BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781063|ref|YP_003065476.1| hypothetical protein CLIBASIA_04825 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781063|ref|YP_003065476.1| hypothetical protein CLIBASIA_04825 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 260 bits (665), Expect = 5e-72, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYK 60 MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYK Sbjct: 1 MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYK 60 Query: 61 IDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSE 120 IDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSE Sbjct: 61 IDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSE 120 Query: 121 EAQIATGYY 129 EAQIATGYY Sbjct: 121 EAQIATGYY 129 >gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Score = 22.7 bits (47), Expect = 2.2, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%) Query: 67 YMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIAT 126 Y V L T+ PV G + A+ + SG++ IT D +S+ Q+A Sbjct: 237 YNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID-------ISKTTQLAG 289 Query: 127 GY 128 G+ Sbjct: 290 GF 291 >gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 744 Score = 22.3 bits (46), Expect = 2.9, Method: Composition-based stats. Identities = 7/22 (31%), Positives = 17/22 (77%) Query: 1 MKQKNPDTENNIADKIALSPES 22 +++ N DT +N++D+I +P++ Sbjct: 139 IEEVNTDTASNVSDQINQNPDT 160 >gi|254780458|ref|YP_003064871.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 449 Score = 21.2 bits (43), Expect = 5.9, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 21/47 (44%) Query: 34 NDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGC 80 ++I +KT EI F + L+ K D DY V+I GC Sbjct: 191 TEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGC 237 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 20.8 bits (42), Expect = 9.8, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 12 IADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCD 51 +AD + +P S + +++E+ D++ L + D I D Sbjct: 568 LADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD 607 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.136 0.404 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,324 Number of Sequences: 1233 Number of extensions: 3104 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 33 (17.3 bits)