RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str. psy62] (116 letters) >gnl|CDD|30664 COG0316, IscA, Uncharacterized conserved protein [Function unknown]. Length = 110 Score = 130 bits (329), Expect = 7e-32 Identities = 45/111 (40%), Positives = 71/111 (63%), Gaps = 1/111 (0%) Query: 1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60 + ++T+T+AA R+K ++ + G+R+ +K GGC+G +Y ++ D + D + E Sbjct: 1 AAMMITLTDAAAARVKALLAKEGEENLGLRVGVKGGGCSGFQYGLEFD-DEINEDDTVFE 59 Query: 61 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111 +DGVKV +D SL Y+ GTEID+ + L SGF F NPN S+CGCG+S + Sbjct: 60 QDGVKVVVDPKSLPYLEGTEIDYVEDLLGSGFTFKNPNAKSSCGCGESFSV 110 >gnl|CDD|36336 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain) [Inorganic ion transport and metabolism]. Length = 134 Score = 102 bits (255), Expect = 3e-23 Identities = 41/108 (37%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Query: 4 IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63 +T+T +AV IK+++ + + + +RI +K+ GC GL Y ++ T D+++E+DG Sbjct: 29 ALTLTPSAVNHIKQLL-SDKPEDVCLRIGVKQRGCNGLSYTLEY-TKTKGKFDEVVEQDG 86 Query: 64 VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111 V+++I+ +LL ++GTE+D+ +KL S FVF NPN CGCG+S + Sbjct: 87 VRIFIEPKALLTLIGTEMDYVDDKLSSEFVFSNPNAKGTCGCGESFSV 134 >gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis. This family is involved in iron-sulphur cluster biosynthesis. Its members include proteins that are involved in nitrogen fixation such as the HesB and HesB-like proteins. Length = 91 Score = 93.8 bits (234), Expect = 9e-21 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 2/93 (2%) Query: 5 VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64 +T+T+AA IK++ + +G G+RI ++ GGC+G Y + D +GD++ E+DGV Sbjct: 1 ITLTDAAAKWIKKL-LDLEGGENGLRIGVRYGGCSGFSYGLTFE-DEAGEGDEVFEQDGV 58 Query: 65 KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNP 97 V +D SL Y+ GTEIDF E L SGF F NP Sbjct: 59 TVVVDEKSLPYLEGTEIDFVEELLGSGFTFSNP 91 >gnl|CDD|36335 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster biosynthesis protein ISA2 (contains a HesB-like domain) [Energy production and conversion, Intracellular trafficking, secretion, and vesicular transport]. Length = 199 Score = 81.2 bits (200), Expect = 6e-17 Identities = 35/113 (30%), Positives = 65/113 (57%), Gaps = 7/113 (6%) Query: 2 SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-E 60 + ++++ R+KEI NS + +R++++ GGC+G +Y L DN ++ DD + Sbjct: 91 GFNLHLSDSCSKRLKEIYENSP---EFLRLTVEGGGCSGFQYKFRL--DNKINNDDRVFV 145 Query: 61 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGF-VFHNPNQVSACGCGQSVEIK 112 ++G +V +D+ SL + G +D+ E + S F + +NP+ C CG S +IK Sbjct: 146 ENGARVVVDNVSLNLLKGATVDYTNELIRSSFRIVNNPSAKQGCSCGSSFDIK 198 >gnl|CDD|32805 COG2986, HutH, Histidine ammonia-lyase [Amino acid transport and metabolism]. Length = 498 Score = 27.5 bits (61), Expect = 0.83 Identities = 16/84 (19%), Positives = 29/84 (34%), Gaps = 12/84 (14%) Query: 3 DIVTMTEAAVYRIKEIVFNSQG--------KAQGIRISLKKGGCAGLEYMVDLVTDN--P 52 D V+M A ++ EI+ N + AQ + + G + V + Sbjct: 414 DHVSMATHAARKLLEIIENLRTILAIELLAAAQAVDLRAPLDLSPGTKAAYAAVREKVPF 473 Query: 53 VDGDDLIEKDGVKV--WIDSASLL 74 +D D D + S +L+ Sbjct: 474 LDDDRPFAPDIEAAAALLASGALI 497 >gnl|CDD|36690 KOG1477, KOG1477, KOG1477, SPRY domain-containing proteins [General function prediction only]. Length = 469 Score = 26.5 bits (58), Expect = 1.7 Identities = 8/38 (21%), Positives = 12/38 (31%) Query: 73 LLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110 GTE+ + L + N N + VE Sbjct: 160 FFTKNGTEVGEIIKPLSPDLLEENGNLAWLFSPNEEVE 197 >gnl|CDD|143256 cd05848, Ig1_Contactin-5, First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord. Length = 94 Score = 25.3 bits (55), Expect = 4.0 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 78 GTEIDFKTEKLYS----GFVFHNPNQVSACG 104 GTEID +++ YS + NP++V G Sbjct: 42 GTEIDTESDYRYSLIDGNLIISNPSEVKDSG 72 >gnl|CDD|144450 pfam00858, ASC, Amiloride-sensitive sodium channel. Length = 441 Score = 24.7 bits (54), Expect = 5.4 Identities = 17/74 (22%), Positives = 25/74 (33%), Gaps = 10/74 (13%) Query: 19 VFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV---------WID 69 FNS + S + G GL ++D+ D + G KV ++D Sbjct: 178 TFNSGQTGKPPLRSSRPGPGYGLSLVLDVQQDE-YLYSPSTSEAGFKVLIHSPDEYPFVD 236 Query: 70 SASLLYMLGTEIDF 83 S GTE Sbjct: 237 SLGFSVPPGTETSI 250 >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 352 Score = 24.5 bits (54), Expect = 5.8 Identities = 18/71 (25%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Query: 5 VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEY-----MVDLVTDNPVDGDDLI 59 VT+ K+ FNS L G Y ++D D +LI Sbjct: 256 VTIVGDYKANYKKDTFNSWDNPSANARKLF-GSLGLWSYNYQFFLLDPNADWIEKCAELI 314 Query: 60 EKDGVKVWIDS 70 VK IDS Sbjct: 315 ADGKVKPPIDS 325 >gnl|CDD|35481 KOG0260, KOG0260, KOG0260, RNA polymerase II, large subunit [Transcription]. Length = 1605 Score = 24.6 bits (53), Expect = 5.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Query: 90 SGFVFHNPNQVSACGCGQSVEIKR 113 S F N +QVSAC Q+VE KR Sbjct: 749 SKGSFINISQVSACVGQQNVEGKR 772 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0810 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,338,726 Number of extensions: 61872 Number of successful extensions: 128 Number of sequences better than 10.0: 1 Number of HSP's gapped: 122 Number of HSP's successfully gapped: 11 Length of query: 116 Length of database: 6,263,737 Length adjustment: 81 Effective length of query: 35 Effective length of database: 4,513,408 Effective search space: 157969280 Effective search space used: 157969280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.3 bits)