANVLR 106

Query: 77  RAS-KGIFLAFQYPVEIPGIIM-------MQFLKIALNEQRKARNEKELLIPDFTRKVRK 128
           +     + + FQ    +P   +       ++FL I  + +RK+R  + L I + T+    
Sbjct: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIP-DVERKSRVAEHLEIVNLTK---- 161

Query: 129 ITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-IDALKIAA 187
             A+  INM           SGG K+     +       + ++DE  S LD +  +++  
Sbjct: 162 -WADCKINM----------LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQD 210

Query: 188 QGVNALRSQDRSFLIITH----YQRLLNYIKPDTIHVLHNGKIIKTG 230
           + +   R   ++ + ++H      RL N I      ++  G+II+ G
Sbjct: 211 ELLALQRKLKKTIVFVSHDINEAFRLGNRIA-----IMEGGRIIQCG 252