RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 30.5 bits (68), Expect = 0.090 Identities = 10/67 (14%), Positives = 18/67 (26%), Gaps = 9/67 (13%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEE---SAQL------FSR 51 + L I V D + + Q I +P + SA ++ Sbjct: 251 KRRQLDARDIKVFVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFSERVEKYAE 310 Query: 52 TYIKNPK 58 + N Sbjct: 311 RFAPNAN 317 >1xvs_A Protein APAG; MCSG APC26324, midwest center for structural genomics, protein structure initiative, PSI, structural genomics, unknown function; 2.01A {Vibrio cholerae} (A:) Length = 126 Score = 25.1 bits (55), Expect = 4.0 Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Query: 6 VTSGINVNFSPVLDLLYGPE-TFIAQKRSIFS---RIPAKAEESAQLFSRTYI 54 I + Y E + +R +F+ I + ++ QL SR ++ Sbjct: 4 SLPCIKIQVQTR----YIEEQSNPEYQRFVFAYLITIKNLSSQTVQLXSRRWL 52 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.133 0.364 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 370,407 Number of extensions: 10798 Number of successful extensions: 13 Number of sequences better than 10.0: 1 Number of HSP's gapped: 13 Number of HSP's successfully gapped: 4 Length of query: 58 Length of database: 4,956,049 Length adjustment: 27 Effective length of query: 31 Effective length of database: 4,043,314 Effective search space: 125342734 Effective search space used: 125342734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.6 bits)