RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781063|ref|YP_003065476.1| hypothetical protein CLIBASIA_04825 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* (A:) Length = 103 Score = 110 bits (276), Expect = 9e-26 Identities = 37/94 (39%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Query: 35 DIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAV 94 A L+ VYDPE+ D+ LGLIY + VE + TLT PGCP+ + + + A+ Sbjct: 10 QAWALLEAVYDPELGLDVVNLGLIYDLVVEPP-RAYVRXTLTTPGCPLHDSLGEAVRQAL 68 Query: 95 GAVEGISGVEVSITFDPPWTPDLMSEEAQIATGY 128 + G+ VEV +TF+PPWT +SE+A+ G+ Sbjct: 69 SRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102 >1uwd_A Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} (A:1-88) Length = 88 Score = 99.1 bits (247), Expect = 2e-22 Identities = 38/88 (43%), Positives = 56/88 (63%) Query: 26 PEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGD 85 P + D++ ALK V D E+ D+ LGL+Y I +++ VK+LMT+T P CP+AG Sbjct: 1 PMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGM 60 Query: 86 MPKWIENAVGAVEGISGVEVSITFDPPW 113 + E A+ +EG++ VEV +TFDPPW Sbjct: 61 ILSDAEEAIKKIEGVNNVEVELTFDPPW 88 >3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} (A:1-92) Length = 92 Score = 95.6 bits (238), Expect = 2e-21 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Query: 25 PPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAG 84 E N + A L+ V DPE+ DI LGL+Y + + + I T T+ GCP AG Sbjct: 2 NAXSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITXTXTSIGCPXAG 61 Query: 85 DMPKWIENAV-GAVEGISGVEVSITFDPPWT 114 + ++ + V ++ +EV++ ++PPW+ Sbjct: 62 QIVSDVKKVLSTNVPEVNEIEVNVVWNPPWS 92 >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} (A:) Length = 72 Score = 26.2 bits (58), Expect = 1.6 Identities = 10/46 (21%), Positives = 22/46 (47%), Gaps = 8/46 (17%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 I + A++G++ ++S +T+D T D + +E G+ Sbjct: 20 INTQLRALKGVTKCDISLVTNECQVTYDNEVTADSI-KEIIEDCGF 64 >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} (A:131-199) Length = 69 Score = 26.2 bits (58), Expect = 1.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 45 DPEIPCDIFELGL 57 D + IFELGL Sbjct: 54 DKSVAFKIFELGL 66 >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 25.9 bits (56), Expect = 1.9 Identities = 4/22 (18%), Positives = 9/22 (40%), Gaps = 1/22 (4%) Query: 21 ESTIPPEDLERISNDIIAALKT 42 E +P L ++I ++ Sbjct: 147 EKALPLL-LSNPPRNMIGQSQS 167 >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, metal transport; NMR {Helicobacter pylori 26695} (A:) Length = 66 Score = 25.8 bits (57), Expect = 2.2 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 8/46 (17%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE VG +EG+S ++VS + FD P T DL+ +EA + G Sbjct: 19 IEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLI-KEALLDAGQ 63 >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A (A:) Length = 90 Score = 25.6 bits (56), Expect = 2.3 Identities = 8/46 (17%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE+ + A++ +S + VS + ++ +A A Sbjct: 21 IESTLSALQYVSSIVVSLENRSAIVVYNASSVTPESLRKAIEAVSP 66 >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A (A:) Length = 77 Score = 25.5 bits (56), Expect = 2.4 Identities = 10/46 (21%), Positives = 17/46 (36%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + EGI + V+ + ++P M E G+ Sbjct: 21 IERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGF 66 >2gcf_A Cation-transporting ATPase PACS; ferredoxin-like fold, beta-alpha-beta-BETA-alpha-beta, structural genomics, structural proteomics in europe; NMR {Synechocystis SP} (A:) Length = 73 Score = 25.5 bits (56), Expect = 2.5 Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE A+ V G+ +V+ +++ TP ++ +A GY Sbjct: 21 IERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQIL-TDAVERAGY 65 >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} (A:353-422) Length = 70 Score = 25.4 bits (56), Expect = 2.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 45 DPEIPCDIFELGL 57 D + IFELGL Sbjct: 54 DKSVAFKIFELGL 66 >1zu0_A Chitin oligosaccharide binding protein; alpha helix/beta sheet, sugar binding protein, signaling protein; HET: CBS; 2.20A {Vibrio cholerae} PDB: 1zty_A* (A:53-126) Length = 74 Score = 25.2 bits (55), Expect = 3.1 Identities = 4/47 (8%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 32 ISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAP 78 ++D++ + + + ++ ++Y V+ L+ Sbjct: 30 TADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRF--RLSEA 74 >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} (A:1-72) Length = 72 Score = 25.1 bits (55), Expect = 3.6 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + + G++ V+ + +DP T +E GY Sbjct: 24 IEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGY 69 >2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N-acetylglucosamine, N-acetylglucosamine- 1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* (A:426-486) Length = 61 Score = 25.0 bits (55), Expect = 3.8 Identities = 6/19 (31%), Positives = 9/19 (47%) Query: 88 KWIENAVGAVEGISGVEVS 106 KW+ G ++ VEV Sbjct: 19 KWVIQNGGVIDNQGLVEVD 37 >1cpz_A Protein (COPZ); copper chaperone, metal transport; NMR {Enterococcus hirae} (A:) Length = 68 Score = 25.1 bits (55), Expect = 3.9 Identities = 13/46 (28%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE AVG + G+ V+V + FD +A GY Sbjct: 18 IEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGY 63 >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} (A:) Length = 84 Score = 24.8 bits (54), Expect = 4.1 Identities = 10/46 (21%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE +G ++G+ ++VS I + P ++ A G+ Sbjct: 27 IEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGF 72 >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A (B:) Length = 75 Score = 24.7 bits (54), Expect = 4.6 Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE +G V G+ ++VS I +DP +EA G+ Sbjct: 20 IEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGF 65 >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} (A:) Length = 80 Score = 24.8 bits (54), Expect = 4.7 Identities = 10/46 (21%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + +EG++ V+ + ++P +EA GY Sbjct: 21 IEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGY 66 >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} (A:73-151) Length = 79 Score = 24.8 bits (54), Expect = 4.9 Identities = 10/46 (21%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + +EG++ V+ + ++P +EA GY Sbjct: 20 IEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGY 65 >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} (A:1-104) Length = 104 Score = 24.5 bits (53), Expect = 5.1 Identities = 11/46 (23%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE +G + G+ ++VS + +DP T + + A A Sbjct: 38 IEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPP 83 >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} (X:) Length = 74 Score = 24.3 bits (53), Expect = 5.2 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 +E A+ V G+ V+ + FDP + +E G+ Sbjct: 20 VEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEEIEDAGF 65 >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} (A:77-149) Length = 73 Score = 24.4 bits (53), Expect = 5.4 Identities = 9/46 (19%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE+ + GI+ V+ + FDP + G+ Sbjct: 22 IESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGF 67 >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A (A:) Length = 75 Score = 24.3 bits (53), Expect = 5.5 Identities = 9/46 (19%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE+++ GI V+ I +DP + G+ Sbjct: 22 IESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGF 67 >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} (A:) Length = 69 Score = 24.3 bits (53), Expect = 5.5 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 +E +VG ++G+S V V+ ++FD +A GY Sbjct: 20 VETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGY 65 >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} (A:) Length = 76 Score = 24.4 bits (53), Expect = 5.5 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + + G++ V+ + +DP T +E GY Sbjct: 24 IEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGY 69 >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} (A:105-202) Length = 98 Score = 24.5 bits (53), Expect = 5.7 Identities = 9/46 (19%), Positives = 17/46 (36%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + +EG+ + VS + ++P A G+ Sbjct: 36 IEGMISQLEGVQQISVSLAEGTATVLYNPAVISPEELRAAIEDMGF 81 >2ofg_X Zinc-transporting ATPase; ferredoxin-like fold, beta-alpha-beta-BETA-alpha-beta, structural genomics, hydrolase, membrane protein; NMR {Synechocystis SP} PDB: 2ofh_X (X:) Length = 111 Score = 24.2 bits (52), Expect = 5.9 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE ++ ++G++ V+ +T+DP ++ +E A GY Sbjct: 21 IEGSLERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGY 66 >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa} (A:) Length = 342 Score = 24.3 bits (53), Expect = 5.9 Identities = 6/19 (31%), Positives = 9/19 (47%) Query: 95 GAVEGISGVEVSITFDPPW 113 G + G S + S F P+ Sbjct: 71 GELVGCSAIVASAGFSEPF 89 >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} (A:) Length = 72 Score = 24.4 bits (53), Expect = 5.9 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 ++ A+ VEG+S V+V+ +TFD T +A GY Sbjct: 21 VKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGY 66 >2ocz_A 3-dehydroquinate dehydratase; structural genomics, dhqase, dehydroshikimate, PSI-2, protein structure initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} (A:) Length = 231 Score = 24.1 bits (52), Expect = 6.4 Identities = 7/66 (10%), Positives = 16/66 (24%), Gaps = 11/66 (16%) Query: 13 ADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKIL 72 A +I + P + I+ ++ E + E + + Sbjct: 3 AXRIVAP----VXPRHFDEAQAIDISK-------YEDVNLIEWRADFLPKDEIVAVAPAI 51 Query: 73 MTLTAP 78 A Sbjct: 52 FEKFAG 57 >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} (A:1-76) Length = 76 Score = 24.0 bits (52), Expect = 6.6 Identities = 10/46 (21%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + G+ V V+ I +DP L + G+ Sbjct: 22 IERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGF 67 >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} (A:) Length = 95 Score = 24.1 bits (52), Expect = 6.6 Identities = 7/46 (15%), Positives = 14/46 (30%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IEN + +++G+ V + D +A Sbjct: 34 IENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARL 79 >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} (A:) Length = 73 Score = 23.9 bits (52), Expect = 6.8 Identities = 11/46 (23%), Positives = 18/46 (39%), Gaps = 9/46 (19%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 +ENAV + G++ V+V + D + A GY Sbjct: 21 VENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVE--SALQKAGY 64 >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} (A:) Length = 72 Score = 24.0 bits (52), Expect = 7.3 Identities = 10/46 (21%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE + G+ + VS + +DP T A G+ Sbjct: 21 IEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGF 66 >2a9d_A Sulfite oxidase; molybdopterin, molybdenum, oxidoreductase; HET: MTE; 1.70A {Gallus gallus} (A:235-372) Length = 138 Score = 24.1 bits (52), Expect = 7.5 Identities = 11/52 (21%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 65 NDYMVKILMTLTAPGCPVAGDMPKWIENAV-GAVEGISGVEVSITFDPPWTP 115 + V+ +T PG V A G + V+VS+ W Sbjct: 15 QELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKV 66 >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} (A:329-466) Length = 138 Score = 24.1 bits (52), Expect = 7.5 Identities = 11/52 (21%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 65 NDYMVKILMTLTAPGCPVAGDMPKWIENAV-GAVEGISGVEVSITFDPPWTP 115 + V+ +T PG V A G + V+VS+ W Sbjct: 15 QELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKV 66 >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} (A:1-73) Length = 73 Score = 23.9 bits (52), Expect = 8.5 Identities = 5/19 (26%), Positives = 9/19 (47%) Query: 90 IENAVGAVEGISGVEVSIT 108 I+ + V GI+ + I Sbjct: 23 IKACLKNVPGINSLNFDIE 41 >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} (A:) Length = 79 Score = 23.6 bits (51), Expect = 8.6 Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE +G V G+ ++VS I +DP +EA G+ Sbjct: 26 IEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGF 71 >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* (A:1-112) Length = 112 Score = 23.7 bits (51), Expect = 8.6 Identities = 7/37 (18%), Positives = 10/37 (27%) Query: 81 PVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDL 117 P+A V +V + S P T Sbjct: 8 PIAPAKVLPDAQTVTSVRHWTDTLFSFRVTRPQTLRF 44 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.136 0.404 Gapped Lambda K H 0.267 0.0681 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,094,670 Number of extensions: 47510 Number of successful extensions: 177 Number of sequences better than 10.0: 1 Number of HSP's gapped: 175 Number of HSP's successfully gapped: 55 Length of query: 129 Length of database: 4,956,049 Length adjustment: 77 Effective length of query: 52 Effective length of database: 2,353,064 Effective search space: 122359328 Effective search space used: 122359328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.1 bits)