HHsearch alignment for GI: 254781073 and conserved domain: COG0408

>COG0408 HemF Coproporphyrinogen III oxidase [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=908.49  Aligned_cols=272  Identities=47%  Similarity=0.902  Sum_probs=264.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEEEEE
Q ss_conf             66999999999999999999999999630102222344566512521231788888777504899505946536887776
Q gi|254781073|r   13 DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVS   92 (307)
Q Consensus        13 ~ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGVNfS   92 (307)
T Consensus         2 ~~~~~~~~~~~~~~~Lqd~Ic~~le~~dg~~----------~F~~d~W~r~~g~----GgG~~~vl~~G~vFEk~GVn~S   67 (303)
T COG0408           2 DIEPDKQAVKAWLLNLQDEICAALEALDGEA----------KFVEDSWQREEGG----GGGRSRVLMDGAVFEKGGVNFS   67 (303)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCE----------EEECCCCCCCCCC----CCCEEEEEECCCEEEECCCEEE
T ss_conf             8522899999999999999999998526640----------6740322246898----8872588722734663372158


Q ss_pred             EEECCCHHHHHHHHHHCCCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEECC------CCCCCCCCCCCCCCHHHCCCH
Q ss_conf             30035426776421110267651000002233136887440102302102024------312532001100000110432
Q gi|254781073|r   93 TVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYD  166 (307)
Q Consensus        93 ~V~G~~~p~~a~~i~g~~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~~------~WFGGG~DLTP~~~~~~y~~~  166 (307)
T Consensus        68 ~V~G~~~P~~~~~~rp~~~g~~F~A~GiSlV~HP~NP~vPt~H~N~R~f~a~~~~~~~vwWFGGG~DLTP~-----y~~~  142 (303)
T COG0408          68 TVFGEFSPESATAMRPELAGRRFFATGISLVAHPKNPYVPTVHLNVRYFEAEKPGAEPVWWFGGGADLTPY-----YGFE  142 (303)
T ss_pred             EEECCCCCHHHHHCCCHHCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEECCCCCCCEEECCCCCCCCC-----CCCH
T ss_conf             87446680787638830028863653116997258999874231478999745888754565477567545-----6623


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             67999999998403656733428999976787434532521234301010147866658967799999999999999999
Q gi|254781073|r  167 PDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP  246 (307)
Q Consensus       167 eD~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg~~fl~~y~  246 (307)
T Consensus       143 eD~~hfH~~~k~aC~~~~~~~YprfK~WCDeYFyLkHR~E~RGiGGiFfD~l~~~----~~~~~Faf~qdvG~afl~aY~  218 (303)
T COG0408         143 EDAVHFHRAAKDACDPHGPEDYPRFKKWCDEYFYLKHRNEPRGIGGIFFDDLNEP----DFERDFAFTQDVGKAFLPAYL  218 (303)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHEEECCCCCCCCCCEEECCCCCCC----CHHHHHHHHHHHHHHHHHHHH
T ss_conf             6779999999997531782340688876355433014677777650531335678----989989999998777766437


Q ss_pred             HHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCHHHEEECCCCCCCCC
Q ss_conf             9998754799998999885420240112211110255357357888111411288878897
Q gi|254781073|r  247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP  307 (307)
Q Consensus       247 ~Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esIl~SlPp~~~Wp  307 (307)
T Consensus       219 pIV~~r~~~~~te~er~fQl~RRGRYVEFNLvyDRGT~FGLqTgGr~ESILmSlPP~vrW~  279 (303)
T COG0408         219 PIVERRKNMPWTEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRVESILMSLPPLVRWE  279 (303)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHCCCEEEEEEEEECCCEEEECCCCCHHHHHHCCCCCCCCC
T ss_conf             9998743899865677788886153379998874463675126973655764299534256