BLAST/BLAST alignment of GI: 254781060 and GI: 254780596
>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438
 Score = 51.6 bits (122), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 79/163 (48%), Gaps = 17/163 (10%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           ++  +N  V   E+V ++G +GSGKSTL  +++G      ++G +L+KG+ I D      
Sbjct: 32  VLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGL--VSPSSGQVLFKGKKIKD------ 83

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
             K I + FQ     P + +++ +++ L  +   + E         R+ R ++A   I +
Sbjct: 84  PPKDISVVFQTFALFPWLTVLENVELGLKAKGIDKEE---------RRKRALSAIDLIGL 134

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  +       SGG  +     +  ++ PSL ++DE  S LD+
Sbjct: 135 DGFESAHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDV 177