BLAST/BLAST alignment of GI: 254781060 and GI: 254780871
>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227
 Score = 30.0 bits (66), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 24/31 (77%)

Query: 18 IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYL 48
          ++  ++L ++  E+VA++ P+G+GKST+ ++
Sbjct: 25 VLENVHLSLKKGEIVALVSPSGTGKSTILHI 55