HHsearch alignment of GI: 254781073 and MMDB domain: 1vju_A_1-232

>1vju_A (A:1-232) Coproporphyrinogen III oxidase; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.40A {Leishmania major}
Probab=100.00  E-value=0  Score=687.51  Aligned_cols=224  Identities=34%  Similarity=0.666  Sum_probs=215.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEE
Q ss_conf             89687669999999999999999999999996301022223445665125212317888887775048995059465368
Q gi|254781073|r    8 IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA   87 (307)
Q Consensus         8 ~~~p~~ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKa   87 (307)
                      -.++.+.+.++..+++||+.||++||++||+||++          ++|++|.|+|++|     |||++|||++|+|||||
T Consensus         3 ~~~~~~~~~~r~~~~~~~~~lQ~~I~~~le~~dg~----------a~F~~d~W~R~~G-----gGG~t~vl~~G~VFEKa   67 (232)
T 1vju_A            3 HHHHHHXSLAVEAVKDFLLKLQDDICEALEAEDGQ----------ATFVEDKWTREGG-----GGGRTRVXVDGAVIEKG   67 (232)
T ss_dssp             -----CCHHHHHHHHHHHHHHHHHHHHHHHHHHSS----------CCCEEEEEEETTT-----EEEEEEEEESCSSEEEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC----------CCEEECCCCCCCC-----CCCCEEEEECCEEEEEC
T ss_conf             53200153679999999999999999999964078----------8754545547875-----55414898668357743


Q ss_pred             EEEEEEEECCCHHHHHHHHHHCCCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEECC------CCCCCCCCCCCCCCHH
Q ss_conf             8777630035426776421110267651000002233136887440102302102024------3125320011000001
Q gi|254781073|r   88 AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESR  161 (307)
Q Consensus        88 GVNfS~V~G~~~p~~a~~i~g~~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~~------~WFGGG~DLTP~~~~~  161 (307)
                      |||||+|+|+++|++++++++..++.+|+|||||||+||+||+|||+|||+|||++.+      ||||||+|||||    
T Consensus        68 gVN~S~V~G~~~p~~a~~~~~~~~~~~f~A~GiSlViHP~NP~vPTvH~N~R~f~~~~~~~~~~~WFGGG~DLTP~----  143 (232)
T 1vju_A           68 GVNFSHVYGKGLPXSSTERHPDIAGCNFEAXGVSLVIHPKNPHVPTSHANVRLFVAEREGKEPVWWFGGGFDLTPY----  143 (232)
T ss_dssp             EEEEEEEEEEC-----------CTTCEEEEEEEEEEEEESSTTSCEEEEEEEEEEEEETTEEEEEEEEEEEEEECS----
T ss_pred             CEEEEEEEECCCCHHHHHHCCCCCCCCCEEECCHHHHCCCCCCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCHH----
T ss_conf             3417999904641023430444478751441211010135887762234469999825998614899764252166----


Q ss_pred             HCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             10432679999999984036567334289999767874345325212343010101478666589677999999999999
Q gi|254781073|r  162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF  241 (307)
Q Consensus       162 ~y~~~eD~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg~~f  241 (307)
                       |+++||++|||+++|++||+|++++|++||+|||+|||||||+|+||||||||||||+    +++|++|+|+++||++|
T Consensus       144 -y~~~eD~~hFH~~~K~aCd~~~~~~Y~~fK~wCD~YFyi~HR~E~RGIGGIFfDdl~~----~~~e~~f~f~~~vg~af  218 (232)
T 1vju_A          144 -YAVEEDCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGY  218 (232)
T ss_dssp             -SCCHHHHHHHHHHHHHHHGGGCTTHHHHHHHHHHHHSEEGGGTEESSSEEEEEEEECS----SCHHHHHHHHHHHHHHH
T ss_pred             -HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHEECCHHHCCCCCCHHHHHHHCC----CCCCHHHHHHHHHHHHH
T ss_conf             -7779999999999998735110112167787633524240330245532100113306----76420089999999999


Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             99999999875479
Q gi|254781073|r  242 IKLYPSLVRRNYHH  255 (307)
Q Consensus       242 l~~y~~Iv~~r~~~  255 (307)
                      |++|+|||+||+++
T Consensus       219 l~aY~pIv~kr~~t  232 (232)
T 1vju_A          219 XDAYIPIVNRRKNT  232 (232)
T ss_dssp             HHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             99889999986379