Query         gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 307
No_of_seqs    154 out of 1016
Neff          5.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:19:05 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781073.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1vjua_ d.248.1.1 (A:) Hypothe 100.0       0       0  920.5  21.1  270   14-307     2-277 (302)
  2 d1tkla_ d.248.1.1 (A:) Copropo 100.0       0       0  906.7  17.3  272   11-307     4-299 (325)
  3 d1ci4a_ a.60.5.1 (A:) Barrier-  57.6     3.3 0.00024   19.0   2.6   32  167-198    54-88  (89)
  4 d1bgva1 c.2.1.7 (A:195-449) Gl  24.3      19  0.0014   14.1   2.8   55  233-289   176-230 (255)
  5 d2fkla1 d.230.3.1 (A:126-189)   18.3      18  0.0013   14.3   0.9   18  167-184    20-37  (64)
  6 d1zrua3 b.163.1.2 (A:2-140) Re  17.0      27  0.0019   13.1   2.7   36   52-87     34-69  (139)
  7 d2icya1 b.81.1.4 (A:384-466) U  16.2      20  0.0015   13.8   0.8   13  143-155    42-54  (83)
  8 d2jfga2 c.59.1.1 (A:298-437) U  15.0      17  0.0012   14.4   0.1   20  163-182    70-89  (140)
  9 d1tz9a_ c.1.15.6 (A:) Mannonat  14.5      31  0.0023   12.7   6.7   89  116-218   198-288 (353)
 10 d1mlia_ d.58.4.1 (A:) Muconala  14.1      13 0.00095   15.1  -0.7   43  259-301    27-72  (96)

No 1  
>d1vjua_ d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishmania major [TaxId: 5664]}
Probab=100.00  E-value=0  Score=920.45  Aligned_cols=270  Identities=39%  Similarity=0.751  Sum_probs=259.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEEEEEE
Q ss_conf             69999999999999999999999996301022223445665125212317888887775048995059465368877763
Q gi|254781073|r   14 IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVST   93 (307)
Q Consensus        14 ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGVNfS~   93 (307)
                      |.++.+.+++||++||++||++||++|++          ++|++|.|+|++|     |||+||||++|+||||||||||+
T Consensus         2 m~~~ie~vk~~F~~LQ~~Ic~~lE~le~~----------~~F~~d~W~R~~G-----GGG~t~Vl~~G~VFEKaGVNfS~   66 (302)
T d1vjua_           2 MSLAVEAVKDFLLKLQDDICEALEAEDGQ----------ATFVEDKWTREGG-----GGGRTRVMVDGAVIEKGGVNFSH   66 (302)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHSS----------CCCEEEEEEETTT-----EEEEEEEEESCSSEEEEEEEEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCC----------CCEEEECCCCCCC-----CCCEEEEEECCEEEEECCEEEEE
T ss_conf             76679999999999999999999964077----------8746604303799-----99748997078256644341799


Q ss_pred             EECCCHHHHHHHHHHCCCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEECC------CCCCCCCCCCCCCCHHHCCCHH
Q ss_conf             0035426776421110267651000002233136887440102302102024------3125320011000001104326
Q gi|254781073|r   94 VYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDP  167 (307)
Q Consensus        94 V~G~~~p~~a~~i~g~~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~~------~WFGGG~DLTP~~~~~~y~~~e  167 (307)
                      |+|+++|+++.++++..++.+|||||||||+||+||+|||+|||+|||+|.+      ||||||+|||||     |+++|
T Consensus        67 V~G~~lP~sa~~~~~~~~~~~f~AtGiSvV~HP~NP~vPt~H~N~R~f~~~~~~~~~~wWFGGG~DLTP~-----~~~~~  141 (302)
T d1vjua_          67 VYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANVRLFVAEREGKEPVWWFGGGFDLTPY-----YAVEE  141 (302)
T ss_dssp             EEEEC-----------CTTCEEEEEEEEEEEEESSTTSCEEEEEEEEEEEEETTEEEEEEEEEEEEEECS-----SCCHH
T ss_pred             EECCCCHHHHHHCCCCCCCCCEEEECCEEEEECCCCCCCCEEECEEEEEEECCCCCCEEEEECCCCCHHH-----HHHHH
T ss_conf             9854624444421654467740542100000126876761331314899844898621687055451166-----77699


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79999999984036567334289999767874345325212343010101478666589677999999999999999999
Q gi|254781073|r  168 DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS  247 (307)
Q Consensus       168 D~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg~~fl~~y~~  247 (307)
                      |+++||++||++||+|+++||++||+|||+|||||||+|+|||||||||||++    .+++++|+|+++||++|+++|+|
T Consensus       142 D~~~fH~~~K~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGiGGIFfD~l~~----~~~~~~~~f~~~vg~~fl~~Y~~  217 (302)
T d1vjua_         142 DCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGYMDAYIP  217 (302)
T ss_dssp             HHHHHHHHHHHHHGGGCTTHHHHHHHHHHHHSEEGGGTEESSSEEEEEEEECS----SCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHCCEEECCCCCCCCCCCEEEEEEECC----CCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998626440012356765402046434212345533043420026----98788799999999999999999


Q ss_pred             HHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCHHHEEECCCCCCCCC
Q ss_conf             998754799998999885420240112211110255357357888111411288878897
Q gi|254781073|r  248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP  307 (307)
Q Consensus       248 Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esIl~SlPp~~~Wp  307 (307)
                      ||+||++++||++||+|||+||||||||||||||||+|||+||||||||||||||+|+|.
T Consensus       218 Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esILmSlPp~~~W~  277 (302)
T d1vjua_         218 IVNRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARWG  277 (302)
T ss_dssp             HHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHTTCCHHHHGGGSCSCCCCC
T ss_pred             HHHHHCCCCCCHHHHHHHHHHCCEEEEEEEEEECCCHHHCCCCCCHHEEEECCCCCCCCC
T ss_conf             999860799878999999985867689999975685020326996110022599768625


No 2  
>d1tkla_ d.248.1.1 (A:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=100.00  E-value=0  Score=906.70  Aligned_cols=272  Identities=40%  Similarity=0.762  Sum_probs=254.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEEE
Q ss_conf             87669999999999999999999999996301022223445665125212317888887775048995059465368877
Q gi|254781073|r   11 PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVL   90 (307)
Q Consensus        11 p~~ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGVN   90 (307)
                      |.++.+ ++.+++||++||++||++||+||+.           +|++|.|+|+++    +|||+||||++|+||||||||
T Consensus         4 p~~~~m-r~~~e~~~~~lQ~~Ic~~lE~ld~~-----------~F~~d~W~R~~~----gGGG~s~vl~~G~VfEKaGVN   67 (325)
T d1tkla_           4 PRNLPI-RQQMEALIRRKQAEITQGLESIDTV-----------KFHADTWTRGND----GGGGTSMVIQDGTTFEKGGVN   67 (325)
T ss_dssp             GGGSCH-HHHHHHHHHHHHHHHHHHHHTTSSS-----------CCEEEEEECGGG----CEEEEEEEEESCSSEEEEEEE
T ss_pred             CCCCHH-HHHHHHHHHHHHHHHHHHHHHHCCC-----------CCEEECCCCCCC----CCCCEEEEECCCCEEEEEEEE
T ss_conf             440329-9999999999999999999975078-----------716445432799----988569997599478864589


Q ss_pred             EEEEECCCHHHHHHHHHHCCC----------------CCCCEEECEEEEEECCCCCCCHHHCCHHHEEEC-------CCC
Q ss_conf             763003542677642111026----------------765100000223313688744010230210202-------431
Q gi|254781073|r   91 VSTVYGDLSPDFKDQILGTTK----------------NPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-------AYW  147 (307)
Q Consensus        91 fS~V~G~~~p~~a~~i~g~~~----------------~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~-------~~W  147 (307)
                      ||+|+|+++|+++.++++..+                +.+|||||||||+||+||+|||+|||+|||+|.       .||
T Consensus        68 ~S~V~G~~~p~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~f~AtGiSlViHP~NP~vPt~H~N~R~f~~~~~~~~~~~wW  147 (325)
T d1tkla_          68 VSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAPTTHLNYRYFETWNQDGTPQTWW  147 (325)
T ss_dssp             EEEEEEEECHHHHTTTGGGCTTCCCCCCSSSSCCCSSCEEEEEEEEEEEEEESSTTSCEEEEEEEEEEEECTTSCEEEEE
T ss_pred             EEEEEEECCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEHCCCCCCCCHHCCCCEEEEEECCCCCCCEEE
T ss_conf             99998536989998503112355675422236743357750574103000025787401023422799754788754048


Q ss_pred             CCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCH
Q ss_conf             25320011000001104326799999999840365673342899997678743453252123430101014786665896
Q gi|254781073|r  148 FGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGI  227 (307)
Q Consensus       148 FGGG~DLTP~~~~~~y~~~eD~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~  227 (307)
                      ||||+|||||     |+++||+++||++||++||+|+++||++||||||+|||||||+|+|||||||||||++    .++
T Consensus       148 FGGG~DLTP~-----y~~~eD~~~fH~~lK~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFfD~l~~----~~~  218 (325)
T d1tkla_         148 FGGGADLTPS-----YLYEEDGQLFHQLHKDALDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDE----RDP  218 (325)
T ss_dssp             EEEEEEEECS-----SCCHHHHHHHHHHHHHHHHTTCTTHHHHHHHHHHHHTEEGGGTEESSCCEEEEEEECS----SCH
T ss_pred             EEEEECCCCC-----CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCC----CCH
T ss_conf             8400113301-----3315889999999988750478788899998765522554102245410112455514----641


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCC-CCCHHHEEECCCCCCCC
Q ss_conf             77999999999999999999998754799998999885420240112211110255357357-88811141128887889
Q gi|254781073|r  228 DADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW  306 (307)
Q Consensus       228 e~~f~f~~~vg~~fl~~y~~Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t-~gr~esIl~SlPp~~~W  306 (307)
                      |++|+|+++||++||++|+|||++|++++||++||+|||+||||||||||||||||+|||+| |||||||||||||+|+|
T Consensus       219 e~~f~f~~~vg~~fl~~Y~~Iv~kr~~~~~t~~~r~~Ql~rRGRYvEFNLlyDRGT~FGL~t~G~r~esILmSlPp~a~W  298 (325)
T d1tkla_         219 QEILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASW  298 (325)
T ss_dssp             HHHHHHHHHHHTTHHHHHHHHHHTTTTSCCCHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHSTTCCHHHHGGGSCSEEEC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEEEEECCCEEEEECCCCCCEEEEECCCCCCEE
T ss_conf             78999999987767999999999843563007899999984772489999962584130024998700477538987722


Q ss_pred             C
Q ss_conf             7
Q gi|254781073|r  307 P  307 (307)
Q Consensus       307 p  307 (307)
                      .
T Consensus       299 ~  299 (325)
T d1tkla_         299 L  299 (325)
T ss_dssp             C
T ss_pred             E
T ss_conf             0


No 3  
>d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
Probab=57.63  E-value=3.3  Score=18.99  Aligned_cols=32  Identities=28%  Similarity=0.714  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHCCCC---CHHHHHHHHHHHHHH
Q ss_conf             67999999998403656---733428999976787
Q gi|254781073|r  167 PDVIFFHNTLKEMCSQH---AVANYTHYKEWCDRY  198 (307)
Q Consensus       167 eD~~~fH~~~k~~Cd~~---~~~~Y~~fKk~CD~Y  198 (307)
                      .|-..|-.-+|+.|...   ..+-|.-.|.|||++
T Consensus        54 kde~~F~~Wlk~~~gAn~kq~~dcy~cLkeWCd~f   88 (89)
T d1ci4a_          54 KDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF   88 (89)
T ss_dssp             TCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             74999999999980889899999999999999972


No 4  
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]}
Probab=24.25  E-value=19  Score=14.07  Aligned_cols=55  Identities=5%  Similarity=-0.013  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCC
Q ss_conf             999999999999999998754799998999885420240112211110255357357
Q gi|254781073|r  233 FISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT  289 (307)
Q Consensus       233 f~~~vg~~fl~~y~~Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t  289 (307)
                      ++-+.| ..+-+|.+.++......|++++-+-+|.++-+.+ |+-+++....+++..
T Consensus       176 ~laNaG-GVivSy~E~~qn~~~~~w~~~ev~~~l~~~m~~~-~~~v~~~a~~~~~~~  230 (255)
T d1bgva1         176 KAVNAG-GVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDI-HDGSAAAAERYGLGY  230 (255)
T ss_dssp             HHHTTH-HHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHH-HHHHHHHHHHTTCCS
T ss_pred             HHHCCC-CEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCCC
T ss_conf             664287-6155314565555554566899999999999999-999999999838999


No 5  
>d2fkla1 d.230.3.1 (A:126-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
Probab=18.31  E-value=18  Score=14.26  Aligned_cols=18  Identities=28%  Similarity=0.600  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHCCCCC
Q ss_conf             679999999984036567
Q gi|254781073|r  167 PDVIFFHNTLKEMCSQHA  184 (307)
Q Consensus       167 eD~~~fH~~~k~~Cd~~~  184 (307)
                      ++-.+||.+++++|..-+
T Consensus        20 ~~~~~W~~~A~eaC~~~~   37 (64)
T d2fkla1          20 ETHLHWHTVAKETCSEKS   37 (64)
T ss_dssp             EEHHHHHHHHHHHHHHTT
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             380899999999886659


No 6  
>d1zrua3 b.163.1.2 (A:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
Probab=17.04  E-value=27  Score=13.10  Aligned_cols=36  Identities=14%  Similarity=0.239  Sum_probs=24.5

Q ss_pred             CCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEE
Q ss_conf             665125212317888887775048995059465368
Q gi|254781073|r   52 PKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA   87 (307)
Q Consensus        52 ~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKa   87 (307)
                      -+.|+++.|..+-...-+.----+++|..|+.||--
T Consensus        34 Y~tirrkdW~~p~ntaLNv~Y~NTSiiagGRYFELl   69 (139)
T d1zrua3          34 YRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELL   69 (139)
T ss_dssp             TTCCEEEEEECCEECSSEEEEEEEEEEETTEEEEEE
T ss_pred             CCEEEECCCCCCCCCCEEEEEECCEEEECCEEEEEE
T ss_conf             232870103775541036887133598744631221


No 7  
>d2icya1 b.81.1.4 (A:384-466) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
Probab=16.20  E-value=20  Score=13.85  Aligned_cols=13  Identities=46%  Similarity=1.038  Sum_probs=6.6

Q ss_pred             ECCCCCCCCCCCC
Q ss_conf             0243125320011
Q gi|254781073|r  143 TGAYWFGGGIDLT  155 (307)
Q Consensus       143 ~~~~WFGGG~DLT  155 (307)
                      .++||||-|.=|.
T Consensus        42 ~GdV~FG~~V~lk   54 (83)
T d2icya1          42 SGDVWFGSSIVLK   54 (83)
T ss_dssp             ESEEEECSSCEEE
T ss_pred             EEEEEECCCCEEE
T ss_conf             7027978997999


No 8  
>d2jfga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
Probab=14.98  E-value=17  Score=14.39  Aligned_cols=20  Identities=15%  Similarity=0.096  Sum_probs=11.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCC
Q ss_conf             04326799999999840365
Q gi|254781073|r  163 HSYDPDVIFFHNTLKEMCSQ  182 (307)
Q Consensus       163 y~~~eD~~~fH~~~k~~Cd~  182 (307)
                      +.+-++...+...++..|..
T Consensus        70 ~~~G~~~~~i~~~~~~~~~~   89 (140)
T d2jfga2          70 YCFGRDGAQLAALRPEVAEQ   89 (140)
T ss_dssp             EEESTTHHHHHTTSGGGEEE
T ss_pred             HHHCCHHHHHHHHHHHHHHH
T ss_conf             00000058899987541016


No 9  
>d1tz9a_ c.1.15.6 (A:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]}
Probab=14.47  E-value=31  Score=12.68  Aligned_cols=89  Identities=13%  Similarity=0.004  Sum_probs=51.8

Q ss_pred             EEECEEEEEECCCCCCCHHHCCHHHEEECC--CCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             000002233136887440102302102024--312532001100000110432679999999984036567334289999
Q gi|254781073|r  116 WATGLSVIVHPYNPHVPAVHFNIRMIVTGA--YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE  193 (307)
Q Consensus       116 ~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~~--~WFGGG~DLTP~~~~~~y~~~eD~~~fH~~~k~~Cd~~~~~~Y~~fKk  193 (307)
                      -..||.+.+||..|-.|..+. -|.+.+..  -|+   +|+.|+--   ....-|+-++...       -+.+...-+++
T Consensus       198 e~~GV~laihp~dpp~~~~g~-~riv~t~ed~~~l---l~~v~Sp~---~Gl~~D~G~~~~~-------~~~D~~~~i~~  263 (353)
T d1tz9a_         198 EEENIKMGIHPDDPPWEIFGL-PRITKNLADLKRI---LSLVDSPA---NGITFCTGSLGAD-------PTNDLPTMIRE  263 (353)
T ss_dssp             HHHTCEEEECCCSSSSCBTTB-CCCTTSHHHHHHH---HHHTCSTT---EECCEETTHHHHS-------TTSCHHHHHHH
T ss_pred             HHCCCEEEEECCCCCCCCCCC-CCCCCCHHHHHHH---HHHCCCCC---CEEEECCCCCHHC-------CCCCHHHHHHH
T ss_conf             983988999417876562468-8644678999999---98479834---0699717950530-------68648999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCEEHHCC
Q ss_conf             7678743453252123430101014
Q gi|254781073|r  194 WCDRYFYLPHRQESRGIGGIFFDHL  218 (307)
Q Consensus       194 ~CD~YFylpHR~E~RGvGGIFFD~l  218 (307)
                      .+|.=+|+--|+-.+..-|-|+...
T Consensus       264 ~gdRI~~vHlrDv~~~~~~~F~E~~  288 (353)
T d1tz9a_         264 IGHRINFVHFRNVKYLGEHRFEETA  288 (353)
T ss_dssp             HGGGCCCEEECCEEECSSSEEEECC
T ss_pred             HHCCCEEEEEECCCCCCCCCCEEEE
T ss_conf             7265147753226667899713643


No 10 
>d1mlia_ d.58.4.1 (A:) Muconalactone isomerase, MLI {Pseudomonas putida [TaxId: 303]}
Probab=14.06  E-value=13  Score=15.11  Aligned_cols=43  Identities=16%  Similarity=0.328  Sum_probs=0.0

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCCC---CCCCCHHHEEECCC
Q ss_conf             89998854202401122111102553573---57888111411288
Q gi|254781073|r  259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGF---KTGGNVESILASMP  301 (307)
Q Consensus       259 ~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL---~t~gr~esIl~SlP  301 (307)
                      |+.+..+|.+.|+-+-.==+--+---.++   .|+...+.||+|||
T Consensus        27 E~a~a~~Lq~~G~~~~LWRv~G~~~nisIfdv~s~deLh~iL~~LP   72 (96)
T d1mlia_          27 EKELAQRLQREGTWRHLWRIAGHYANYSVFDVPSVEALHDTLMQLP   72 (96)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCEEEEEEECCCHHHHHHHHHCCC
T ss_conf             9998887774788179999647742789997698799999997199


Done!