RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >3bmx_A Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Length = 642 Score = 31.8 bits (71), Expect = 0.036 Identities = 16/47 (34%), Positives = 27/47 (57%) Query: 23 AVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKM 69 A + ++Q A VI+ + VK+G+I +I ++ +RII LK K Sbjct: 350 ASVTSLKEEQKFARVIQALKEAVKNGDIPEQQINNSVERIISLKIKR 396 >2x41_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2x40_A* 2x42_A* Length = 721 Score = 31.2 bits (70), Expect = 0.056 Identities = 7/37 (18%), Positives = 16/37 (43%) Query: 33 DPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKM 69 + D IE I +K G++ ++ + I+ + Sbjct: 271 ERRDEIEEIMEALKEGKLSEEVLDECVRNILKVLVNA 307 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 27.1 bits (59), Expect = 1.0 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 21 IIAVYNAGADQQDPADVIELIYAHVKSG 48 I+ +N G+ +QD +IE IY K+G Sbjct: 534 IVVPFNQGS-KQDVEALIEFIYDTEKNG 560 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.9 bits (58), Expect = 1.3 Identities = 11/38 (28%), Positives = 15/38 (39%), Gaps = 13/38 (34%) Query: 2 RWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIE 39 + A K L A S + +Y AD PA I+ Sbjct: 19 KQALKKLQA--------S--LKLY---ADDSAPALAIK 43 >2wt3_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2wt6_A 2x40_A 2x41_A* 2x42_A* 2wt5_A* Length = 721 Score = 25.5 bits (55), Expect = 2.8 Identities = 11/79 (13%), Positives = 24/79 (30%), Gaps = 14/79 (17%) Query: 2 RWAFKALLALIACKW-NLSRIIAVYNAGADQQDPADVIEL----------IYAHVKSGEI 50 W F+ + W + AG D P ++ I +K G++ Sbjct: 232 EWGFEGF---VMSDWYAGDNPVEQLKAGNDLIMPGKAYQVNTERRDEIEEIMEALKEGKL 288 Query: 51 KPSRIESAYQRIIYLKNKM 69 ++ + I+ + Sbjct: 289 SEEVLDECVRNILKVLVNA 307 >1e9g_A Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae} SCOP: b.40.5.1 PDB: 1e6a_A* 1wgi_A 1wgj_A 2ihp_A* 8prk_A 2ik6_A 2ik2_A 2ik4_A 117e_A 2ik1_A* 2ik9_A 2ik0_A 2ik7_A 1m38_A 1ypp_A 1huk_A 1huj_A 1pyp_A Length = 286 Score = 24.5 bits (53), Expect = 5.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 33 DPADVIELIYAHVKSGEIKPSRI 55 DP DV+E+ +G++K + Sbjct: 117 DPIDVLEIGETIAYTGQVKQVKA 139 >3fq3_A Inorganic pyrophosphatase:bacterial/archaeal inorganic pyrophosphatase; ssgcid, inorganic phosphatase, hydrolase; 1.90A {Brucella melitensis biovar ABORTUS2308} Length = 197 Score = 24.4 bits (53), Expect = 7.2 Identities = 6/27 (22%), Positives = 11/27 (40%) Query: 29 ADQQDPADVIELIYAHVKSGEIKPSRI 55 ++ DP DV+ + G + R Sbjct: 85 SEDGDPIDVLVCNTRPLIPGCVINVRP 111 >3ld3_A Inorganic pyrophosphatase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.75A {Anaplasma phagocytophilum} PDB: 3lo0_A Length = 199 Score = 24.4 bits (53), Expect = 7.4 Identities = 9/27 (33%), Positives = 11/27 (40%) Query: 29 ADQQDPADVIELIYAHVKSGEIKPSRI 55 A DP DV+ L V G + R Sbjct: 85 AGDGDPVDVLVLARFPVMPGAVICVRP 111 >1ecm_A Endo-oxabicyclic transition state analogue; P-protein, chorismate mutase domain; HET: TSA; 2.20A {Escherichia coli} SCOP: a.130.1.1 Length = 109 Score = 24.0 bits (52), Expect = 8.2 Identities = 14/63 (22%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Query: 6 KALLALIACKWNLSRIIAVYNAGADQQ--DP---ADVIELIYAHVKSGEIKPSRIESAYQ 60 + LLAL+A + L+ + + + D D++E + K+ + I +Q Sbjct: 19 EKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQ 78 Query: 61 RII 63 II Sbjct: 79 LII 81 >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium LT2} Length = 358 Score = 23.9 bits (51), Expect = 8.5 Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Query: 43 AHVKSGEIKPSRIESAYQRII 63 V++G I +R E+ Y RI+ Sbjct: 322 EAVENGAIAETRFEN-YHRIL 341 >1v2b_A 23-kDa polypeptide of photosystem II oxygen- evolving complex; alpha-beta, riken structural genomics/proteomics initiative, RSGI; HET: GLC; 1.60A {Nicotiana tabacum} SCOP: d.107.1.2 Length = 177 Score = 23.9 bits (51), Expect = 8.7 Identities = 6/37 (16%), Positives = 13/37 (35%) Query: 15 KWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIK 51 KWN ++ + +D D + + + K Sbjct: 24 KWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKK 60 >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Score = 23.9 bits (51), Expect = 8.9 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query: 45 VKSGEIKPSRIESAYQRIIY-LKNKMK 70 V++GEI SR E+ Y ++ Y L + K Sbjct: 275 VENGEIAESRYEN-YVKMFYELLGRRK 300 >1m2d_A [2Fe-2S] ferredoxin; thioredoxin-like fold, [2Fe-2S] cluster, Cys59Ser variant, electron transport; 1.05A {Aquifex aeolicus} SCOP: c.47.1.11 PDB: 1m2a_A 1f37_A 1m2b_A Length = 110 Score = 23.8 bits (51), Expect = 9.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 33 DPADVIELIYAHVKSGEI 50 P DV E++ H+K GE Sbjct: 78 KPEDVDEIVEKHLKGGEP 95 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.134 0.400 Gapped Lambda K H 0.267 0.0657 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 607,435 Number of extensions: 20905 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 22 Length of query: 71 Length of database: 5,693,230 Length adjustment: 41 Effective length of query: 30 Effective length of database: 4,699,226 Effective search space: 140976780 Effective search space used: 140976780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.2 bits)