RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) >3f94_A Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 sheet, hydrolase; 2.30A {Pseudoalteromonas SP} PDB: 3f93_A Length = 822 Score = 33.4 bits (75), Expect = 0.012 Identities = 6/24 (25%), Positives = 13/24 (54%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGP 24 AK + +GI +F+P + ++ Sbjct: 146 TAKEVAATGIEWSFAPTVAVVRDD 169 >2x41_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2x40_A* 2x42_A* Length = 721 Score = 32.4 bits (73), Expect = 0.029 Identities = 6/33 (18%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGP------ETF 27 M + + G++V +P +++ P E + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLCGRNFEYY 135 >3bmx_A Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Length = 642 Score = 31.8 bits (71), Expect = 0.036 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 + K L GIN +FSPV+D+ P+ + RS FS Sbjct: 160 IGKELSALGINTDFSPVVDINNNPDNPVIGVRS-FSSNR 197 >2wt3_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2wt6_A 2x40_A 2x41_A* 2x42_A* 2wt5_A* Length = 721 Score = 30.9 bits (69), Expect = 0.069 Identities = 5/24 (20%), Positives = 13/24 (54%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGP 24 M + + G++V +P +++ P Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNP 126 >3abz_A Beta-glucosidase I; glycoside hydrolase family3 beta-glucosidase, PA14 domain, H; 2.15A {Kluyveromyces marxianus} PDB: 3ac0_A* Length = 845 Score = 30.4 bits (68), Expect = 0.11 Identities = 9/33 (27%), Positives = 13/33 (39%), Gaps = 6/33 (18%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGP------ETF 27 MAK + V P ++ GP E+F Sbjct: 86 MAKESIAKNAAVILGPTTNMQRGPLGGRGFESF 118 >1tza_A APAG protein, SOR45; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Shewanella oneidensis mr-1} SCOP: b.1.23.1 Length = 134 Score = 24.8 bits (54), Expect = 5.4 Identities = 11/53 (20%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Query: 6 VTSGINVNFSPVLDLLYGPE-TFIAQKRSIFS---RIPAKAEESAQLFSRTYI 54 + + I V Y + + ++ +FS I E++A+L +R +I Sbjct: 4 LDNSIRVEVKTE----YIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWI 52 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.133 0.364 Gapped Lambda K H 0.267 0.0426 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 434,460 Number of extensions: 13218 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 6 Length of query: 58 Length of database: 5,693,230 Length adjustment: 30 Effective length of query: 28 Effective length of database: 4,965,910 Effective search space: 139045480 Effective search space used: 139045480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.8 bits)