RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str. psy62] (116 letters) >d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Score = 85.0 bits (210), Expect = 1e-18 Identities = 33/97 (34%), Positives = 58/97 (59%), Gaps = 2/97 (2%) Query: 5 VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64 +T++++A R+ + ++GK G+R+ ++ GC+G+ Y+++ D P D + E GV Sbjct: 2 ITLSDSAAARVNTFL-ANRGKGFGLRLGVRTSGCSGMAYVLEF-VDEPTPEDIVFEDKGV 59 Query: 65 KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVS 101 KV +D S+ ++ GT++DF E L GF F NPN Sbjct: 60 KVVVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKD 96 >d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Score = 80.2 bits (197), Expect = 4e-17 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 1/94 (1%) Query: 4 IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63 I +T+ AV IK++ + + +RI + GGC+G +Y + D + E DG Sbjct: 9 IFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEG-DHVFEYDG 67 Query: 64 VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNP 97 VKV ID S+ Y+ G E+D+ + + GF NP Sbjct: 68 VKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNP 101 >d2bsca1 b.2.3.5 (A:1-176) Fimbrial adhesin F17-AG lectin domain {Escherichia coli [TaxId: 562]} Length = 176 Score = 27.8 bits (61), Expect = 0.26 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Query: 33 LKKGGCAGLEYMVDLVTDNPVDGDD---LIEKDGVKVWIDSASLLYMLGTEIDFKT-EKL 88 + KG C GL+ VDL +DG L E+ G+ +W+ Y GT + + E + Sbjct: 48 ISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTK--YSRGTAMSGNSWENV 105 Query: 89 YSGF 92 +SG+ Sbjct: 106 FSGW 109 >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Length = 312 Score = 24.0 bits (51), Expect = 3.9 Identities = 4/23 (17%), Positives = 11/23 (47%) Query: 9 EAAVYRIKEIVFNSQGKAQGIRI 31 E V R++ ++ + + Q + Sbjct: 15 ETLVRRMERVIASGKTPFQDYFL 37 >d1qkia2 d.81.1.5 (A:200-434,A:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Score = 23.8 bits (51), Expect = 4.4 Identities = 4/22 (18%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Query: 49 TDNPVDGDDLIEKDGVKVWIDS 70 + P + D+L+++ G + + + Sbjct: 272 SRGPTEADELMKRVGFQ-YEGT 292 >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 336 Score = 22.6 bits (47), Expect = 8.2 Identities = 6/14 (42%), Positives = 9/14 (64%) Query: 88 LYSGFVFHNPNQVS 101 +YSGF+F P + Sbjct: 317 IYSGFIFKGPPLIK 330 >d1h9aa2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]} Length = 290 Score = 22.7 bits (48), Expect = 9.2 Identities = 5/17 (29%), Positives = 8/17 (47%), Gaps = 1/17 (5%) Query: 52 PVDGDDLIEKDGVKVWI 68 P D L+ +G W+ Sbjct: 272 PEASDKLLAANGDA-WV 287 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0514 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 445,235 Number of extensions: 18735 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 8 Length of query: 116 Length of database: 2,407,596 Length adjustment: 73 Effective length of query: 43 Effective length of database: 1,405,306 Effective search space: 60428158 Effective search space used: 60428158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.4 bits)