RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|169276 PRK08201, PRK08201, hypothetical protein; Provisional. Length = 456 Score = 25.9 bits (57), Expect = 2.3 Identities = 7/17 (41%), Positives = 14/17 (82%) Query: 31 QQDPADVIELIYAHVKS 47 QDP ++++LI AH+++ Sbjct: 333 DQDPQEILDLIEAHLQA 349 >gnl|CDD|170049 PRK09692, PRK09692, integrase; Provisional. Length = 413 Score = 25.4 bits (55), Expect = 3.1 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Query: 30 DQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNK 68 +Q P DVIE AHV E++ AY R YL+ + Sbjct: 349 EQGFPPDVIEAALAHVDKNEVR-----RAYNRSDYLEQR 382 >gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase. Cyanophycin synthesis is analogous to polyhydroxyalkanoic acid (PHA) biosynthesis, except that PHA polymers lack nitrogen and may be made under nitrogen-limiting conditions. Length = 864 Score = 25.5 bits (56), Expect = 3.2 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Query: 4 AFKALLALIACKWNLSRIIAVYNAGADQQDPADVIEL 40 A +A+ A I W R I V D++D D++E Sbjct: 743 AIEAVGAAIR-NWPARRRIGVIGGPGDRRD-EDLVEQ 777 >gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated. Length = 238 Score = 25.2 bits (56), Expect = 4.0 Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 27 AGADQQDPADVIELIYAHVKSGE 49 A + PADV I +++G+ Sbjct: 187 LDAPKASPADVARQILDALEAGD 209 >gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional. Length = 612 Score = 25.1 bits (55), Expect = 4.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 21 IIAVYNAGADQQDPADVIELIYAHV 45 I+A AG + DPA I+ I A V Sbjct: 544 IVAERAAGTSRADPAPAIDAIRAAV 568 >gnl|CDD|128484 smart00187, INB, Integrin beta subunits (N-terminal portion of extracellular region). Portion of beta integrins that lies N-terminal to their EGF-like repeats. Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Beta integrins are proposed to have a von Willebrand factor type-A "insert" or "I" -like domain (although this remains to be confirmed). Length = 423 Score = 24.6 bits (54), Expect = 5.5 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 14/48 (29%) Query: 16 WNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRII 63 LS +I + G +D ++V+EL I+ AY +I Sbjct: 306 KELSALIPGSSVGVLSEDSSNVVEL--------------IKDAYNKIS 339 >gnl|CDD|150028 pfam09205, DUF1955, Domain of unknown function (DUF1955). Members of this family are found in hypothetical proteins synthesized by the Archaeal organism Sulfolobus. Their exact function has not, as yet, been determined. Length = 160 Score = 24.8 bits (54), Expect = 5.7 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Query: 31 QQDPADVIELIYAHVKSGEIKPS---RIESAYQRI 62 QQ D ++ I A + + EI P +I +AY++I Sbjct: 98 QQGKKDQLDKILAELFNEEIPPEILLKIANAYKKI 132 >gnl|CDD|185619 PTZ00440, PTZ00440, reticulocyte binding protein 2-like protein; Provisional. Length = 2722 Score = 24.4 bits (53), Expect = 5.9 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 36 DVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT 71 D+IELI +K K IE + I L KMKT Sbjct: 1024 DIIELIDKLIKE---KGKEIEEKVDQYISLLEKMKT 1056 >gnl|CDD|152545 pfam12110, Nup96, Nuclear protein 96. Nup96 (often known by the name of its yeast homolog Nup145C) is part of the Nup84 heptameric complex in the nuclear pore complex. Nup96 complexes with Sec13 in the middle of the heptamer. The function of the heptamer is to coat the curvature of the nuclear pore complex between the inner and outer nuclear membranes. Nup96 is predicted to be an alpha helical solenoid. The interaction between Nup96 and Sec13 is the point of curvature in the heptameric complex. Length = 287 Score = 24.2 bits (53), Expect = 7.8 Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 15 KWNLSRIIAVYNAGADQQDPADVIELIYA 43 W+L ++++ D D AD + L +A Sbjct: 185 SWHLCQVLSAVGYRHDSDDIADQLTLSFA 213 >gnl|CDD|129003 smart00764, Citrate_ly_lig, Citrate lyase ligase C-terminal domain. Proteins of this family contain the C-terminal domain of citrate lyase ligase EC:6.2.1.22. Length = 182 Score = 24.1 bits (53), Expect = 8.5 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 18 LSRIIAVYNAGADQQDPADVIELI 41 S + A+YN Q + IE++ Sbjct: 118 FSPVTAIYNQTMKQTLLSPAIEVV 141 >gnl|CDD|178309 PLN02707, PLN02707, Soluble inorganic pyrophosphatase. Length = 267 Score = 23.9 bits (52), Expect = 9.6 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 33 DPADVIELIYAHVKSGEIKP 52 DP DV+E+ K GE+ Sbjct: 142 DPVDVVEIGERAAKIGEVLK 161 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.134 0.400 Gapped Lambda K H 0.267 0.0769 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,148,500 Number of extensions: 56426 Number of successful extensions: 148 Number of sequences better than 10.0: 1 Number of HSP's gapped: 148 Number of HSP's successfully gapped: 24 Length of query: 71 Length of database: 5,994,473 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,086,937 Effective search space: 147521173 Effective search space used: 147521173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.0 bits)