RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|37554 KOG2343, KOG2343, KOG2343, Glucose-repressible protein and related proteins [General function prediction only]. Length = 689 Score = 26.1 bits (57), Expect = 2.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Query: 50 IKPSRIESAYQRIIYLKNKMKT 71 IK + E YQR + + +++K Sbjct: 298 IKITGRELEYQRCLAVASRVKF 319 >gnl|CDD|146628 pfam04095, NAPRTase, Nicotinate phosphoribosyltransferase (NAPRTase) family. Nicotinate phosphoribosyltransferase (EC:2.4.2.11) is the rate limiting enzyme that catalyses the first reaction in the NAD salvage synthesis. This family also includes Pre-B cell enhancing factor that is a cytokine. This family is related to Quinolinate phosphoribosyltransferase pfam01729. Length = 243 Score = 26.2 bits (58), Expect = 2.2 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 30 DQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIY 64 D DP + E + AH S I ++ + +R+I+ Sbjct: 118 DSGDPVEWGEKLIAHFGSTNIDGYKVLN-TKRLIF 151 >gnl|CDD|29502 cd00801, INT_P4, Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.. Length = 357 Score = 25.2 bits (55), Expect = 3.7 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 34 PADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNK 68 P DVIE AHV G ++ +AY R YL+ + Sbjct: 319 PPDVIERQLAHVLGG-----KVRAAYNRADYLEER 348 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.134 0.400 Gapped Lambda K H 0.267 0.0691 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 831,641 Number of extensions: 32473 Number of successful extensions: 77 Number of sequences better than 10.0: 1 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 6 Length of query: 71 Length of database: 6,263,737 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,356,159 Effective search space: 155328611 Effective search space used: 155328611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.5 bits)