BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] (190 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 378 bits (970), Expect = e-107, Method: Compositional matrix adjust. Identities = 190/190 (100%), Positives = 190/190 (100%) Query: 1 MGYSVSASNNDTSKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYG 60 MGYSVSASNNDTSKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYG Sbjct: 1 MGYSVSASNNDTSKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYG 60 Query: 61 AYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEIT 120 AYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEIT Sbjct: 61 AYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEIT 120 Query: 121 KAVDTLTRAYNEYKKEIRELIEEFIELGFDQCDECDLCSEKADVIQKKRIAFEMVEREFA 180 KAVDTLTRAYNEYKKEIRELIEEFIELGFDQCDECDLCSEKADVIQKKRIAFEMVEREFA Sbjct: 121 KAVDTLTRAYNEYKKEIRELIEEFIELGFDQCDECDLCSEKADVIQKKRIAFEMVEREFA 180 Query: 181 EKLEGKFVRK 190 EKLEGKFVRK Sbjct: 181 EKLEGKFVRK 190 >gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 25.4 bits (54), Expect = 0.65, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query: 5 VSASNNDTSKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDK 64 V S+N S +P K + LQIR +SV+ F +++E+ + ++D + G + Sbjct: 257 VVVSSNQGSAVPKGKIKALLQIR--DSVV-PIFQNQLDEMARVLIGSFSEKDPIAGNSEN 313 Query: 65 V 65 V Sbjct: 314 V 314 >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 22.7 bits (47), Expect = 3.8, Method: Compositional matrix adjust. Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 110 GKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIELGFD 150 G S ++E + V + + Y Y + ELIE FD Sbjct: 27 GLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFD 67 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 22.3 bits (46), Expect = 5.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%) Query: 130 YNEYKKEIRELIEEFIELGFDQCDECDLCSEKADVIQKKRIA 171 Y K+ I+EL EFIE+ + + DV+++K A Sbjct: 50 YVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTA 91 >gi|254781004|ref|YP_003065417.1| threonyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 22.3 bits (46), Expect = 5.5, Method: Compositional matrix adjust. Identities = 16/69 (23%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Query: 77 KAFYIDFRTE----LKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNE 132 AFY++ +E + +A+ + + + E G + + I V T+T + E Sbjct: 507 NAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVE 566 Query: 133 YKKEIRELI 141 Y +EI L+ Sbjct: 567 YAQEIANLL 575 >gi|254780899|ref|YP_003065312.1| methionine aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 22.3 bits (46), Expect = 5.7, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 4/62 (6%) Query: 91 KALTKYYKS----VVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIE 146 KA+ +Y S VV G+GKS E EI D L + +++ + IE + Sbjct: 158 KAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLN 217 Query: 147 LG 148 +G Sbjct: 218 VG 219 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.132 0.356 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 112,571 Number of Sequences: 1233 Number of extensions: 4222 Number of successful extensions: 30 Number of sequences better than 100.0: 18 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 18 length of query: 190 length of database: 328,796 effective HSP length: 69 effective length of query: 121 effective length of database: 243,719 effective search space: 29489999 effective search space used: 29489999 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 36 (18.5 bits)