BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str. psy62] (116 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 239 bits (610), Expect = 9e-66, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%) Query: 1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE Sbjct: 1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60 Query: 61 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL Sbjct: 61 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116 >gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 109 Score = 84.0 bits (206), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 2/111 (1%) Query: 1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60 M I+ +T+AA +IK I+ S + +RI+++ GGC+G Y DL + D D + E Sbjct: 1 MVPIIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSED-DIVFE 58 Query: 61 KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111 K+G +++ID SL Y+ +EIDF L F NPN S CGCG S I Sbjct: 59 KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109 >gi|254780974|ref|YP_003065387.1| adenylosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 435 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 18/27 (66%) Query: 58 LIEKDGVKVWIDSASLLYMLGTEIDFK 84 L++++ +KVW + A L +L ++D + Sbjct: 377 LVQRNAMKVWKNGAIFLDVLLADVDIR 403 >gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 23.1 bits (48), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 4/36 (11%) Query: 54 DGDDLIEKDGVK---VWIDSASLLYMLGTEIDFKTE 86 + DD++EK+G+K + +++A L+ +L EI+ K E Sbjct: 279 ETDDIVEKEGIKRTFLEVENADLILLL-KEINSKKE 313 >gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Score = 22.3 bits (46), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 9 EAAVYRIKEIVFNSQGKAQGIRIS 32 E V RI+ IV S+G AQ + ++ Sbjct: 106 EELVARIRAIVRRSRGHAQSLIVT 129 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 21.9 bits (45), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 51 NPVDGDDLIEKDGVKVWIDSAS 72 N VDGDDL +++G + +D AS Sbjct: 76 NVVDGDDLEDEEGSEDSLDLAS 97 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.137 0.398 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,089 Number of Sequences: 1233 Number of extensions: 2775 Number of successful extensions: 8 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 116 length of database: 328,796 effective HSP length: 63 effective length of query: 53 effective length of database: 251,117 effective search space: 13309201 effective search space used: 13309201 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)