PSIBLAST alignment of GI: 254781067 and protein with PDB id: 3hks

>gi|260099974|pdb|3HKS|A Chain A, Crystal Structure Of Eukaryotic Translation Initiation Factor Eif-5a2 From Arabidopsis Thaliana Length = 167
>gi|260099975|pdb|3HKS|B Chain B, Crystal Structure Of Eukaryotic Translation Initiation Factor Eif-5a2 From Arabidopsis Thaliana Length = 167
 Score = 54.1 bits (129), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 28/80 (35%), Gaps = 1/80 (1%)

Query: 5   IASAVRKGNVLDVDGKLYIVLVAKNFHPGK-GTPITQVEMRRISDGVKVSNRWRTTEQVE 63
            A  +RKG  + +  +   V+       GK G          I    K+ +   ++   +
Sbjct: 30  SAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCD 89

Query: 64  RAFVEDQRFQFLYQDQEGFH 83
              V    +Q +   ++GF 
Sbjct: 90  VPHVNRVDYQLIDITEDGFV 109