BLAST/BLAST alignment of GI: 254781060 and GI: 254781123
>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610
 Score = 38.5 bits (88), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG 51
           D  +++  +L++   E + I+GPNG+GK+TL  LL+G
Sbjct: 296 DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332