BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 146 bits (369), Expect = 6e-38, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQ 60 MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQ Sbjct: 1 MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQ 60 Query: 61 RIIYLKNKMKT 71 RIIYLKNKMKT Sbjct: 61 RIIYLKNKMKT 71 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 25 YNAGADQQDPADVIELIYAHVKSGEIKPSRIESA 58 ++ G + D DV+ IYA G PSR + A Sbjct: 122 WDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGA 155 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 20.0 bits (40), Expect = 8.5, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 8 LLALIACKWNLSRIIAVYNAGADQQDPADVIELIY 42 L A + KWN+ + ++ G Q+ +++IY Sbjct: 697 LSADASLKWNMRAELPSHSIGLAYQNDCATVKIIY 731 >gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 19.6 bits (39), Expect = 9.6, Method: Composition-based stats. Identities = 6/16 (37%), Positives = 12/16 (75%) Query: 42 YAHVKSGEIKPSRIES 57 +AHVK G ++ S +++ Sbjct: 212 FAHVKQGYLEASNVDA 227 >gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 19.6 bits (39), Expect = 9.6, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 35 ADVIELIYAHVKSGEIK 51 +D EL+Y H + GE + Sbjct: 441 SDDSELLYIHARFGETR 457 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.134 0.400 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,765 Number of Sequences: 1233 Number of extensions: 1317 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 31 (16.5 bits)