BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040750|gb|ACT57546.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 307

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW
Sbjct: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL
Sbjct: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC
Sbjct: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC
Sbjct: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM
Sbjct: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300

Query: 301 PPLVAWP 307
           PPLVAWP
Sbjct: 301 PPLVAWP 307


>gi|315122467|ref|YP_004062956.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495869|gb|ADR52468.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 307

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 237/306 (77%), Positives = 268/306 (87%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MNL  IE+G PD+IEE KR +QRKFENLQSIIC EFEKLENE   NS+N   +IF  KHW
Sbjct: 1   MNLGKIELGLPDNIEEWKRRAQRKFENLQSIICAEFEKLENELTGNSSNIPSEIFKSKHW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           +RDKS+K DLGGG MATL  GKVFEKAAVLVSTVYGDLS +F+DQI GT ++PYFWA GL
Sbjct: 61  VRDKSKKNDLGGGHMATLYGGKVFEKAAVLVSTVYGDLSVNFRDQIPGTLQSPYFWAAGL 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVI HPYNPHVPA+HFNIRMIVTGAYWFGGGIDLTP LESRR   DPDV+FFH++LK++ 
Sbjct: 121 SVIAHPYNPHVPAIHFNIRMIVTGAYWFGGGIDLTPFLESRRQLDDPDVMFFHDSLKKIF 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           +QH VA+Y HYKEWCD+YFYLPHR+E+RG+GGIFFD+LHS  E+GGIDADFSF+SAVGDC
Sbjct: 181 AQHTVADYNHYKEWCDQYFYLPHREEARGVGGIFFDYLHSKQEIGGIDADFSFVSAVGDC 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+ LYP LVRRNY   F++Q+RQEQLIRRGRY EFNLLYDKGTNFGFKTGGNVESILASM
Sbjct: 241 FVTLYPLLVRRNYRRSFTKQERQEQLIRRGRYVEFNLLYDKGTNFGFKTGGNVESILASM 300

Query: 301 PPLVAW 306
           PP+VAW
Sbjct: 301 PPMVAW 306


>gi|241205750|ref|YP_002976846.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859640|gb|ACS57307.1| Coproporphyrinogen oxidase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 303

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKAAARNWFEGLRDTICASFEALEDELEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGGRM ++  G+VFEK  V  STVYG+ +PDF+ QI G   +P FWA+G+
Sbjct: 61  SRENGAG---GGGRM-SMMEGRVFEKVGVHTSTVYGEFAPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NPHVPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPHVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHSS E GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDEYFFLKHRNEARGIGGIFYDWLHSSEEAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|116253236|ref|YP_769074.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226740924|sp|Q1MDJ5|HEM6_RHIL3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|115257884|emb|CAK08982.1| putative coproporphyrinogen III oxidase, aerobic [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 303

 Score =  354 bits (909), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE +E++     +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKAAARNWFEGLRDTICASFEAIEDDLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGGRM ++  G+VFEK  V  STVYG+ +PDF+ QI G   +P FWA+G+
Sbjct: 61  SRENGAG---GGGRM-SMMEGRVFEKVGVHTSTVYGEFAPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHSS E GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKTWCDEYFFLKHRNEARGIGGIFYDWLHSSEEAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|190892790|ref|YP_001979332.1| coproporphyrinogen III oxidase [Rhizobium etli CIAT 652]
 gi|226740891|sp|B3PV29|HEM6_RHIE6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|190698069|gb|ACE92154.1| coproporphyrinogen III oxidase protein [Rhizobium etli CIAT 652]
          Length = 303

 Score =  351 bits (901), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 208/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  +++ FE L+  IC  FE LE+      +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKEAARKWFEGLRDTICASFEALEDGLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGGRM ++  G+VFEK  V  STVYG+ SP+F+ QI G   +P FWA+G+
Sbjct: 61  SRENGAG---GGGRM-SMMEGRVFEKVGVHTSTVYGEFSPEFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E RGIGGIF+D LHSS E GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIFYDWLHSSDETGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|209550365|ref|YP_002282282.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226740892|sp|B5ZY73|HEM6_RHILW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|209536121|gb|ACI56056.1| Coproporphyrinogen oxidase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 303

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG P+DIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPEDIEEKKAAARSWFEGLRDTICASFEALEDELEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGGRM ++  G+VFEK  V  STV+G+ SPDF+ QI G   +P FWA+G+
Sbjct: 61  SRENGAG---GGGRM-SMMEGRVFEKVGVHTSTVHGEFSPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTSSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHS+ + GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEARGIGGIFYDWLHSNEDAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FSMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|325293608|ref|YP_004279472.1| Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3]
 gi|325061461|gb|ADY65152.1| Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3]
          Length = 303

 Score =  348 bits (892), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M   ++  G P+DIE++K  +Q  F++L+  I T FE LE+E     A++ P  F  K W
Sbjct: 1   MERPSLPKGLPEDIEDKKAAAQAWFQHLRDTIVTSFETLEDELSGPLADQEPGRFVQKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD       GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LRDNGA----GGGGKMSMMEGRVFEKVGVHTSTVYGEFSPEFRQQIPGAEEDPSFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT ++WFGGG DLTP L  RR   DPD   FH   +  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSHWFGGGADLTPVLGRRRTEQDPDTQLFHRGFEITC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA+Y  YK WCD YF+L HR E RG GGIFFD LH   E GG DA+F+F+  VG  
Sbjct: 177 NRHPVADYPRYKSWCDEYFFLKHRNEPRGTGGIFFDWLHPEEEKGGWDANFAFVQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FNLVYPKIVRSNFNQSWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|327188341|gb|EGE55558.1| coproporphyrinogen III oxidase protein [Rhizobium etli CNPAF512]
          Length = 303

 Score =  347 bits (891), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 165/307 (53%), Positives = 207/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE LE+      +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKEAARTWFEGLRDTICASFEALEDGLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGGRM ++  G+VFEK  V  STVYG+ SP+F+ QI G   +P FWA+G+
Sbjct: 61  SRENGAG---GGGRM-SMMEGRVFEKVGVHTSTVYGEFSPEFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  Y+ WCD YF+L HR E RGIGGIF+D LHSS + GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYRAWCDDYFFLKHRNEPRGIGGIFYDWLHSSEDSGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|222086615|ref|YP_002545149.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
 gi|254800264|sp|B9J7B2|HEM6_AGRRK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|221724063|gb|ACM27219.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
          Length = 303

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 209/297 (70%), Gaps = 4/297 (1%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P+DIE++K  +Q  F++L+  +C EFE+LE+E     ++++P  F  K W R+  +    
Sbjct: 11  PEDIEDKKEAAQGWFQSLRDALCAEFEQLEDELAGPLSDQTPGRFVAKDWQRENGEGGGG 70

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
              RM ++  G+VFEK  +  STVYG+ SPDF+ QI G  ++P FWA+GLS+I HP NP+
Sbjct: 71  ---RM-SMMEGRVFEKVGIHTSTVYGEFSPDFRSQIPGAEEDPRFWASGLSLIAHPVNPN 126

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VP VH N RM+VT + WFGGG DLTP L  RR   D D + FH  ++ +C +H VA+Y  
Sbjct: 127 VPTVHMNTRMVVTTSQWFGGGCDLTPMLNRRRTQEDTDSVLFHRAMQIVCDRHKVADYQR 186

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK WCD YFYL HR ESRGIGGIFFD LHS+ E GG DADF+F   VG  F  +YP +VR
Sbjct: 187 YKAWCDEYFYLKHRNESRGIGGIFFDWLHSTEEAGGWDADFAFTRDVGRAFSMVYPRIVR 246

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+PP+V WP
Sbjct: 247 SNFNETWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSLPPVVRWP 303


>gi|15889523|ref|NP_355204.1| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
 gi|22653788|sp|Q8UD80|HEM6_AGRT5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15157401|gb|AAK87989.1| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
          Length = 303

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P+DIE++K ++Q  F++L+  I   FE LE+E     +++ P  F  K W
Sbjct: 1   MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD  +    GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+GL
Sbjct: 61  LRDNGE----GGGGKMSMMEGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGL 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT ++WFGGG DLTP L  RR   DPD   FH   +  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H +A+Y  YK WCD YF+L HR E RG GGIFFD LH   E GG DA+F+F+  VG  
Sbjct: 177 NRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIFFDWLHPDEEKGGWDANFTFVQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|150396759|ref|YP_001327226.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419]
 gi|226740904|sp|A6U9R1|HEM6_SINMW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150028274|gb|ABR60391.1| Coproporphyrinogen oxidase [Sinorhizobium medicae WSM419]
          Length = 303

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 213/307 (69%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P DIE +K  ++  FE+L+  IC +FE +E++     ++R    F  K W
Sbjct: 1   MERPQLPQGLPADIERKKAEAKAWFESLRDTICADFEAIEDDLAGPLSDRPAGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD+      GGGRM ++  G+VFEK  V  STV+G+ SP+F+DQI G +++P FWA+G+
Sbjct: 61  LRDEGNG---GGGRM-SMMEGRVFEKVGVHTSTVFGEFSPEFRDQIPGASEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   D D + FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIPTDADTVLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA+Y  +K+WCD YFYL HR E RG GGIF+D L S  E+GG +ADF+F   VG  
Sbjct: 177 NRHKVADYPKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSDEEIGGWEADFAFTRDVGKA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAIVYPRIVRTNFNMPWTEQDRSEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PPLV WP
Sbjct: 297 PPLVRWP 303


>gi|163761618|ref|ZP_02168689.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
 gi|162281214|gb|EDQ31514.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
          Length = 303

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + +G PDDIEE+K  ++  FE+L+  IC  FE LE+EA    +      F    W
Sbjct: 1   MERPNLPVGLPDDIEEKKTKAREWFEHLRDQICESFETLEDEAEHPQSPGEAGRFERTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD    E  GGG   ++  G++FEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LRD----EGAGGGGTMSIMKGRLFEKVGVHTSTVHGEFSPEFRKQIPGAEEDPKFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NPHVP VH N RM+VT + WFGGG DLTP L++RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPVNPHVPTVHMNTRMVVTSSQWFGGGADLTPVLDNRRTQTDPDTLLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +HAVA+Y  +K WC+ YFYLPHR E RGIGGIF+D LH++ + GG DAD +F   VG  
Sbjct: 177 RRHAVADYPKFKAWCEEYFYLPHRDEPRGIGGIFYDWLHTADDKGGWDADLAFTQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N+   +SE++R EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S+
Sbjct: 237 FNVVYPKIVRSNFMKPWSEEERTEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSL 296

Query: 301 PPLVAWP 307
           PP+V +P
Sbjct: 297 PPVVMYP 303


>gi|86358648|ref|YP_470540.1| coproporphyrinogen III oxidase [Rhizobium etli CFN 42]
 gi|123511225|sp|Q2K5S3|HEM6_RHIEC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|86282750|gb|ABC91813.1| coproporphyrinogen III oxidase protein [Rhizobium etli CFN 42]
          Length = 303

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 206/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG P+DIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPEDIEEKKTAARNWFEGLRDTICASFEALEDELQGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R++         RM ++  G+VFEK  V  STV+G+ SPDF  QI G  ++P FWA+G+
Sbjct: 61  SREEGAGGGG---RM-SMMEGRVFEKVGVHTSTVHGEFSPDFSAQIPGAKEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTSSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E RGIGGIF+D LHSS E GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIFYDWLHSSEEAGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|239832432|ref|ZP_04680761.1| coproporphyrinogen III oxidase [Ochrobactrum intermedium LMG 3301]
 gi|239824699|gb|EEQ96267.1| coproporphyrinogen III oxidase [Ochrobactrum intermedium LMG 3301]
          Length = 304

 Score =  341 bits (875), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 211/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +QR FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MQRDEIPAIIPADIEEKKQAAQRWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D+ +    GGG + ++  G+VFEK  V VSTVYG+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDEGR----GGGGVMSIMHGRVFEKVGVHVSTVYGEFSPEFRKQIPGAEEDPRYWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT   WFGGG DLTP L+ RR   DPD + FH   + +C
Sbjct: 117 SLIAHPQNPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDRRRTQDDPDTLAFHKAFRFIC 176

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E+RGIGGIF+D LHS  E GG DADF++   VG 
Sbjct: 177 DKHKEIVDYQRVKEWCDEYFFLPHRNEARGIGGIFYDWLHSPEEKGGWDADFAYTRDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  +++ DR EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 GFSVVYPHLVRQNFNKDWTDADRNEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 297 MPPVVKWP 304


>gi|15965580|ref|NP_385933.1| coproporphyrinogen III oxidase [Sinorhizobium meliloti 1021]
 gi|22653790|sp|Q92PD8|HEM6_RHIME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15074761|emb|CAC46406.1| Probable coproporphyrinogen III oxidase, aerobic protein
           [Sinorhizobium meliloti 1021]
          Length = 303

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 212/307 (69%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P DIE++K  ++  FE+L+  IC  FE +E+E     ++R    F  K W
Sbjct: 1   MERPQLPQGLPADIEDKKAAAKAWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR++         RM ++  G+VFEK  V  STV+G+ SP+F++QI G +++P FWA+G+
Sbjct: 61  LREEGAGGGG---RM-SMMEGRVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA++  +K+WCD YFYL HR E RG GGIF+D L S+ E+GG DADF+F   VG  
Sbjct: 177 NRHPVADHAKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSAEELGGWDADFAFTRDVGKA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FALVYPRIVRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PPLV WP
Sbjct: 297 PPLVRWP 303


>gi|307302700|ref|ZP_07582456.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti BL225C]
 gi|307318548|ref|ZP_07597982.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti AK83]
 gi|306895888|gb|EFN26640.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti AK83]
 gi|306903064|gb|EFN33655.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti BL225C]
          Length = 326

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 157/299 (52%), Positives = 210/299 (70%), Gaps = 4/299 (1%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKE 68
           G P DIE++K  ++  FE+L+  IC  FE +E+E     ++R    F  K WLR++    
Sbjct: 32  GLPADIEDKKAAAKAWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDWLREEGAGG 91

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
                RM ++  G+VFEK  V  STV+G+ SP+F++QI G +++P FWA+G+S+I HP N
Sbjct: 92  GG---RM-SMMEGRVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGISLIAHPVN 147

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           P+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C++H VA++
Sbjct: 148 PNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIACNRHPVADH 207

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K+WCD YFYL HR E RG GGIF+D L S+ E+GG DADF+F   VG  F  +YP +
Sbjct: 208 AKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSAEELGGWDADFAFTRDVGKAFALVYPRI 267

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+PPLV WP
Sbjct: 268 VRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSLPPLVRWP 326


>gi|153008946|ref|YP_001370161.1| coproporphyrinogen III oxidase [Ochrobactrum anthropi ATCC 49188]
 gi|226740886|sp|A6WZC8|HEM6_OCHA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|151560834|gb|ABS14332.1| Coproporphyrinogen oxidase [Ochrobactrum anthropi ATCC 49188]
          Length = 304

 Score =  339 bits (869), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 211/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +QR FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MQRDEIPAIIPTDIEEKKQAAQRWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D+ +    GGG + ++  G+VFEK  V VSTVYG+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDEGR----GGGGVMSIMHGRVFEKVGVHVSTVYGEFSPEFRKQIPGAEEDPRYWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH   + +C
Sbjct: 117 SLIAHPQNPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDNRRTQDDPDTLAFHKAFRFIC 176

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   K+WCD YF+LPHR E+RG GGIF+D LHS  E GG DADF++   VG 
Sbjct: 177 EKHKDIVDYQRVKDWCDEYFFLPHRNEARGTGGIFYDWLHSPDEKGGWDADFAYTRDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  +++ DR EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 GFSVVYPHLVRQNFNKDWTDADRNEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 297 MPPVVKWP 304


>gi|306843104|ref|ZP_07475726.1| coproporphyrinogen III oxidase [Brucella sp. BO2]
 gi|306844549|ref|ZP_07477138.1| coproporphyrinogen III oxidase [Brucella sp. BO1]
 gi|306275160|gb|EFM56916.1| coproporphyrinogen III oxidase [Brucella sp. BO1]
 gi|306286709|gb|EFM58262.1| coproporphyrinogen III oxidase [Brucella sp. BO2]
          Length = 303

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 208/308 (67%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  ICT +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICTSYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNV +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|110634518|ref|YP_674726.1| coproporphyrinogen III oxidase [Mesorhizobium sp. BNC1]
 gi|123353494|sp|Q11GB4|HEM6_MESSB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110285502|gb|ABG63561.1| coproporphyrinogen oxidase [Chelativorans sp. BNC1]
          Length = 304

 Score =  335 bits (860), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 207/308 (67%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I  G P+D+E +K  ++  FE L+  IC   E LE+E     ++ +P  F    W
Sbjct: 1   MEQPHIPAGLPEDVENKKEAARAWFETLRDKICAALEGLEDELSGPHSSYAPGRFEQTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR    +E  GGG + ++  G+VFEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LR----QEGAGGGGVMSIMHGRVFEKVGVHTSTVHGEFSPEFRRQIPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVI HP NPHVP VH N RM+VT   WFGGG DLTP L  RR   DPD I FH  ++ +C
Sbjct: 117 SVIAHPQNPHVPTVHMNTRMVVTTRQWFGGGADLTPMLNRRRSQEDPDAIAFHKAMRFVC 176

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +HA VA+Y  +K WC+ YF+LPHR E RGIGGIF+D L S  E GG DADF+F   VG 
Sbjct: 177 ERHAAVADYEKFKNWCEEYFFLPHRNEPRGIGGIFYDWLKSPEENGGWDADFAFTQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +Y  +VR+N++  ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 AFVMVYQHIVRKNFNTNWTEADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           +PP+V WP
Sbjct: 297 LPPVVKWP 304


>gi|17986750|ref|NP_539384.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225627991|ref|ZP_03786027.1| coproporphyrinogen III oxidase [Brucella ceti str. Cudo]
 gi|237815943|ref|ZP_04594940.1| coproporphyrinogen III oxidase [Brucella abortus str. 2308 A]
 gi|17982377|gb|AAL51648.1| coproporphyrinogen iii oxidase, aerobic [Brucella melitensis bv. 1
           str. 16M]
 gi|225617154|gb|EEH14200.1| coproporphyrinogen III oxidase [Brucella ceti str. Cudo]
 gi|237789241|gb|EEP63452.1| coproporphyrinogen III oxidase [Brucella abortus str. 2308 A]
          Length = 340

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 205/298 (68%), Gaps = 6/298 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W     QK+D 
Sbjct: 48  PADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW-----QKDDG 102

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
            GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+S+I HP NP+
Sbjct: 103 NGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPN 162

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYT 189
           VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C +H  + +Y 
Sbjct: 163 VPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKDIVDYQ 222

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
             KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG  F  +YP LV
Sbjct: 223 RLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLV 282

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+SMPP+V WP
Sbjct: 283 RQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSSMPPVVKWP 340


>gi|256369966|ref|YP_003107477.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
 gi|256000129|gb|ACU48528.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
          Length = 303

 Score =  334 bits (857), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 207/308 (67%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKRKDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|23502415|ref|NP_698542.1| coproporphyrinogen III oxidase [Brucella suis 1330]
 gi|62290435|ref|YP_222228.1| coproporphyrinogen III oxidase [Brucella abortus bv. 1 str. 9-941]
 gi|82700358|ref|YP_414932.1| coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|161619494|ref|YP_001593381.1| coproporphyrinogen III oxidase [Brucella canis ATCC 23365]
 gi|189024663|ref|YP_001935431.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|225853029|ref|YP_002733262.1| coproporphyrinogen III oxidase [Brucella melitensis ATCC 23457]
 gi|254689735|ref|ZP_05152989.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|254694224|ref|ZP_05156052.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|254697879|ref|ZP_05159707.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254704802|ref|ZP_05166630.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|254708216|ref|ZP_05170044.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|254710586|ref|ZP_05172397.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|254714769|ref|ZP_05176580.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|254717830|ref|ZP_05179641.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|254730770|ref|ZP_05189348.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|256032080|ref|ZP_05445694.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|256045172|ref|ZP_05448071.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114123|ref|ZP_05454877.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160276|ref|ZP_05457970.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|256255481|ref|ZP_05461017.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|256257988|ref|ZP_05463524.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|256263491|ref|ZP_05466023.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260169215|ref|ZP_05756026.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|260546969|ref|ZP_05822708.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260565229|ref|ZP_05835713.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|260565955|ref|ZP_05836425.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|260755267|ref|ZP_05867615.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260758488|ref|ZP_05870836.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260762313|ref|ZP_05874656.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884282|ref|ZP_05895896.1| coproporphyrinogen 3 oxidase [Brucella abortus bv. 9 str. C68]
 gi|261214531|ref|ZP_05928812.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|261219676|ref|ZP_05933957.1| coproporphyrinogen 3 oxidase [Brucella ceti M13/05/1]
 gi|261222688|ref|ZP_05936969.1| coproporphyrinogen 3 oxidase [Brucella ceti B1/94]
 gi|261315720|ref|ZP_05954917.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M163/99/10]
 gi|261318158|ref|ZP_05957355.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis B2/94]
 gi|261322565|ref|ZP_05961762.1| coproporphyrinogen 3 oxidase [Brucella ceti M644/93/1]
 gi|261755496|ref|ZP_05999205.1| coproporphyrinogen 3 oxidase [Brucella suis bv. 3 str. 686]
 gi|261758727|ref|ZP_06002436.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|265989189|ref|ZP_06101746.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M292/94/1]
 gi|265991603|ref|ZP_06104160.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995441|ref|ZP_06107998.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 3 str. Ether]
 gi|265998652|ref|ZP_06111209.1| coproporphyrinogen 3 oxidase [Brucella ceti M490/95/1]
 gi|294852867|ref|ZP_06793540.1| coproporphyrinogen III oxidase [Brucella sp. NVSL 07-0026]
 gi|297248820|ref|ZP_06932538.1| coproporphyrinogen III oxidase, aerobic [Brucella abortus bv. 5
           str. B3196]
 gi|54037274|sp|P63851|HEM6_BRUSU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|54041269|sp|P63850|HEM6_BRUME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|75496448|sp|Q57BW7|HEM6_BRUAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123547584|sp|Q2YS10|HEM6_BRUA2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740642|sp|B2S710|HEM6_BRUA1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740643|sp|A9M6L4|HEM6_BRUC2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800266|sp|C0REI6|HEM6_BRUMB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|23348402|gb|AAN30457.1| coproporphyrinogen III oxidase, aerobic [Brucella suis 1330]
 gi|62196567|gb|AAX74867.1| HemF, coproporphyrinogen III oxidase [Brucella abortus bv. 1 str.
           9-941]
 gi|82616459|emb|CAJ11522.1| Coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|161336305|gb|ABX62610.1| Coproporphyrinogen oxidase [Brucella canis ATCC 23365]
 gi|189020235|gb|ACD72957.1| Coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|225641394|gb|ACO01308.1| Coproporphyrinogen oxidase [Brucella melitensis ATCC 23457]
 gi|260096019|gb|EEW79896.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260151297|gb|EEW86391.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|260155473|gb|EEW90553.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|260668806|gb|EEX55746.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260672745|gb|EEX59566.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675375|gb|EEX62196.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260873810|gb|EEX80879.1| coproporphyrinogen 3 oxidase [Brucella abortus bv. 9 str. C68]
 gi|260916138|gb|EEX82999.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|260921272|gb|EEX87925.1| coproporphyrinogen 3 oxidase [Brucella ceti B1/94]
 gi|260924765|gb|EEX91333.1| coproporphyrinogen 3 oxidase [Brucella ceti M13/05/1]
 gi|261295255|gb|EEX98751.1| coproporphyrinogen 3 oxidase [Brucella ceti M644/93/1]
 gi|261297381|gb|EEY00878.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis B2/94]
 gi|261304746|gb|EEY08243.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M163/99/10]
 gi|261738711|gb|EEY26707.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|261745249|gb|EEY33175.1| coproporphyrinogen 3 oxidase [Brucella suis bv. 3 str. 686]
 gi|262553276|gb|EEZ09110.1| coproporphyrinogen 3 oxidase [Brucella ceti M490/95/1]
 gi|262766554|gb|EEZ12343.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 3 str. Ether]
 gi|263002387|gb|EEZ14962.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093514|gb|EEZ17548.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661386|gb|EEZ31647.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M292/94/1]
 gi|294821456|gb|EFG38455.1| coproporphyrinogen III oxidase [Brucella sp. NVSL 07-0026]
 gi|297175989|gb|EFH35336.1| coproporphyrinogen III oxidase, aerobic [Brucella abortus bv. 5
           str. B3196]
 gi|326409569|gb|ADZ66634.1| Coproporphyrinogen III oxidase [Brucella melitensis M28]
 gi|326539273|gb|ADZ87488.1| coproporphyrinogen oxidase [Brucella melitensis M5-90]
          Length = 303

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 207/308 (67%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|114704760|ref|ZP_01437668.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
 gi|114539545|gb|EAU42665.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
          Length = 302

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 207/300 (69%), Gaps = 7/300 (2%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKE 68
           G PD+IE +K  ++  FE L+  IC  FE LE +AH       P  F    W RD     
Sbjct: 9   GLPDNIEMKKATARAWFEALRDRICAVFEDLE-KAHGEETGLEPGRFERTEWHRDNE--- 64

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
             GGG + ++  G+VFEK  V  STV+G+ S +F+  I G  ++P FWA+G+S+I H  N
Sbjct: 65  --GGGGVMSMMHGRVFEKVGVHTSTVHGEFSEEFRKNIPGAEEDPTFWASGISLIGHLRN 122

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VAN 187
           P+VPAVH N RM+VT   WFGGG DLTP+LE RR   DPD   FH  L+ +C +H+ VA+
Sbjct: 123 PNVPAVHMNTRMVVTTRQWFGGGADLTPTLERRRTQEDPDTRAFHKALQFVCDRHSKVAD 182

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y   KEWCD YFYLPHRQE+RG+GGIF+D+LHSS E+GG DADF+F   VG  FI +YP 
Sbjct: 183 YGRLKEWCDEYFYLPHRQETRGVGGIFYDYLHSSDEVGGWDADFAFTRDVGKAFIVVYPH 242

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           ++++N    ++E DR+EQL+RRGRY E+NLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 243 IIKQNVGQPYTEADREEQLVRRGRYVEYNLLYDRGTLFGLKTGGNVQSILSSMPPVVKWP 302


>gi|254719583|ref|ZP_05181394.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|265984591|ref|ZP_06097326.1| coproporphyrinogen 3 oxidase [Brucella sp. 83/13]
 gi|306837928|ref|ZP_07470788.1| coproporphyrinogen III oxidase [Brucella sp. NF 2653]
 gi|264663183|gb|EEZ33444.1| coproporphyrinogen 3 oxidase [Brucella sp. 83/13]
 gi|306407016|gb|EFM63235.1| coproporphyrinogen III oxidase [Brucella sp. NF 2653]
          Length = 303

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 207/308 (67%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPTDIEEKKQAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFIRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   K+WCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKDWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNV +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNTILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|163843804|ref|YP_001628208.1| coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|163674527|gb|ABY38638.1| Coproporphyrinogen oxidase [Brucella suis ATCC 23445]
          Length = 303

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 206/308 (66%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFVFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|260462578|ref|ZP_05810785.1| Coproporphyrinogen oxidase [Mesorhizobium opportunistum WSM2075]
 gi|259031774|gb|EEW33043.1| Coproporphyrinogen oxidase [Mesorhizobium opportunistum WSM2075]
          Length = 299

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 209/303 (68%), Gaps = 5/303 (1%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS 65
           + +G P DIEE+K  ++  FE L+  IC  FE++E +     A+ +P  F    W RD+ 
Sbjct: 1   MPLGLPADIEEKKMKARLWFEALRERICGAFEQIEQDLQGPLASWAPGRFEKTPWERDQG 60

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           +    GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+G+S+I H
Sbjct: 61  K----GGGGTMSMMHGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGISLIAH 116

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA- 184
           P+NP+VPAVH N RM+VT ++WFGGG DLTP L+ RR   DPD I FH  ++  C ++A 
Sbjct: 117 PWNPNVPAVHMNTRMVVTSSHWFGGGADLTPVLDRRRTQDDPDSIAFHRAMQFACEKNAG 176

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
           VA+Y  +K WCD YFYLPHR E RG GGIFFD+LHS    GG +ADF+F+  VG  F+ +
Sbjct: 177 VADYPKFKTWCDEYFYLPHRNEPRGTGGIFFDYLHSGEAAGGWNADFNFVQDVGRSFLVV 236

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LVR N++  +++ DR EQLIRRGRY EFNLL+D+GT FG KTGGNV SIL+S+PP V
Sbjct: 237 YGHLVRANFNENWTDGDRDEQLIRRGRYVEFNLLHDRGTIFGLKTGGNVASILSSLPPEV 296

Query: 305 AWP 307
            WP
Sbjct: 297 RWP 299


>gi|118591956|ref|ZP_01549351.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
 gi|118435599|gb|EAV42245.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
          Length = 308

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 207/300 (69%), Gaps = 8/300 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENS---ANRSPKIFTVKHWLRDKSQK 67
           PD IE++K  +   F+ L+  IC  FE LE+E  E S   A++    F    W R  S  
Sbjct: 14  PDGIEDKKATAPAWFKELRDRICKSFEDLEDEIGELSGPLADQPAGRFERTPWERTDSTG 73

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG M ++  G+VFEKA V +STV+G+ SP+F+ QI G +++P FWA+G+S+IVHP 
Sbjct: 74  AKGGGGVM-SMMHGRVFEKAGVHISTVHGEFSPEFRGQIPGASEDPRFWASGISLIVHPQ 132

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD I FH  ++  C  HA+A+
Sbjct: 133 NPHVPAVHMNTRMVVTTRQWFGGGADLTPVLDARRTQDDPDTIAFHEAMRSACDAHAIAD 192

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E+RGIGGIF+D+L+S    G  + DF+F   VG  F+ +YP 
Sbjct: 193 YDAYKAWCDDYFFLKHRNEARGIGGIFYDYLNS----GTWEDDFAFTKDVGLAFLNIYPE 248

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           LVRRN+   +S+ +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+SMPP+V WP
Sbjct: 249 LVRRNFQKSWSDAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSMPPVVKWP 308


>gi|227822226|ref|YP_002826197.1| coproporphyrinogen III oxidase [Sinorhizobium fredii NGR234]
 gi|227341226|gb|ACP25444.1| coproporphyrinogen III oxidase, aerobic [Sinorhizobium fredii
           NGR234]
          Length = 491

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 154/297 (51%), Positives = 206/297 (69%), Gaps = 4/297 (1%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P DIE++K  ++  FE+L+  IC  FE +E++     ++R P  F  K WLR++      
Sbjct: 199 PADIEDKKAEAKAWFESLRDSICAAFETIEDDLTGPLSDRPPGRFVGKDWLREEGAGGGG 258

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
              RM+ +  G+VFEK  V  STV+G+ SP+F++QI G + +P FWA+G+S+I HP NP+
Sbjct: 259 ---RMSMM-EGRVFEKVGVHTSTVFGEFSPEFRNQIPGASDDPRFWASGISLIAHPVNPN 314

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD   FH  ++  C++H VA++  
Sbjct: 315 VPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRLMSDPDTAVFHRAMEITCNRHPVADHAK 374

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +KEWCD YF+L HR E RG GGIF+D LHS  +MGG  ADF+F   VG  F  +YP +VR
Sbjct: 375 FKEWCDEYFFLKHRNEPRGTGGIFYDWLHSPEDMGGWQADFAFTRDVGKAFAIVYPKIVR 434

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            N++  ++E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+PP+V WP
Sbjct: 435 TNFNTPWTEADRDEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSLPPVVRWP 491


>gi|256061602|ref|ZP_05451743.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261325609|ref|ZP_05964806.1| coproporphyrinogen 3 oxidase [Brucella neotomae 5K33]
 gi|261301589|gb|EEY05086.1| coproporphyrinogen 3 oxidase [Brucella neotomae 5K33]
          Length = 303

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 159/308 (51%), Positives = 206/308 (66%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHLQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|148559586|ref|YP_001259425.1| coproporphyrinogen III oxidase [Brucella ovis ATCC 25840]
 gi|148370843|gb|ABQ60822.1| coproporphyrinogen III oxidase, aerobic [Brucella ovis ATCC 25840]
          Length = 303

 Score =  329 bits (843), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 159/308 (51%), Positives = 205/308 (66%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWAGGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWC  YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCYEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|254503192|ref|ZP_05115343.1| coproporphyrinogen III oxidase, aerobic [Labrenzia alexandrii
           DFL-11]
 gi|222439263|gb|EEE45942.1| coproporphyrinogen III oxidase, aerobic [Labrenzia alexandrii
           DFL-11]
          Length = 318

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 207/300 (69%), Gaps = 8/300 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENS---ANRSPKIFTVKHWLRDKSQK 67
           P+ IE++K  +   F++L+  IC  FEKLE++  E +   ++     F    W R  S  
Sbjct: 24  PEGIEDKKLTASAWFKDLRDQICAAFEKLEDDIGELNGPISDLPAGRFERTPWERTDSSG 83

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG M ++  G+VFEK  V +STV+G+ SP+F+ QI G +++P FWA+G+S+I HP 
Sbjct: 84  AKGGGGVM-SMMHGRVFEKVGVHISTVHGEFSPEFRGQIPGASEDPRFWASGISLIAHPQ 142

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           NP+VPAVH N RM+VT   WFGGG DLTP L+ RR   DPD + FH+ +K  C  HAVA+
Sbjct: 143 NPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDDRRTQDDPDTVAFHDAMKAACEPHAVAD 202

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+L HR E RGIGGIF+D+LHS    G  +AD +F   VG  F+K+YP 
Sbjct: 203 YPAYKDWCDEYFFLKHRNEPRGIGGIFYDYLHS----GDWNADLAFTKDVGRAFLKVYPE 258

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           LVR+NY + +++  R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+SMPP+V WP
Sbjct: 259 LVRKNYENSWTDAQREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSMPPVVKWP 318


>gi|90418299|ref|ZP_01226211.1| coproporphyrinogen oxidase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337971|gb|EAS51622.1| coproporphyrinogen oxidase [Aurantimonas manganoxydans SI85-9A1]
          Length = 437

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/308 (52%), Positives = 211/308 (68%), Gaps = 7/308 (2%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M   T+  G P+DIE +K  +Q  FE L+  IC  FE++E+   E +    P  F    W
Sbjct: 136 MERPTLPEGLPEDIETKKATAQAWFEALRDRICKVFEEIEDGFGEETG-LEPGRFEQTEW 194

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R     E+ GGG + ++  G+VFEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 195 SR-----ENEGGGGLMSMMHGRVFEKVGVHTSTVHGEFSPEFRKQIPGAEEDPTFWASGI 249

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP+VPAVH N RM+VT   WFGGG DLTP+L+ RR   D D + FH  L+ +C
Sbjct: 250 SLIAHMRNPNVPAVHMNTRMVVTTRQWFGGGADLTPTLDRRRIDDDRDTLAFHKALQFVC 309

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H+ VA+Y  +KEWCD YFYLPHR E+RG+GGIF+D LHSS E GG DADF+F   VG 
Sbjct: 310 DRHSGVADYAKFKEWCDTYFYLPHRNEARGVGGIFYDWLHSSDEAGGWDADFAFTRDVGK 369

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +YP +VR+N    F+E DR+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+S
Sbjct: 370 AFLVVYPHIVRQNVVQPFTEADREEQLIRRGRYVEYNLLYDRGTLFGLKTGGNVNSILSS 429

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 430 MPPVVKWP 437


>gi|328542785|ref|YP_004302894.1| Coproporphyrinogen III oxidase, aerobic [polymorphum gilvum
           SL003B-26A1]
 gi|326412531|gb|ADZ69594.1| Coproporphyrinogen III oxidase, aerobic [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 160/301 (53%), Positives = 201/301 (66%), Gaps = 8/301 (2%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI---FTVKHWLRDKSQ 66
            PD IE +K  +   FE+L+  IC+ FE LE+E        S K    F    W R  + 
Sbjct: 13  VPDAIETKKITAATWFEDLRDRICSAFETLEDEIGARGGPLSDKPAGRFVRTPWERTDAS 72

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
               GGG M +L  G+VFEK  V VSTV+G  SP+F+ QI G +++P FWA+G+S+I H 
Sbjct: 73  GAKGGGGVM-SLMHGRVFEKVGVHVSTVHGAFSPEFRGQIPGASEDPRFWASGISLIAHL 131

Query: 127 YNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           +NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  +K  C+ HA A
Sbjct: 132 HNPHVPAVHMNTRMVVTSRQWFGGGADLTPVLDARRTQEDPDTVAFHAAMKAACAPHACA 191

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
           +Y  YK WCD YF+LPHR E RGIGGIF+D+LHS       DADF+F   VG  F+ +YP
Sbjct: 192 DYDRYKAWCDEYFFLPHRNEPRGIGGIFYDYLHSR----DWDADFAFTRDVGLAFLDVYP 247

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            LVR N+   +SE +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+S+PP+V W
Sbjct: 248 RLVRANFEKPWSEAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSLPPVVKW 307

Query: 307 P 307
           P
Sbjct: 308 P 308


>gi|222149360|ref|YP_002550317.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
 gi|254800265|sp|B9JZ61|HEM6_AGRVS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|221736344|gb|ACM37307.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
          Length = 304

 Score =  325 bits (834), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 211/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G PDDIE +K  ++  FE+L+  IC  FE LE+E     ++R+P  FT K W
Sbjct: 1   MQRPILPKGLPDDIEVKKATARAWFESLRDQICRSFEALEDELTGPLSDRAPGRFTPKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R++         RM ++  G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+
Sbjct: 61  QREEGLGGGG---RM-SMMNGRVFEKVGVHTSTVHGEFSPEFRKQMPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NPHVPAVH N RM+VT + WFGGG DLTP L+ RR   D D + FH  L+  C
Sbjct: 117 SLIAHSCNPHVPAVHMNTRMVVTTSQWFGGGADLTPVLDRRRTQDDADTVAFHAALEAAC 176

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           + H  VA+Y HYK WC+ YF+LPHRQE RGIGGIFFD LH+  +     A+F+F+  VG 
Sbjct: 177 AAHPDVADYPHYKAWCEEYFFLPHRQEPRGIGGIFFDWLHAGEKFDLWAANFAFVQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVRRN++  ++E+DR+EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S
Sbjct: 237 QFAAVYPDLVRRNFNTPWTEEDREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSS 296

Query: 300 MPPLVAWP 307
           +PPLV WP
Sbjct: 297 LPPLVRWP 304


>gi|300024038|ref|YP_003756649.1| coproporphyrinogen oxidase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525859|gb|ADJ24328.1| Coproporphyrinogen oxidase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 302

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/296 (53%), Positives = 200/296 (67%), Gaps = 3/296 (1%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDLG 71
           +E+ K  ++  FE L+  I   FEKLE    E +     +P  F    W R K    + G
Sbjct: 8   LEQHKAQARAWFERLRDDIVAAFEKLEAGLPETAPHGGDAPGRFVATPWPR-KDAAGNDG 66

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG + ++  G+VFEKA V  STVYG+ SP+F+ QI G  ++P FWA+G+S+IVHP NP+V
Sbjct: 67  GGGVMSMLHGRVFEKAGVHTSTVYGEFSPEFRKQIPGAEESPAFWASGISLIVHPRNPNV 126

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N RMIVT  +WFGGG DLTP L+ RR   D D + FH  +   C+ H+VA+Y   
Sbjct: 127 PAVHMNTRMIVTSKWWFGGGADLTPVLDKRRTQSDADTMAFHAAMYGACAPHSVADYQKL 186

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           KEWCD YF+LPHR E+RGIGGIF+DHL  +   GG DA F+F   VG  F  +YP LVR 
Sbjct: 187 KEWCDEYFFLPHRNEARGIGGIFYDHLTPADAEGGWDAAFAFTQDVGKAFASVYPMLVRG 246

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           NY   +SE+ R+EQLIRRGRY E+NLLYD+GT FG KTGGNVESIL+SMPP+V WP
Sbjct: 247 NYSMPYSEEQREEQLIRRGRYVEYNLLYDRGTMFGLKTGGNVESILSSMPPVVKWP 302


>gi|312114062|ref|YP_004011658.1| coproporphyrinogen oxidase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219191|gb|ADP70559.1| Coproporphyrinogen oxidase [Rhodomicrobium vannielii ATCC 17100]
          Length = 315

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/284 (54%), Positives = 197/284 (69%), Gaps = 6/284 (2%)

Query: 25  FENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           F +L++ IC EFE++E+E      A+  P  F  K W R     ED GGG MA L  G+V
Sbjct: 37  FASLRNDICNEFERIEDELKSGPHASLPPGRFEKKPWRRTDHTGEDGGGGTMAML-HGRV 95

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           FEK  V VSTV+G+ +P+F+ QI G+ ++P F A+G+S+I H  NP+VP VH N R IVT
Sbjct: 96  FEKVGVHVSTVHGEFAPEFRAQIPGSEEDPRFRASGISLIAHMRNPNVPTVHLNTRFIVT 155

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP L  RR   DPDV+ FH   +  C +H VA+Y+ YKEWCD YFYLPH
Sbjct: 156 SKWWFGGGSDLTPMLSKRRRVEDPDVLDFHAAFRSACLKHPVADYSRYKEWCDEYFYLPH 215

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           RQE+RG+GGIF+D+ +S    G  DADF+F   VG  F+ + P L+R N H  +SE DR 
Sbjct: 216 RQEARGLGGIFYDYHNS----GDWDADFAFTQDVGRAFLAVVPKLIRANMHTPWSEADRD 271

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 272 EQLVRRGRYVEFNLLYDRGTVFGLKTGGNVDSILSSMPPVVKWP 315


>gi|307944161|ref|ZP_07659502.1| coproporphyrinogen III oxidase, aerobic [Roseibium sp. TrichSKD4]
 gi|307772507|gb|EFO31727.1| coproporphyrinogen III oxidase, aerobic [Roseibium sp. TrichSKD4]
          Length = 304

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 201/289 (69%), Gaps = 8/289 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENS---ANRSPKIFTVKHWLRDKSQK 67
           PD IE++K+ +   FE+L++ IC  FEKLE+E  + S   ++R    F    W R  S  
Sbjct: 14  PDQIEDKKKTAAAWFEDLRNQICASFEKLEDEITDRSGPMSDREAGRFVRTPWERTDSTG 73

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG M +L  G+VFEK  V +STV+G+ SP+F+ QI G  ++P FWA+G+S+I H +
Sbjct: 74  AKGGGGVM-SLMHGRVFEKVGVHISTVHGEFSPEFRGQIPGANEDPRFWASGISLIAHMH 132

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  +++ CS H VA+
Sbjct: 133 NPHVPAVHMNTRMVVTTRQWFGGGADLTPVLDARRTQTDPDTVAFHKAMEDACSPHDVAD 192

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HR E+RGIGGIF+D+L+S    G  DADF+F   VG  F+K+YP 
Sbjct: 193 YPAYKKWCDEYFYLKHRDEARGIGGIFYDYLNS----GSWDADFAFTQDVGRAFLKIYPE 248

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           LVR N+   +S+ +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SI
Sbjct: 249 LVRANFEKPWSDAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASI 297


>gi|154246889|ref|YP_001417847.1| coproporphyrinogen III oxidase [Xanthobacter autotrophicus Py2]
 gi|154160974|gb|ABS68190.1| Coproporphyrinogen oxidase [Xanthobacter autotrophicus Py2]
          Length = 315

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/295 (52%), Positives = 192/295 (65%), Gaps = 2/295 (0%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +EER+  ++  FE+LQ  I   FE LENEA       +P  F    W R        GGG
Sbjct: 22  LEERRSRARCWFEDLQGRIIAAFEALENEADAALYAGAPGRFARTPWSRTDHTGAPGGGG 81

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            MA L  G++FEK  V  STV+G+ +P+F+ QI G  ++P FWA+G+S+I H  NPHVPA
Sbjct: 82  TMA-LMRGRLFEKVGVHTSTVFGEFAPEFRSQIPGAAEDPRFWASGISLIAHMANPHVPA 140

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R +VT   WFGGG DLTP L+ RR   DPD + FH  +   C+ H VA+Y  YK 
Sbjct: 141 VHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTVAFHAAMAGACTAHTVADYARYKT 200

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHS-SPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           WCD YF+L HR E RGIGGIF+D+L S S   G  D DF+F   VG  F+ +YP LVR N
Sbjct: 201 WCDDYFFLKHRNEMRGIGGIFYDYLDSASSGTGTWDNDFAFTRDVGLAFLDIYPKLVRAN 260

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               +S  DR+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 261 MGQPWSAADREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPVVKWP 315


>gi|254293108|ref|YP_003059131.1| coproporphyrinogen III oxidase [Hirschia baltica ATCC 49814]
 gi|254041639|gb|ACT58434.1| Coproporphyrinogen oxidase [Hirschia baltica ATCC 49814]
          Length = 297

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/299 (51%), Positives = 196/299 (65%), Gaps = 7/299 (2%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
            P+ +E RK +++  FENLQS I   FE+LE EA           F +  W R +   ED
Sbjct: 5   SPEQMESRKSVAKAWFENLQSDIIARFEQLEEEASPPLYKGIAGKFEITPWKRGQD-GED 63

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-YFWATGLSVIVHPYN 128
           LGGG MA +  G++FEK  V  STVYG+ S +F+ QI G  +N   FWA+G+S+I H +N
Sbjct: 64  LGGGNMAIM-KGRLFEKVGVHTSTVYGEFSEEFRKQIPGAEENDGKFWASGISLIAHMHN 122

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N RMI T   WFGGG DLTP +E +RH  +PD I FH  +K  C  H  A+Y
Sbjct: 123 PHVPAVHMNTRMICTSKSWFGGGADLTPLMEVQRHQDNPDAIAFHAAMKAACDAHEGADY 182

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K+WCD YFYLPHR+E RG GGIF+D      + G  DAD +F   VG+ F  +YP++
Sbjct: 183 ARFKDWCDEYFYLPHREEPRGTGGIFYDRH----DTGNWDADLAFTKDVGEAFAAIYPTI 238

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           VR   +  ++E DR  QLI+RGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 239 VRNRMNQSWNEADRDAQLIQRGRYVEFNLLYDRGTTFGLKTGGNVKSILSSMPPVVKWP 297


>gi|254470296|ref|ZP_05083700.1| coproporphyrinogen III oxidase, aerobic [Pseudovibrio sp. JE062]
 gi|211960607|gb|EEA95803.1| coproporphyrinogen III oxidase, aerobic [Pseudovibrio sp. JE062]
          Length = 303

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 205/300 (68%), Gaps = 8/300 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENS---ANRSPKIFTVKHWLRDKSQK 67
           P D+E++K+ +   F  L+  ICT FE+LE E  E     A++    F    W R     
Sbjct: 9   PADLEDKKKEASAWFTQLRDNICTAFEQLEEEVGEQDGPLADQPAGRFERTPWERTDHSG 68

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG M +L  G+VFEK  V VSTV+G+ SP+F+DQI G +++P FWA+G+S+I H +
Sbjct: 69  GHGGGGVM-SLMHGRVFEKVGVHVSTVHGEFSPEFRDQIPGASEDPRFWASGISLIAHMH 127

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           NP+VPAVH N RM+VT   WFGGG DLTP L +RR   DPD + FH  +K  C  H  A+
Sbjct: 128 NPNVPAVHMNTRMVVTTKQWFGGGADLTPVLSARRTQEDPDTVEFHEAMKAACVDHPGAD 187

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y H+K+WCD YFYLPHR+E+RGIGGIF+D  ++    G  +AD +F  +VG+ F+ +YP 
Sbjct: 188 YDHFKKWCDEYFYLPHRKEARGIGGIFYDRHNT----GDWNADLAFTKSVGNAFLDIYPK 243

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           LVR+N+   ++ + R+EQL+RRGRY EFNLLYD+GT FG KTGGNV SIL+SMPP+V WP
Sbjct: 244 LVRKNFLTPWTLEQREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVSSILSSMPPVVKWP 303


>gi|319781861|ref|YP_004141337.1| coproporphyrinogen oxidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167749|gb|ADV11287.1| Coproporphyrinogen oxidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 304

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 206/308 (66%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I  G P DIE++K  ++  FE L+  IC  FE++E +     A+ SP  F    W
Sbjct: 1   MERPEIPAGLPADIEQKKMKARLWFEALRERICATFEQIEQDLGGPLASWSPGRFEKTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            RD    E  GGG   ++  G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+
Sbjct: 61  ERD----EGRGGGGTMSMMHGRVFEKVGVHTSTVHGEFSPEFRKQMPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP+NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPWNPNVPAVHMNTRMVVTSSQWFGGGADLTPVLDRRRTQDDPDTVAFHRAMQFAC 176

Query: 181 SQH-AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            ++ AVA+Y  +K WCD YFYL HR E RG GGIFFD LHS  + GG +ADF+F+  VG 
Sbjct: 177 EKNVAVADYPKFKAWCDEYFYLSHRNELRGTGGIFFDWLHSGEDKGGWNADFNFVQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +Y  LVR N++  +++ DR EQLIRRGRY EFNLL+D+GT FG KTGGNV +IL+S
Sbjct: 237 AFLVVYGHLVRANFNENWTDGDRDEQLIRRGRYVEFNLLHDRGTIFGLKTGGNVAAILSS 296

Query: 300 MPPLVAWP 307
           +PP V WP
Sbjct: 297 LPPEVRWP 304


>gi|13472430|ref|NP_103997.1| coproporphyrinogen III oxidase [Mesorhizobium loti MAFF303099]
 gi|14023176|dbj|BAB49783.1| coproporphyrinogen III oxidase precursor [Mesorhizobium loti
           MAFF303099]
          Length = 286

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 195/284 (68%), Gaps = 5/284 (1%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           FE L+  IC  FE++E +     A+ SP  F    W RD  +    GGG   ++  G+VF
Sbjct: 7   FEALRERICGAFEQIEQDLQGPLASWSPGRFEKTPWERDAGK----GGGGTMSMMHGRVF 62

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EK  V  STVYG+ SP+F+ Q+ G  ++P FWA+G+S+I HP+NP+VPAVH N RM+VT 
Sbjct: 63  EKVGVHTSTVYGEFSPEFRKQMPGAEEDPRFWASGISLIAHPWNPNVPAVHMNTRMVVTS 122

Query: 145 AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYKEWCDRYFYLPH 203
             WFGGG DLTP L+ RR   DPD I FH  ++  C ++ AVA++  +K WCD YF+LPH
Sbjct: 123 RQWFGGGADLTPVLDRRRTQDDPDTIAFHRAMQFACEKNVAVADHPKFKTWCDEYFFLPH 182

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R E RG+GGIFFD LHS  + GG +ADF+F+  VG  F+ +Y  LVR N++  +++ DR 
Sbjct: 183 RNEPRGVGGIFFDWLHSGEDRGGWNADFNFVQDVGRSFLVVYSHLVRANFNENWTDGDRD 242

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           EQLIRRGRY EFNLL+D+GT FG KTGGNV SIL+S+PP V WP
Sbjct: 243 EQLIRRGRYVEFNLLHDRGTIFGLKTGGNVASILSSLPPEVRWP 286


>gi|27377592|ref|NP_769121.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
 gi|41017187|sp|Q89SC2|HEM6_BRAJA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|27350737|dbj|BAC47746.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
          Length = 316

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/295 (52%), Positives = 198/295 (67%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE L+  IC  FE+LE++A +         FT   W R        GGG
Sbjct: 27  IEDRKTRARAWFEALRDDICASFERLEDDAPQGLYPGEAGRFTRTPWQRTDHSGAAGGGG 86

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M ++ +G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPHVPA
Sbjct: 87  VM-SMMSGRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPRFWASGISLIAHLRNPHVPA 145

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ-HAVANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR   D D I FH  +KE C Q + VA+Y  YK
Sbjct: 146 VHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDADSIAFHAAMKEACVQPNGVADYDKYK 205

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR+E+RGIGGIF+D  H S   G  DAD +F   VG  F+K+YP +VRRN
Sbjct: 206 KWCDEYFYLPHRKEARGIGGIFYD-WHDS---GDWDADLAFTQDVGRAFLKIYPDIVRRN 261

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++  DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV+SIL+S+PP V WP
Sbjct: 262 FASAWTAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSLPPEVKWP 316


>gi|148253793|ref|YP_001238378.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. BTAi1]
 gi|146405966|gb|ABQ34472.1| coproporphyrinogen oxidase [Bradyrhizobium sp. BTAi1]
          Length = 295

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/295 (53%), Positives = 199/295 (67%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE+L+  IC  FE+LE+EA      R P  F    W R        GGG
Sbjct: 6   IEDRKARARAWFESLRDQICAAFEQLEDEAPAALYPRQPGRFVRTPWQR-TDHSGAPGGG 64

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            +  +  G++FEK  V  STV+G+ +P+F+ QI G +++P FWA+G+S+I H ++PHVPA
Sbjct: 65  GVMGMMHGRLFEKVGVHCSTVHGEFAPEFRSQIPGASEDPRFWASGISLIAHLWSPHVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR+  DPD + FH  L+  C  HA VA Y  YK
Sbjct: 125 VHMNTRFVVTTKAWFGGGADLTPVLDRRRNQEDPDTLAFHAALQGACDAHATVAPYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E RGIGGIF+DH  S    G  +AD +F   VG  F+K+YP LVRRN
Sbjct: 185 RWCDEYFYLPHRKEPRGIGGIFYDHHDS----GDWEADLAFTQDVGRAFLKVYPELVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FGAAWTEADREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPPEVKWP 295


>gi|146339023|ref|YP_001204071.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
 gi|146191829|emb|CAL75834.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 201/295 (68%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE+L+  IC  FE+LE EA  +   R+   F    W R        GGG
Sbjct: 6   IEDRKARARAWFESLRDQICAAFERLEEEAPADLYPRASAHFVRTPWER-TDHGGGHGGG 64

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + ++  G++FEK  V  STV+G+ +P+F+ QI G +++P FWA+G+S+I H ++PHVPA
Sbjct: 65  GVMSMMHGRLFEKVGVHCSTVHGEFAPEFRSQIPGASEDPRFWASGISLIAHLWSPHVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR+  DPD + FH  +K  C  H AVA+Y  YK
Sbjct: 125 VHMNTRFVVTTKSWFGGGADLTPVLDRRRNQEDPDTVAFHAAMKGACDAHAAVASYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E RGIGGIF+DH  S    G  DAD +F   VG  F+K+YP LVRRN
Sbjct: 185 RWCDEYFYLPHRKEPRGIGGIFYDHHDS----GNWDADLAFTQDVGRAFLKVYPDLVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V WP
Sbjct: 241 FSAPWTEADREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVDSILSSMPPEVKWP 295


>gi|299134643|ref|ZP_07027835.1| Coproporphyrinogen oxidase [Afipia sp. 1NLS2]
 gi|298590453|gb|EFI50656.1| Coproporphyrinogen oxidase [Afipia sp. 1NLS2]
          Length = 295

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ RK  ++  FE L+  IC  FE+LE+E   +        F  K W R        GGG
Sbjct: 6   LDSRKTSARAWFEKLRDDICASFEQLEDEVPASLYGDQAGRFVRKPWERTDHTGAPGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M ++  G++FEK  V  STV+G+ +P+F+ QI G + +P FWA+G+S+I HP+NP+VPA
Sbjct: 66  VM-SMMRGRLFEKVGVHCSTVFGEFAPEFRAQIPGASDDPRFWASGISLIAHPWNPNVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR   DPD + FH   ++ C  H AVA Y  +K
Sbjct: 125 VHMNTRFVVTTKRWFGGGADLTPVLDRRRTQEDPDTVSFHEAFRKACHAHTAVAPYDKFK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR+E RGIGGIF+D L S    G  +ADF+F   VG  F  +YP LVRRN
Sbjct: 185 KWCDDYFFLAHRKEPRGIGGIFYDWLES----GDWNADFAFTQDVGRAFAAIYPELVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   + + DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FETPWQDADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|158425127|ref|YP_001526419.1| coproporphyrinogen III oxidase [Azorhizobium caulinodans ORS 571]
 gi|158332016|dbj|BAF89501.1| coproporphyrinogen III oxidase [Azorhizobium caulinodans ORS 571]
          Length = 299

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 149/295 (50%), Positives = 188/295 (63%), Gaps = 5/295 (1%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           ++E RK  ++  FE LQ  I   FE+LE+EA           F    W R        GG
Sbjct: 10  ELERRKAEARAWFEALQGRIIAAFEQLEDEASPALYGEKAGRFVRTPWDRTDHTGAPGGG 69

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G MA +  G++FEK  V  STV+G+ +P+F+ QI G  ++P FWA+G+S+I H  NPHVP
Sbjct: 70  GTMA-MMHGRLFEKVGVHTSTVFGEFAPEFRGQIPGAAEDPRFWASGISLIAHMANPHVP 128

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R +VT   WFGGG DLTP L++RR   DPD   FH   ++ C  HAVA+Y  YK
Sbjct: 129 AVHMNTRFVVTTKSWFGGGADLTPVLDTRRTQDDPDTRAFHAAFEKACGAHAVADYGRYK 188

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E RGIGGIF+D L+S    G   AD +F   VG  F+ +YP LVR N
Sbjct: 189 AWCDEYFFLKHRNEMRGIGGIFYDWLNS----GDFGADLAFTREVGTTFLDIYPRLVRAN 244

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               + E +R+EQL+RRGRY EFNLLYD+GT FG KTGGN+ SIL+SMPP+V WP
Sbjct: 245 MARPWDETEREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNIASILSSMPPVVKWP 299


>gi|304393675|ref|ZP_07375603.1| coproporphyrinogen III oxidase, aerobic [Ahrensia sp. R2A130]
 gi|303294682|gb|EFL89054.1| coproporphyrinogen III oxidase, aerobic [Ahrensia sp. R2A130]
          Length = 304

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 151/303 (49%), Positives = 202/303 (66%), Gaps = 4/303 (1%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           ++  G PDDIE +K  ++  FE L+  IC  FE +E++     +++    F    W RD 
Sbjct: 6   SLPPGLPDDIEGKKATARAWFEELRDDICARFEAIEDDVKGPFSDKDAGRFEFTPWHRD- 64

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
              E  GGG +  +  G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+S+I 
Sbjct: 65  ---EGKGGGGVMGMMTGRVFEKVGVHCSTVHGEFSPEFRAQMPGGNEDPRFWASGVSLIA 121

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP NP+VPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  ++  C+ H 
Sbjct: 122 HPQNPNVPAVHMNTRMVVTSTQWFGGGGDLTPVLDARRTQTDPDTVDFHKAMEAACNAHD 181

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
           VA+Y  +K WCD YF+L HR E RG+GGIF D+LHS  +    DA+F+FI  +G  F  +
Sbjct: 182 VADYDEFKAWCDEYFHLSHRDEPRGVGGIFCDYLHSGEKHDMWDANFAFIQDIGREFADI 241

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           YP+LVRRN    ++E+ R EQLIRRGRY EFNLL D+GT FG KTGGNV SIL+SMPP+V
Sbjct: 242 YPALVRRNMETPWTEEQRDEQLIRRGRYVEFNLLQDRGTIFGLKTGGNVNSILSSMPPVV 301

Query: 305 AWP 307
            +P
Sbjct: 302 KFP 304


>gi|92118712|ref|YP_578441.1| coproporphyrinogen III oxidase [Nitrobacter hamburgensis X14]
 gi|91801606|gb|ABE63981.1| coproporphyrinogen oxidase [Nitrobacter hamburgensis X14]
          Length = 295

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 195/303 (64%), Gaps = 9/303 (2%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS 65
           +E    DD + R R     FE L+  IC  FEKLE++A  +    S   F    W R   
Sbjct: 1   MEAASYDDHKTRARAW---FEQLRDDICAAFEKLEDDAPASLYPGSAGRFVRTPWERTDH 57

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
             +  GGG M ++  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H
Sbjct: 58  TGQPGGGGVM-SMMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAEADPKFWASGISLIAH 116

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-A 184
             NPH+PAVH N R +VT   WFGGG DLTP L  RR   D D + FH  +K  C  H A
Sbjct: 117 MRNPHIPAVHMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDADSVAFHAAMKSACDAHAA 176

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
           +A+Y  YK WCD YF+LPHR E+RGIGGIF+D  H S   G  DAD +F   VG   +K+
Sbjct: 177 IADYDKYKTWCDEYFHLPHRNEARGIGGIFYD-WHDS---GDWDADLAFTQDVGRALLKV 232

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           YP LVRRN++  ++  DR+EQLIRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V
Sbjct: 233 YPELVRRNFNTPWTAADREEQLIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEV 292

Query: 305 AWP 307
            WP
Sbjct: 293 KWP 295


>gi|323139050|ref|ZP_08074109.1| Coproporphyrinogen oxidase [Methylocystis sp. ATCC 49242]
 gi|322395710|gb|EFX98252.1| Coproporphyrinogen oxidase [Methylocystis sp. ATCC 49242]
          Length = 302

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 199/298 (66%), Gaps = 5/298 (1%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHE--NSANRSPKIFTVKHWLRDKSQKEDLG 71
           +E+RK  ++  FE+LQ  I   FE LE+EA    +    +P  F++  W R        G
Sbjct: 6   LEQRKIAAREWFESLQLRIIAAFETLEDEAPGPFSPEATAPGRFSLTPWER-TDHSGAPG 64

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG    +  G+VFEKA V  STV+G   P+F  QI G  ++P F+ATG+S+I HP+NP+V
Sbjct: 65  GGGRMGMIHGRVFEKAGVHCSTVFGTFQPEFARQIPGAAEDPRFFATGISLIAHPWNPNV 124

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R +VT   WFGGG DLTP L++RR   DPD I FH  ++  C +H VA+Y  +
Sbjct: 125 PAVHMNTRFVVTTKAWFGGGADLTPVLDARRTQDDPDTIAFHAAMRGACERHPVADYKRF 184

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSS--PEMGGIDADFSFISAVGDCFIKLYPSLV 249
           KEWCD YF+L HR E RGIGGIF+D+ +S+  P     D+DF+F   VG+ F+ +YP LV
Sbjct: 185 KEWCDEYFFLKHRNEPRGIGGIFYDYFNSAGDPANSAWDSDFAFTRDVGESFLSIYPELV 244

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           RRN+   +SE  R EQL+RRGRY E+NLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 245 RRNFATPWSEAQRDEQLVRRGRYVEYNLLYDRGTIFGLKTGGNVDSILSSMPPMVKWP 302


>gi|85714276|ref|ZP_01045264.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
 gi|85698723|gb|EAQ36592.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
          Length = 295

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 150/295 (50%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++  K  ++  FE L+  IC+ FEKLE++A  +    S   F    W R     +  GGG
Sbjct: 6   LDNHKTRARSWFEQLRDDICSAFEKLEDDAPASLYPGSAGRFVRTPWERTDHTGQPGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M ++  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPH+PA
Sbjct: 66  VM-SMMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPNFWASGISLIAHMRNPHIPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYK 192
           VH N R +VT   WFGGG DLTP L  RR   DPD + FH  +K  C  H A+A Y  YK
Sbjct: 125 VHMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDPDSVAFHAAMKSACDAHAAIAPYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E+RGIGGIF+D  H S   G  DAD +F   VG   +++YP +VR N
Sbjct: 185 TWCDEYFYLPHRKEARGIGGIFYD-WHDS---GDWDADLAFTQDVGRALLRVYPEIVRSN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           ++  ++  DR+EQ+IRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FNTPWTAADREEQVIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|154252687|ref|YP_001413511.1| coproporphyrinogen III oxidase [Parvibaculum lavamentivorans DS-1]
 gi|154156637|gb|ABS63854.1| Coproporphyrinogen oxidase [Parvibaculum lavamentivorans DS-1]
          Length = 304

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 147/296 (49%), Positives = 191/296 (64%), Gaps = 6/296 (2%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D   ERK  ++  F  L+ +IC EFEKLE+E     A+R    F    W R    + D G
Sbjct: 15  DGTTERKARAESWFRELRDLICAEFEKLEDELTGTFADRPAGRFERTPWKRGDGSR-DEG 73

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG M+ +  G+VFEK  V +STV+G+ S DF+ Q+ G  ++P FWA+G+S+I H  NP V
Sbjct: 74  GGEMSVM-HGRVFEKVGVHISTVHGEFSEDFRKQMQGAEEDPRFWASGISLIAHMQNPRV 132

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R + T   WFGGG DLTP L+ +R    PD + FH   K  C +H    Y  +
Sbjct: 133 PAVHMNTRHVYTTKSWFGGGGDLTPVLDVQRRDDHPDTVDFHAAYKRACDRHDADYYPKF 192

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YF+LPHR E RG GGIF+DH +S    G  + DF+F   VG  F+++YP LVRR
Sbjct: 193 KKWCDEYFFLPHRNEPRGTGGIFYDHHNS----GDWEKDFAFTQDVGRAFLEIYPELVRR 248

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           + +  ++E +R+EQL+RRGRY EFNLLYD+GT FG KTGGNV SIL+SMPP V WP
Sbjct: 249 HMNEAWTEAEREEQLVRRGRYVEFNLLYDRGTVFGLKTGGNVNSILSSMPPAVKWP 304


>gi|170744119|ref|YP_001772774.1| coproporphyrinogen III oxidase [Methylobacterium sp. 4-46]
 gi|168198393|gb|ACA20340.1| Coproporphyrinogen oxidase [Methylobacterium sp. 4-46]
          Length = 299

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 193/298 (64%), Gaps = 9/298 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHE--NSANRSPKIFTVKHWLRDKSQKEDL 70
           D++  +  +   F  L+  IC  FE LE+EA    +    +P  F    W R        
Sbjct: 8   DLDALRARATDWFATLRDRICAAFEALESEAAGPFHPEAEAPGRFVRTPWERTDHSGAPG 67

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG MA L  G+VFEKA V VS V+G+ +P+F+ QI G  ++P F+ATG+S+I HP+NP+
Sbjct: 68  GGGVMAML-RGRVFEKAGVHVSAVHGEFAPEFRIQIPGAAEDPRFFATGISLIAHPWNPN 126

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VP VH N R++VT   WFGGG DLTP L+ RR   DPD + FH  L+  C++H  A+Y  
Sbjct: 127 VPTVHMNTRLVVTTKAWFGGGADLTPVLDRRRTQEDPDSVAFHEALRRACARHPGADYAR 186

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
           Y+ WCD YF+L HR E RGIGGIF+D H    PE     AD +    VG+ F+++YP++V
Sbjct: 187 YRTWCDEYFHLKHRNEPRGIGGIFYDYHWSGDPE-----ADLALTRDVGEAFLEVYPAIV 241

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           RRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V WP
Sbjct: 242 RRNLSQPWTEADRREQQVRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPTVRWP 299


>gi|163850113|ref|YP_001638156.1| coproporphyrinogen III oxidase [Methylobacterium extorquens PA1]
 gi|163661718|gb|ABY29085.1| Coproporphyrinogen oxidase [Methylobacterium extorquens PA1]
          Length = 307

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 192/305 (62%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK---IFTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I T  E LE EA       +PK    F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFSTLRDRIVTALETLEAEATGPFHPDAPKEAGTFEKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGTPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E C +HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQEDPDTQFFHACLREACEKHA 187

Query: 185 -VANYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
             A+Y  YK WCD YF+L HR E RGIGGIF+D H    P+     AD ++   VG  F+
Sbjct: 188 PAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGDPQ-----ADLAYTRDVGGAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNLAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|298292456|ref|YP_003694395.1| coproporphyrinogen oxidase [Starkeya novella DSM 506]
 gi|296928967|gb|ADH89776.1| Coproporphyrinogen oxidase [Starkeya novella DSM 506]
          Length = 297

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 193/297 (64%), Gaps = 5/297 (1%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P DIE RK+ ++  FE L++ IC  FEKLE+EA +     +P  F    W R        
Sbjct: 6   PADIEARKQAARAWFEELRNRICACFEKLEDEASDALYPGAPGRFERTPWQRTDHSGGPG 65

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG MA +  G++FEK  V  STV+G+ +P+F+ QI G  ++P F ATG+S+I H  NPH
Sbjct: 66  GGGTMAVM-RGRLFEKVGVHCSTVHGEFAPEFRQQIPGAEEDPRFHATGISLIAHMTNPH 124

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R +VT   WFGGG DLTP L++RR   DPD + FH  ++  C      +Y  
Sbjct: 125 VPAVHMNTRFVVTSKAWFGGGADLTPVLDARRTQEDPDSVAFHAAMRGACESRPHIDYGR 184

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK WCD YF+LPHR E+RGIGGIF+D L S    G  + DF F  AVG  F+ +YP LVR
Sbjct: 185 YKAWCDEYFFLPHRGEARGIGGIFYDWLDS----GDWEGDFHFTKAVGLAFLDVYPRLVR 240

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            N    +   +R+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 241 ANADTPWGMAEREEQLVRRGRYVEFNLLYDRGTLFGLKTGGNVDSILSSMPPVVKWP 297


>gi|218528718|ref|YP_002419534.1| coproporphyrinogen III oxidase [Methylobacterium chloromethanicum
           CM4]
 gi|218521021|gb|ACK81606.1| Coproporphyrinogen oxidase [Methylobacterium chloromethanicum CM4]
          Length = 307

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/305 (49%), Positives = 192/305 (62%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK---IFTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I    E LE EA       +PK    F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGAPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E C +HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTQFFHACLREACEKHA 187

Query: 185 -VANYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
             A+Y  YK WCD YF+L HR E RGIGGIF+D H    P+     AD ++   VG  F+
Sbjct: 188 PAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGDPQ-----ADLAYTRDVGGAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN+   ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNFAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|240137247|ref|YP_002961716.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens AM1]
 gi|240007213|gb|ACS38439.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens AM1]
          Length = 307

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 152/305 (49%), Positives = 191/305 (62%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK---IFTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I    E LE EA       +PK    F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGAPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E C +HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKTWFGGGADLTPVLDRRRTQEDPDTQFFHACLREACEKHA 187

Query: 185 -VANYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
             A+Y  YK WCD YF+L HR E RGIGGIF+D H    P+     AD ++   VG  F+
Sbjct: 188 PAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGDPQ-----ADLAYTRDVGGAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNLAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|254559258|ref|YP_003066353.1| Coproporphyrinogen III oxidase, aerobic [Methylobacterium
           extorquens DM4]
 gi|254266536|emb|CAX22300.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens DM4]
          Length = 307

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 191/305 (62%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK---IFTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I    E LE EA       +PK    F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGAPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E C +HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQQDPDTQFFHACLREACEKHA 187

Query: 185 -VANYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
             A+Y  YK WCD YF+L HR E RGIGGIF+D H    P+     AD ++   VG  F+
Sbjct: 188 PAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGDPQ-----ADLAYTRDVGGAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN    ++E DR++Q +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNLAQAWTEADREQQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|315498162|ref|YP_004086966.1| coproporphyrinogen oxidase [Asticcacaulis excentricus CB 48]
 gi|315416174|gb|ADU12815.1| Coproporphyrinogen oxidase [Asticcacaulis excentricus CB 48]
          Length = 304

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 187/296 (63%), Gaps = 5/296 (1%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D +  R++ +   F +L+  IC  FE LE+ A E     +P  FT K W R  ++  D G
Sbjct: 14  DTLTTRQQAAAVWFRSLRDRICAAFEALEDAAPETLYGPTPGRFTRKPWTRSDAEHGDGG 73

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG M ++  G++FEK  V +STV+G  SPDF   I G  ++P F+ATG+S+I H +NPHV
Sbjct: 74  GGEM-SMMHGRLFEKVGVHISTVHGTFSPDFAKSIPGAAEDPRFFATGISLIAHMWNPHV 132

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R I T   WFGGG DLTP L + R    P    FH   +  C   A   Y  +
Sbjct: 133 PAVHMNTRFINTTQSWFGGGADLTPLLAADRREDAPQAKAFHAAFEATCDHFAPDYYARF 192

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YF+LPHR E RGIGGIF+DHL++    G  +ADF+F  AVG+ F+ +YP LV  
Sbjct: 193 KRWCDEYFFLPHRNEPRGIGGIFYDHLNT----GDHEADFAFTRAVGETFLDIYPRLVSE 248

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                ++E +R +QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 249 RSEVTWTEGERDQQLIQRGRYVEFNLLYDRGTLFGLKTGGNVESILSSMPPAVKWP 304


>gi|188579915|ref|YP_001923360.1| coproporphyrinogen III oxidase [Methylobacterium populi BJ001]
 gi|179343413|gb|ACB78825.1| Coproporphyrinogen oxidase [Methylobacterium populi BJ001]
          Length = 307

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 192/305 (62%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI---FTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I    E LE+EA       +PK    F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFSTLRDRIVAALETLEDEATGPFHPDAPKQAGRFEKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGTPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E C  HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTQFFHACLREACEAHA 187

Query: 185 VA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
            A +Y  +K WCD YF+L HR E RGIGGIF+D H    P+     AD ++   VG  F+
Sbjct: 188 PAVDYERFKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGEPQ-----ADLAYTRDVGGAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN+   ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNFAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|23011790|ref|ZP_00052048.1| COG0408: Coproporphyrinogen III oxidase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 307

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 152/305 (49%), Positives = 188/305 (61%), Gaps = 11/305 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAH---ENSANRSPKIFTVKHWLRDK 64
           +  PDD+   K  +   F  L+  I    E LE+EA    +  A      F    W R  
Sbjct: 9   LPSPDDLAALKSEAGAWFATLRDRIVAALETLEDEAEGPFDPDAPAEAGRFIKTPWQRTD 68

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+IV
Sbjct: 69  HSGAPGGGGVMAML-KGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIV 127

Query: 125 HPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           HP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD   FH  L+E C  HA
Sbjct: 128 HPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQEDPDTQHFHACLREACEAHA 187

Query: 185 -VANYTHYKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFI 242
             ANY  YK WCD YF+L HR E RGIGGIF+D H    P+     AD +F   VG  F+
Sbjct: 188 PAANYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGEPQ-----ADLAFTRDVGQAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN    ++E DR EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNLARAWTEADRLEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|75676805|ref|YP_319226.1| coproporphyrinogen III oxidase [Nitrobacter winogradskyi Nb-255]
 gi|74421675|gb|ABA05874.1| coproporphyrinogen oxidase [Nitrobacter winogradskyi Nb-255]
          Length = 300

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 153/295 (51%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E+RK  ++  FE L+  IC+ FEKLE++A  +    S   F    W R     +  GGG
Sbjct: 11  LEDRKARARSWFEQLRDDICSAFEKLEDDAPASLYPGSAGRFVRTPWERTDHTGKPGGGG 70

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M ++  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPH+PA
Sbjct: 71  VM-SMMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPNFWASGISLIAHMRNPHIPA 129

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN-YTHYK 192
           VH N R +VT   WFGGG DLTP L  RR   DPD + FH  +K  C  HA    Y  YK
Sbjct: 130 VHMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDPDSVAFHAAMKAACDAHAAIAPYDKYK 189

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR+E+RGIGGIF+D  H S   G  +AD +F   VG   +K+YP LVRRN
Sbjct: 190 TWCDEYFHLPHRKEARGIGGIFYD-WHDS---GDWNADLAFTQDVGRALLKVYPELVRRN 245

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++  DR+EQLIRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 246 FSTPWTAADREEQLIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 300


>gi|209886116|ref|YP_002289973.1| coproporphyrinogen III oxidase, aerobic [Oligotropha
           carboxidovorans OM5]
 gi|209874312|gb|ACI94108.1| coproporphyrinogen III oxidase, aerobic [Oligotropha
           carboxidovorans OM5]
          Length = 295

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 152/299 (50%), Positives = 191/299 (63%), Gaps = 14/299 (4%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E RK  ++  FE L+  IC  +E+LE+EA  +        F  K W     ++ D  G 
Sbjct: 6   LENRKTTARAWFEKLRDDICVSYERLEDEAPASLYGDQAGRFERKAW-----ERTDHTGA 60

Query: 74  ----RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
                M ++  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I HP NP
Sbjct: 61  PGGGGMMSMMRGRLFEKVGVHCSTVFGEFAPEFRAQIPGAADDPRFWASGISLIAHPRNP 120

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANY 188
           +VPAVH N R +VT   WFGGG DLTP LE RR   D D I FH   ++ C  H AVA Y
Sbjct: 121 NVPAVHMNTRFVVTTKRWFGGGADLTPVLERRRTQEDSDTIAFHEAFRKTCHAHAAVAPY 180

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K+WCD YF+L HR+E RGIGGIF+D L S    G  DADF+F   VG  F  +YP L
Sbjct: 181 DKFKKWCDDYFFLAHRKEPRGIGGIFYDWLES----GDWDADFAFTQDVGRAFTAIYPEL 236

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           VRRN+   +   DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 237 VRRNFEAPWQAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|182677062|ref|YP_001831208.1| coproporphyrinogen III oxidase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182632945|gb|ACB93719.1| Coproporphyrinogen oxidase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 301

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 193/300 (64%), Gaps = 6/300 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHE---NSANRSPKIFTVKHWLRDKSQK 67
           P  +E  K  ++  FE+LQ  I   FEK+E EA     +    +   FT + W R K+  
Sbjct: 3   PSILEACKAKAKPWFESLQDAIIAAFEKIEAEAPGPFLDDQTPAAGRFTKQPWTR-KNPD 61

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGG    L  G+VFEKA +  STV+G  +P+F  QI G   +P FWA+GLS+I HP 
Sbjct: 62  GEDGGGGFMGLLKGRVFEKAGIHASTVFGRFAPEFASQIPGAEADPRFWASGLSLIAHPV 121

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VA 186
           NP+VP VH N R +VT   WFGGG DLTP L+ RR   D D I FH  ++E C +H  VA
Sbjct: 122 NPNVPTVHMNTRFVVTSKGWFGGGADLTPMLDRRRMQNDKDAIDFHAAMREACDKHKDVA 181

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
           +Y   K+WCD YFYL HR E RGIGG+FFD+    P+    DA+F+F   +G  F+ +YP
Sbjct: 182 DYPRLKDWCDEYFYLKHRNEPRGIGGVFFDYF-DCPDETIFDANFAFAQEIGRAFLAIYP 240

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +VRRN+   ++E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVE+IL+S+PP+V W
Sbjct: 241 EIVRRNWAQPWTEADRDEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVEAILSSLPPVVKW 300


>gi|217979901|ref|YP_002364048.1| coproporphyrinogen III oxidase [Methylocella silvestris BL2]
 gi|217505277|gb|ACK52686.1| Coproporphyrinogen oxidase [Methylocella silvestris BL2]
          Length = 298

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 188/299 (62%), Gaps = 11/299 (3%)

Query: 14  IEERKRISQRK-FENLQSIICTEFEKLENEAHENSA--NRSPKIFTVKHWLRDKSQKEDL 70
           I ER+R   R  FE+LQ  I   FE LE++A    A  + +P  F    W     QKE  
Sbjct: 6   ISERRRTEARAWFESLQQKIIKAFESLEDDAAGPFARPDMAPGRFVQTPW-----QKETG 60

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG MA L  G+VFEK AV  STV+G  +P+F  QI G   +  +WA+G+S+I HP+NP+
Sbjct: 61  GGGLMAVL-KGRVFEKMAVHTSTVFGSFAPEFAAQIPGADADSRYWASGVSLIAHPWNPN 119

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ-HAVANYT 189
           VP VH N R + T   WFGGG DLTP L+ RR   D D + FH  +   C+    VA+Y 
Sbjct: 120 VPCVHMNTRFVETSKAWFGGGADLTPVLDRRRTQTDLDTVDFHAAMAGACAGFEPVADYP 179

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG-GIDADFSFISAVGDCFIKLYPSL 248
            +K WCD YF+L HR E RG+GGIF+D+L   P+     +  F+F  AVG  F  +YP L
Sbjct: 180 RFKTWCDDYFFLKHRNEMRGVGGIFYDYLECPPDDAESFNKSFAFTKAVGLAFADIYPKL 239

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            RRN+   F+E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVE+IL+S+PP+  WP
Sbjct: 240 ARRNFDLSFTEADRHEQLVRRGRYVEFNLLYDRGTVFGLKTGGNVEAILSSLPPMAEWP 298


>gi|329850307|ref|ZP_08265152.1| coproporphyrinogen 3 oxidase, aerobic [Asticcacaulis biprosthecum
           C19]
 gi|328840622|gb|EGF90193.1| coproporphyrinogen 3 oxidase, aerobic [Asticcacaulis biprosthecum
           C19]
          Length = 294

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 185/294 (62%), Gaps = 10/294 (3%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R+  +   F +L+  IC  FE LE+EA  +  + +   F    W R +      GGG
Sbjct: 11  LTDRQTAAAAWFRSLRDQICAAFEALEDEAPASLYDGNAGRFVRTPWDRAE------GGG 64

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              ++  G++FEK  V +STV+G  SP+F   I G  ++P F+ATG+S+I H +NPHVPA
Sbjct: 65  GEMSIMKGRLFEKVGVHISTVHGTFSPEFAKSIPGAAEDPRFFATGISLIAHMHNPHVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R I T   WFGGG DLTP + + RH   PD + FHN  K+ C +     Y  +K 
Sbjct: 125 VHMNTRFITTTTDWFGGGADLTPLMAADRHQDAPDAVAFHNAFKDACDRFDPTYYERFKA 184

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+LPHR E RG+GGIF+DHL+S    G  D DF+F  AVG  F+  YP +VR   
Sbjct: 185 WCDEYFHLPHRNEPRGVGGIFYDHLNS----GDHDTDFAFTQAVGQAFLATYPQIVRDRL 240

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
              +SE +R+ QL++RGRY EFNLLYD+GT FG KTGGNV SI++SMPP+V WP
Sbjct: 241 SQAWSEDEREAQLVQRGRYVEFNLLYDRGTLFGLKTGGNVASIMSSMPPVVKWP 294


>gi|170751060|ref|YP_001757320.1| coproporphyrinogen III oxidase [Methylobacterium radiotolerans JCM
           2831]
 gi|170657582|gb|ACB26637.1| Coproporphyrinogen oxidase [Methylobacterium radiotolerans JCM
           2831]
          Length = 310

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/298 (48%), Positives = 183/298 (61%), Gaps = 9/298 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAH---ENSANRSPKIFTVKHWLRDKSQKED 69
           D+   K  +   FE L+  I    E LE EA       A  +P  F    W R       
Sbjct: 19  DVTAMKSEAAAWFETLRDRIVAALETLEAEAAGPFHPDAPEAPGTFEKTPWNRTDHTGRP 78

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+I HP+NP
Sbjct: 79  GGGGVMAML-RGRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIAHPWNP 137

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           HVP VH N R + T   WFGGG DLTP L+ RR   DPD   FH  L+  C+ H + ++ 
Sbjct: 138 HVPTVHMNTRFVATTRAWFGGGADLTPVLDRRRTQEDPDSRHFHACLERACAAHGI-DHA 196

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            YK WCD YF+L HR E RGIGGIF+D+L S    G   AD ++   VG  F++ YP +V
Sbjct: 197 RYKAWCDEYFHLKHRNEPRGIGGIFYDYLWS----GTPQADLAYTRDVGRAFLEAYPKIV 252

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R N    ++E DR EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+SMPP V WP
Sbjct: 253 RDNLGTPWTEADRHEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSMPPTVRWP 310


>gi|167644667|ref|YP_001682330.1| coproporphyrinogen III oxidase [Caulobacter sp. K31]
 gi|189028099|sp|B0T8D1|HEM6_CAUSK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167347097|gb|ABZ69832.1| Coproporphyrinogen oxidase [Caulobacter sp. K31]
          Length = 290

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 186/295 (63%), Gaps = 10/295 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D++ +K  ++  FE+L+  IC EFE+LE+EA  +     P  F  K W R+       GG
Sbjct: 6   DLDGKKATARAWFESLRDQICAEFERLEDEAPTDLYAGEPGRFVRKPWDREA------GG 59

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + ++  G++FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  +P VP
Sbjct: 60  GGVMSMMHGRLFEKVGVHVSTVFGTFTPEMAKNMPGADEDPRFFATGISLIAHMRSPRVP 119

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R I T   WFGGG DLTP L  +R    PD I FH   +  C  H    +  YK
Sbjct: 120 AVHMNTRFIATTKSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYQRACDAHDPTWHAKYK 179

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR E RGIGGIF+DH  S    G    DF+F   VG  F+++YP+LVRR 
Sbjct: 180 AWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWAKDFAFTQDVGRAFLEIYPTLVRRR 235

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               +S ++R++QL++RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 236 MGETWSAEEREQQLVQRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPEVKWP 290


>gi|304321661|ref|YP_003855304.1| coproporphyrinogen III oxidase, aerobic [Parvularcula bermudensis
           HTCC2503]
 gi|303300563|gb|ADM10162.1| coproporphyrinogen III oxidase, aerobic [Parvularcula bermudensis
           HTCC2503]
          Length = 294

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 187/296 (63%), Gaps = 7/296 (2%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLG 71
           D+  R+  ++  FE L+  I   FE +E++  E      P   FT+  W R     ED G
Sbjct: 5   DLPPRQAKAKAWFETLRDKIVAAFEAIEDKGSEALYGDQPAGRFTLTPWRRGDG-TEDQG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG M  L  G+VFEKA + VSTV+G+ SP+F+ QI G  ++P FWA+G+S+I HP NPHV
Sbjct: 64  GGVMGML-HGRVFEKAGIHVSTVFGEFSPEFRSQIPGAEEDPRFWASGISLIAHPLNPHV 122

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PA H N RMIVT   WFGGG DL P   + R     D  FF + ++  C +     +  +
Sbjct: 123 PAAHMNTRMIVTTKCWFGGGGDLNPMHPAYRDEDHEDARFFLDAMRGACDRRDPHYFARF 182

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           KE CD YF+LPHR E RG+GGIF+DH +S    G  + DF+F   VG  F+  YP+LV R
Sbjct: 183 KEACDTYFFLPHRGEPRGVGGIFYDHHNS----GDWEDDFAFTKDVGLAFLDSYPALVHR 238

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                +SE+DRQ QL +RGRYAEFNLLYD+GT FG KTGGNVESIL+S+PPL AWP
Sbjct: 239 RLETPWSEEDRQLQLRQRGRYAEFNLLYDRGTTFGLKTGGNVESILSSLPPLTAWP 294


>gi|114569285|ref|YP_755965.1| coproporphyrinogen III oxidase [Maricaulis maris MCS10]
 gi|114339747|gb|ABI65027.1| coproporphyrinogen oxidase [Maricaulis maris MCS10]
          Length = 318

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 179/283 (63%), Gaps = 6/283 (2%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           FE+L+  IC EFE LE EA           F  + W R     ++ G      +  G++F
Sbjct: 42  FEDLRDQICAEFESLEQEAPGALYPGEAGKFEREAWTRGDGSSDEGG--GTMAMMRGRLF 99

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EK  V VS V G+ S  F+ QI G  ++P F+ATG+S+I H ++PHVPAVH N R I T 
Sbjct: 100 EKVGVHVSAVQGEFSEAFRQQIPGAAEDPRFFATGVSLIAHMWSPHVPAVHMNTRFITTT 159

Query: 145 AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHR 204
            +WFGGG+DLTP L+  R+   PD I FH   K  C +H    +  +K+WCD YFYLPHR
Sbjct: 160 QWWFGGGMDLTPVLDRARNQRHPDAIDFHAACKAACDEHGDDFHARFKKWCDEYFYLPHR 219

Query: 205 QESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQE 264
            E RGIGGIF+D  ++    G  DADFSF   VG  F+ +YP +VRR     ++ +DR+E
Sbjct: 220 DEPRGIGGIFYDRHNT----GDWDADFSFTRDVGLAFLDIYPKIVRRRMGETWTPKDREE 275

Query: 265 QLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           QLIRRGRYAEFNLL+D+GT FG +TGGNV+SIL+SMPP   WP
Sbjct: 276 QLIRRGRYAEFNLLHDRGTKFGLETGGNVKSILSSMPPEAKWP 318


>gi|261752838|ref|ZP_05996547.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|261742591|gb|EEY30517.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
          Length = 306

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 175/264 (66%), Gaps = 6/264 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W     QK+D 
Sbjct: 48  PADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW-----QKDDG 102

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
            GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+S+I HP NP+
Sbjct: 103 NGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPN 162

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYT 189
           VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C +H  + +Y 
Sbjct: 163 VPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKDIVDYQ 222

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
             KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG  F  +YP LV
Sbjct: 223 RLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLV 282

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYA 273
           R+N++  ++E DR EQLIRRGRY 
Sbjct: 283 RQNFNKDWTEADRDEQLIRRGRYV 306


>gi|254702269|ref|ZP_05164097.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
          Length = 269

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
                QK+D  GG + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  -----QKDDGNGGGVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H  + +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYA 273
            F  +YP LVR+N++  ++E DR EQLIRRGRY 
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYV 269


>gi|295687831|ref|YP_003591524.1| coproporphyrinogen oxidase [Caulobacter segnis ATCC 21756]
 gi|295429734|gb|ADG08906.1| Coproporphyrinogen oxidase [Caulobacter segnis ATCC 21756]
          Length = 290

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 184/295 (62%), Gaps = 10/295 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D++ +K  ++  FE+L+  IC EFE+LE+EA  +    +P  F  K W R+         
Sbjct: 6   DLDAKKARARAWFESLRDQICAEFERLEDEAPADLYPGAPGRFEKKPWSREAGGGG---- 61

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
             +  +  G++FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  NP VP
Sbjct: 62  --VMGMMHGRLFEKVGVHVSTVHGTFTPEMAKNMPGADEDPRFFATGVSLIAHMTNPRVP 119

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R I T   WFGGG DLTP L  +R    PD I FH   +  C ++    +  YK
Sbjct: 120 AVHMNTRFIATTKTWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYQRACDKYDPTWHAKYK 179

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR E RGIGGIF+DH  S    G  + DF+F   VG  F+++YP+LVRR 
Sbjct: 180 AWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWERDFAFTQDVGRAFLEIYPTLVRRR 235

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++  +RQ+QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 236 MGEAWTADERQQQLIQRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPPTVKWP 290


>gi|58040326|ref|YP_192290.1| coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
 gi|58002740|gb|AAW61634.1| Coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
          Length = 305

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 185/295 (62%), Gaps = 16/295 (5%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSAN-----RSPKIFTVKHWLRDKSQKEDLGG 72
           K+ ++  FE L+  IC  +EKLE+EA E  +       +P  F    W R +      GG
Sbjct: 22  KQDAKAWFETLRDRICASYEKLEDEAAEGGSQVLRDRTAPGRFERTAWSRPE------GG 75

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
             + ++  G+VFEK  V VSTV+G+ SP+F+  I G  ++P F+ATG+S++ HP NPHV 
Sbjct: 76  SGVMSVMRGRVFEKVGVNVSTVWGEFSPEFRKNIPGADEDPRFFATGVSLVAHPCNPHVS 135

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMI+T   WFGGG D+TP       +   D  +FH + ++ C++H   +Y  +K
Sbjct: 136 AAHFNTRMIITTKGWFGGGGDITPMFPESAEAQS-DAAYFHKSFEDACNRHDPEHYPRFK 194

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCDRYF+L HR E RG+GGIF+D  ++    G +D DF+F   VG  F   YP++VRR 
Sbjct: 195 EWCDRYFHLHHRNEPRGLGGIFYDQFYT----GDVDLDFAFTKDVGMAFHDAYPAVVRRR 250

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++E DR  QLIRRGRY EFNLL+D+GT FG KTGGN E+IL SMPP V WP
Sbjct: 251 MFTPWTEADRDAQLIRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSMPPEVRWP 305


>gi|326405433|ref|YP_004285515.1| coproporphyrinogen III oxidase [Acidiphilium multivorum AIU301]
 gi|325052295|dbj|BAJ82633.1| coproporphyrinogen III oxidase [Acidiphilium multivorum AIU301]
          Length = 307

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 175/293 (59%), Gaps = 6/293 (2%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           E  K  +   F  L+  IC  FE +E+      A+R+P  F    W R    +  L GG 
Sbjct: 21  EALKPAASEWFRTLRDRICAAFEAIEDAHGGMLADRAPGRFARTPWTRAPDGQNRLEGGG 80

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
             +L  G+VFEK  V +S V G  SPDF   I G  ++P FWA G+S++ H ++P VPA 
Sbjct: 81  EMSLMRGRVFEKVGVNISVVGGAFSPDFAKNIPGAAEDPRFWAAGISLVAHMHSPRVPAA 140

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           H N RMIVT   WFGGG DLTP L+    +   D   FH+  +  C ++    Y  + +W
Sbjct: 141 HMNTRMIVTTKGWFGGGGDLTP-LQPGTAAAKEDAALFHDAFRAACDRYDPDYYPRFSKW 199

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYLPHR E+RG GGIF+D+L + PE+      F+F   VG  F++ YP++VRR   
Sbjct: 200 CDEYFYLPHRGETRGAGGIFYDYLETEPEL-----HFAFTRDVGLAFLESYPAIVRRRMD 254

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
             ++ ++R+ QL+RRGRY EFNLLYD+GT FG KTGGN E+IL SMPP V WP
Sbjct: 255 EAWTPEEREAQLVRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSMPPEVKWP 307


>gi|148261926|ref|YP_001236053.1| coproporphyrinogen III oxidase [Acidiphilium cryptum JF-5]
 gi|146403607|gb|ABQ32134.1| coproporphyrinogen oxidase [Acidiphilium cryptum JF-5]
          Length = 307

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 174/293 (59%), Gaps = 6/293 (2%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           E  K  +   F  L+  IC  FE +E+      A+R+P  F    W R    +  L GG 
Sbjct: 21  EALKPAASEWFRTLRDRICAAFEAIEDAHGGMLADRAPGRFARTPWTRAPDGQNRLEGGG 80

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
             +L  G+VFEK  V +S V G  SPDF   I G  ++P FWA G+S++ H ++P VPA 
Sbjct: 81  EMSLMRGRVFEKVGVNISVVGGAFSPDFAKNIPGAAEDPRFWAAGISLVAHMHSPRVPAA 140

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           H N RMIVT   WFGGG DLTP L+    +   D   FH+  +  C ++    Y  + +W
Sbjct: 141 HMNTRMIVTTKGWFGGGGDLTP-LQPGTAAAKEDAALFHDAFRAACDRYDPDYYPRFSKW 199

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYLPHR E+RG GGIF+D+L + PE       F+F   VG  F++ YP++VRR   
Sbjct: 200 CDEYFYLPHRGETRGAGGIFYDYLETEPER-----HFAFTRDVGLAFLESYPAIVRRRMD 254

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
             ++ ++R+ QL+RRGRY EFNLLYD+GT FG KTGGN E+IL SMPP V WP
Sbjct: 255 EAWTPEEREAQLVRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSMPPEVKWP 307


>gi|296115116|ref|ZP_06833757.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978217|gb|EFG84954.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 303

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 182/295 (61%), Gaps = 10/295 (3%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHEN-----SANRSPKIFTVKHWLRDKSQKEDLGG 72
           K  ++  F+NL+  IC  FE++E++A  +      A  +P  F    W R  ++    GG
Sbjct: 14  KEAARTWFKNLRDRICAAFEQIEDDAARDDAPTLGARTAPGRFERTSWTRGANEDGSPGG 73

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G+VFEK  V VSTV G  SP+F+  I G  ++P F+ATG+S++ H  +P VP
Sbjct: 74  GGVISLMRGRVFEKVGVNVSTVSGTFSPEFRHTIPGAAEDPRFFATGISLVAHMCSPLVP 133

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMIVT   WFGGG D+TP       +   D   FH+  +  C +H    Y  ++
Sbjct: 134 AAHFNTRMIVTTEGWFGGGGDITPMFPKSAEAI-ADAARFHDGFRTACERHDPEYYPRFR 192

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCD+YFYLPHR E+RG+GGIF+D LHS    G  +ADF+F   VG  F++ YP +VR  
Sbjct: 193 EWCDKYFYLPHRDEARGLGGIFYDRLHS----GDANADFAFTRDVGLGFLETYPDIVRGR 248

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++   R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S+PP V WP
Sbjct: 249 MMEPWTPDQREAQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSLPPEVRWP 303


>gi|288962014|ref|YP_003452324.1| coproporphyrinogen III oxidase [Azospirillum sp. B510]
 gi|288914294|dbj|BAI75780.1| coproporphyrinogen III oxidase [Azospirillum sp. B510]
          Length = 291

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 183/294 (62%), Gaps = 10/294 (3%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  +   F+ L+  ICT FE LE E     A+  P  F  K W R   +  + GGG
Sbjct: 8   IEDRKARAAAWFKELRDRICTAFEALEEELTGTHADLPPGRFERKSWTRPDHEGGEGGGG 67

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G+VFEK  V +STV+G  SP+F+  I G  +   FWA+G+S++ H  +P VPA
Sbjct: 68  TMSVM-KGRVFEKVGVNISTVHGTFSPEFRATIPGAAETGEFWASGISLVAHMRSPLVPA 126

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
            H N R IVT   WFGGG DLTP +   R + D     FH  L+  C +H    Y  YKE
Sbjct: 127 THMNTRHIVTTKGWFGGGADLTPMVADDRDTAD-----FHAGLRAACDRHDPDYYPRYKE 181

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCDRYF+LPHR E+RG+GGIF+D L S    G  +ADF+F   VG  F+  Y +LVRR+ 
Sbjct: 182 WCDRYFHLPHRGEARGVGGIFYDQLAS----GDWEADFAFTRDVGASFLDSYVTLVRRHM 237

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +  ++ + R+ QLIRRGRY EFNLLYD+GT FG KTGGN E+IL S+PP V WP
Sbjct: 238 NRPWTAEQREHQLIRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSLPPEVKWP 291


>gi|16124761|ref|NP_419325.1| coproporphyrinogen III oxidase [Caulobacter crescentus CB15]
 gi|221233477|ref|YP_002515913.1| coproporphyrinogen III oxidase [Caulobacter crescentus NA1000]
 gi|21542087|sp|Q9AAT8|HEM6_CAUCR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800267|sp|B8GZX1|HEM6_CAUCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|13421687|gb|AAK22493.1| coproporphyrinogen III oxidase, aerobic [Caulobacter crescentus
           CB15]
 gi|220962649|gb|ACL94005.1| coproporphyrinogen III oxidase [Caulobacter crescentus NA1000]
          Length = 290

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 181/295 (61%), Gaps = 10/295 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D++ +K  ++  FE+L+  IC  FE+LE+EA  +    +P  F  K W R          
Sbjct: 6   DLDTKKAAARAWFESLRDQICAAFEQLEDEAPADLYPGAPGRFAKKAWDRPAGGGG---- 61

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
             +  +  G++FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  NP VP
Sbjct: 62  --VMGMMHGRLFEKVGVHVSTVFGTFTPEMAKTMPGAAEDPRFFATGISLIAHMTNPRVP 119

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R I T   WFGGG DLTP L  +R    PD I FH   K  C ++    +  YK
Sbjct: 120 AVHMNTRFIATTKSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYKRACDKYDPEWHPKYK 179

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR E RGIGGIF+DH  S    G    DF+F   VG  F+++YP+LVRR 
Sbjct: 180 AWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWARDFAFTQDVGRAFLEIYPTLVRRR 235

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++  +R++QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 236 MGEAWTADEREQQLIQRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPAVKWP 290


>gi|220926368|ref|YP_002501670.1| coproporphyrinogen III oxidase [Methylobacterium nodulans ORS 2060]
 gi|219950975|gb|ACL61367.1| coproporphyrinogen III oxidase [Methylobacterium nodulans ORS 2060]
          Length = 299

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 189/298 (63%), Gaps = 9/298 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHE--NSANRSPKIFTVKHWLRDKSQKEDL 70
           DI+  K+ + R F  L+  IC  FE LE EA    +    +P  F    W R        
Sbjct: 8   DIDGLKQEATRWFSGLRDRICAAFEALEAEATGPFDPEATAPGRFVRTPWERTDHSGAPG 67

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG MA L  G+VFEKA V VS V+G+ +P+F+ QI G  ++P F+ATG+S+I HP+NP+
Sbjct: 68  GGGIMAML-RGRVFEKAGVHVSAVHGEFAPEFRIQIPGAAEDPRFFATGISLIAHPWNPN 126

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VP VH N R +VT   WFGGG DLTP L+ RR   DPD + FH  LK  C +H  A+Y  
Sbjct: 127 VPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRRQDDPDTVAFHAALKAACERHPGADYAR 186

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFD-HLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
           YK WCD YF+L HR E RG+GGIF+D H    P+     AD +    VG+ F+ +YP +V
Sbjct: 187 YKAWCDEYFHLKHRNEPRGVGGIFYDYHWTGDPQ-----ADLALTREVGEAFLSVYPEIV 241

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           RRN    ++E DR EQ ++RGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V WP
Sbjct: 242 RRNLATPWTEADRHEQQVQRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPTVRWP 299


>gi|114328386|ref|YP_745543.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
 gi|114316560|gb|ABI62620.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
          Length = 299

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 183/295 (62%), Gaps = 8/295 (2%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDLGG 72
           E  K  ++  FE+L+  IC  FE +E++    +   +  P  F  + W R  S     GG
Sbjct: 11  EHLKSAARLWFESLRDRICAAFEAIEDDLPPAAPFGDLPPGRFERQPWDRPTSDGSPGGG 70

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G M+ +  G+VFEK  V VSTV+G+ S DF+ QI G   +P FWA+G+S++ H  +PHVP
Sbjct: 71  GVMSVM-RGRVFEKVGVNVSTVWGEFSEDFRRQIPGAEHDPRFWASGISLVAHMRSPHVP 129

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N RM+VT   WFGGG DLTP       + + D   FH + +  C  H  A Y  +K
Sbjct: 130 AVHMNTRMLVTTKGWFGGGGDLTPMFLDTPETAE-DRESFHASYRAACDAHDPALYPKFK 188

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+LPHR E RG+GGIFFDH ++    G  + DF F   VG+ F+ +YP++VRR 
Sbjct: 189 QWCDEYFFLPHRGEPRGVGGIFFDHHNT----GNAEEDFHFTRDVGEAFLNVYPAIVRRR 244

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++E +R  QL+RRGRY EFNLL+D+GT FG +TGGN E+IL SMPP V WP
Sbjct: 245 MERPWTEAERHHQLVRRGRYVEFNLLHDRGTLFGLRTGGNTEAILMSMPPEVRWP 299


>gi|83859588|ref|ZP_00953108.1| coproporphyrinogen III oxidase [Oceanicaulis alexandrii HTCC2633]
 gi|83851947|gb|EAP89801.1| coproporphyrinogen III oxidase [Oceanicaulis alexandrii HTCC2633]
          Length = 299

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 182/296 (61%), Gaps = 6/296 (2%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D + +R++ ++  FE+L+  IC+ FE LE  A           F +  W+R    +E  G
Sbjct: 10  DVLADRRQRAKAWFESLRDRICSAFEALEAAADPTLYPGEAGRFELTPWVRGDGAQELGG 69

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
              +  +  G++FEK  V VSTV+G+ SP+F  ++ G   +P F+ATG+S+I H  NPHV
Sbjct: 70  --GVMGMMHGRLFEKVGVHVSTVFGEFSPEFAARVRGAETDPRFFATGISLIAHMRNPHV 127

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R I T   WFGGG+DL P+ + +R    PD   FH   K  C  H  + Y  +
Sbjct: 128 PAVHMNTRFITTTLSWFGGGMDLNPTQDYQRDKSFPDSKAFHAAAKSACDAHDPSYYPRF 187

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
            +WCD YF+L HR E RG GGIF+DHL S    G  +ADF+F   VG+ F+  YP +V+ 
Sbjct: 188 TDWCDEYFWLKHRNEPRGTGGIFYDHLDS----GDHEADFAFTRDVGEAFLSAYPEIVKT 243

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                +SE DR+EQL+RRGRYAEFNLLYD+GT FG +TGGN+ SIL+SMPP   WP
Sbjct: 244 RMGQSWSEDDREEQLVRRGRYAEFNLLYDRGTKFGLETGGNINSILSSMPPHARWP 299


>gi|197106335|ref|YP_002131712.1| coproporphyrinogen III oxidase precursor [Phenylobacterium zucineum
           HLK1]
 gi|196479755|gb|ACG79283.1| coproporphyrinogen III oxidase precursor [Phenylobacterium zucineum
           HLK1]
          Length = 296

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 177/297 (59%), Gaps = 9/297 (3%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P +I  R+  ++  FE+LQ+ IC E E+LE+EA       +P  F ++ W R     E  
Sbjct: 9   PPEILARRDRAKAWFEDLQARICAELERLEDEAPPELYPDAPGRFEMRPWTR-----ETG 63

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
            GG       G++FEKA V  S      SP+   Q+ G  K+P + +  +S+IVHP +P 
Sbjct: 64  VGGGTGGHLKGRLFEKAGVHTSAATARFSPEMAAQMPGADKDPSYVSASISLIVHPVSPR 123

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VP VH N R + T   WFGGG DLTP L+ +R     D   FH  +K  C       +  
Sbjct: 124 VPTVHMNTRFLSTAESWFGGGADLTPMLDEQRSQDADDAKLFHAAMKAACDPFDPEWHPR 183

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK WCD YF+LPHR E RGIGGIF+D  ++    G  + DF+F  AVG+ F+ +YP +VR
Sbjct: 184 YKAWCDEYFFLPHRGEPRGIGGIFYDRHNT----GDFETDFAFTRAVGEAFLDVYPKIVR 239

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                 +++ DR EQL+RRGRY EFNLLYD+GT FG K GGN+E+IL+SMPPLVAWP
Sbjct: 240 HRMSEPWTDADRAEQLVRRGRYVEFNLLYDRGTMFGLKAGGNIETILSSMPPLVAWP 296


>gi|330993449|ref|ZP_08317384.1| Coproporphyrinogen-III oxidase [Gluconacetobacter sp. SXCC-1]
 gi|329759479|gb|EGG75988.1| Coproporphyrinogen-III oxidase [Gluconacetobacter sp. SXCC-1]
          Length = 302

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 182/295 (61%), Gaps = 11/295 (3%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSA-----NRSPKIFTVKHWLRDKSQKEDLGG 72
           K  ++  FE+L+  IC+ FE++E+EA    +       +P  F    W R        GG
Sbjct: 14  KDTARAWFESLRDRICSAFEQIEDEAAAAGSPTLPGKEAPGRFIRTPWERTNDDGTP-GG 72

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G+VFEK  V VSTV G+ SP F+D I G  ++P F+ATG+S++ H  +P VP
Sbjct: 73  GGVISLMRGRVFEKVGVNVSTVSGEFSPGFRDSIPGAAQDPRFFATGISLVAHMCSPLVP 132

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMI+T   WFGGG D+TP       +   D   FH+  +  C +H    Y  ++
Sbjct: 133 AAHFNTRMIITTQGWFGGGGDITPMFPESAEAIS-DAARFHDGFRLACEKHDPDYYPRFR 191

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCDRYFYLPHR E RG+GGIF+D L++    G +DADF+F   VG  F++ YP +VR  
Sbjct: 192 EWCDRYFYLPHRNEPRGLGGIFYDRLNT----GDLDADFAFTRDVGLGFLETYPDIVRGR 247

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++E  R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S+PP V WP
Sbjct: 248 MMEPWTEAQRKAQLVRRGRYVEFNLLHDRGTIFGLKTGGNTEAILMSLPPEVHWP 302


>gi|302383839|ref|YP_003819662.1| coproporphyrinogen oxidase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194467|gb|ADL02039.1| Coproporphyrinogen oxidase [Brevundimonas subvibrioides ATCC 15264]
          Length = 295

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 177/296 (59%), Gaps = 10/296 (3%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D ++ +K  ++  FE L++ I    E+LE+ A  +     P  F    W R +       
Sbjct: 10  DPLDLKKTETRAWFEELRNRIHARLEQLEDSAPADLFPGEPGRFVRTPWSRHEGGGG--- 66

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
              +  +  G++FEK  V VSTV+G    D+   + G  ++P F+ATG+S+I HP +P V
Sbjct: 67  ---VMGMMHGRLFEKVGVHVSTVHGTFPADYAKSVPGAEEDPRFYATGISLICHPVSPKV 123

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R I T   WFGGG DLTP L+  R    PD + FH  ++  C  H  A Y  Y
Sbjct: 124 PAVHMNTRFIATTKSWFGGGADLTPVLDVERTQEAPDTVAFHAGMRSPCDAHDPAWYPKY 183

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YF LPHR E RGIGGIF+DH  S    G  D DF+F   VG  FI  Y ++V R
Sbjct: 184 KQWCDEYFMLPHRNEMRGIGGIFYDHHDS----GDYDKDFAFTRDVGMAFIDTYAAIVER 239

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                +++ +R+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP+V WP
Sbjct: 240 RMSEAWTDDEREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPPVVKWP 295


>gi|329890252|ref|ZP_08268595.1| coproporphyrinogen 3 oxidase, aerobic [Brevundimonas diminuta ATCC
           11568]
 gi|328845553|gb|EGF95117.1| coproporphyrinogen 3 oxidase, aerobic [Brevundimonas diminuta ATCC
           11568]
          Length = 326

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 179/292 (61%), Gaps = 10/292 (3%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           ER+  ++  FE L+  I   FE LE+ A        P  F    W R +          +
Sbjct: 45  ERRERARVWFETLRDKIHAGFEALEDAAPAELFAGEPGRFVRTPWDRKEGGGG------V 98

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             + +G++FEK  V  STV+G    D+   + G  ++P F+ATG+S+I HP +P VPAVH
Sbjct: 99  MGMMSGRLFEKVGVHCSTVHGTFPADYAKNVPGAEEDPRFYATGISLICHPVSPRVPAVH 158

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
            N R+I T   WFGGG DLTP L++ R    PD + FH  +K  C     + +  YK+WC
Sbjct: 159 MNTRLISTTKTWFGGGGDLTPVLDADRRDDHPDTVDFHAAMKGACDAFDPSWHAKYKQWC 218

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+LPHR E RG GG+F+DH H S   G  + DF+F  AVG+ F+K+Y  +V R  H 
Sbjct: 219 DEYFFLPHRNEPRGTGGVFYDH-HDS---GDWEKDFAFTQAVGEAFLKVYCDIVARRMHE 274

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            ++E +R+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP+V WP
Sbjct: 275 PWTEAEREEQLIRRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPVVKWP 326


>gi|162147842|ref|YP_001602303.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542462|ref|YP_002274691.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786419|emb|CAP56001.1| putative coproporphyrinogen 3 oxidase, aerobic [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530139|gb|ACI50076.1| Coproporphyrinogen oxidase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 300

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/286 (46%), Positives = 174/286 (60%), Gaps = 9/286 (3%)

Query: 25  FENLQSIICTEFEKLENEAHENSA---NRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           FE L+  IC  FE++E +A    A   + +P  F    W R        GGG + +L  G
Sbjct: 21  FEGLRDRICAAFERIEQDADSVQALPGHAAPGAFQRTAWDRTNDDGTP-GGGGVISLMRG 79

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
           +VFEK  V VSTV G  SP+F+  I G  ++P F+ATG+S++ H  NP VPA HFN R+I
Sbjct: 80  RVFEKVGVNVSTVEGTFSPEFRASIPGAAEDPRFFATGISLVAHMCNPLVPAAHFNTRLI 139

Query: 142 VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           VT   WFGGG D+TP       +   D   FH   +  C +H    Y  +KEWCDRYF+L
Sbjct: 140 VTTQGWFGGGGDITPMFPDSAEA-QADAARFHAGFRAACDRHDPTYYPRFKEWCDRYFFL 198

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GGIF+D L+S  E     ADF+F   VG  F++ YP++VR      ++   
Sbjct: 199 PHRGEARGLGGIFYDRLNSGDEA----ADFAFTRDVGLAFLETYPAIVRHRMGERWTAHQ 254

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S+PP V WP
Sbjct: 255 REAQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSLPPEVRWP 300


>gi|149185629|ref|ZP_01863945.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
 gi|148830849|gb|EDL49284.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
          Length = 285

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 176/295 (59%), Gaps = 14/295 (4%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D  E+ + ++  FE L+  IC EFE +E EA   +A      F    W R++    D GG
Sbjct: 3   DWTEQTQTARTWFETLRDRICAEFESIEREAGSEAA------FQYDSWSREEEGNADPGG 56

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTT-KNPYFWATGLSVIVHPYNPHV 131
           G    L  GKVFEK  V VSTV G+ +P+F   I G + +NP F ATG+S++ H  NPHV
Sbjct: 57  GTRG-LMKGKVFEKVGVNVSTVRGNFAPEFAASINGASPENPGFTATGISLVAHMANPHV 115

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R + T A WFGGG DL P L      Y+ D   FH   +  C+ H    Y  +
Sbjct: 116 PAVHMNTRFLTTQAAWFGGGADLNPPL-----PYEEDTEEFHARFRAACAAHNPTYYDRF 170

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+W D YFY+PHR   RG+GGIF+DHL    E  G + + +F   VG+ F+ +YP LVRR
Sbjct: 171 KKWADDYFYIPHRGVHRGVGGIFYDHLECDDE-AGFERNLAFTKDVGEAFLDIYPKLVRR 229

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                F+E D+ +QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 230 RMESEFTEADKAQQLEWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEATW 284


>gi|254419937|ref|ZP_05033661.1| coproporphyrinogen III oxidase, aerobic [Brevundimonas sp. BAL3]
 gi|196186114|gb|EDX81090.1| coproporphyrinogen III oxidase, aerobic [Brevundimonas sp. BAL3]
          Length = 293

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 177/296 (59%), Gaps = 10/296 (3%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D ++ +K  ++  FE+L+  I + FE LE+ A +      P  F    W R         
Sbjct: 8   DPLDLKKVETRAWFEHLRDRIHSAFEALEDAAPDELFPGEPGRFVRTAWDRKDGGGG--- 64

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
              +  +  G++FEK  V VSTV+G    D+   + G  ++P F+ATG+S+I HP +P V
Sbjct: 65  ---VMGMMHGRLFEKVGVHVSTVHGSFPADYAKTVPGAAEDPRFFATGISLICHPVSPRV 121

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R I T   WFGGG DLTP L++ R    PD + FH  +K  C  H    +  Y
Sbjct: 122 PAVHMNTRFIATTRSWFGGGGDLTPVLDADRRQDHPDTLAFHAAMKAACDAHDPDWHAKY 181

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YF+LPHRQE RG GGIF+DH  S    G  D DF+F   VG  F+ +YP +V  
Sbjct: 182 KAWCDEYFFLPHRQEPRGTGGIFYDHHDS----GDHDRDFAFTRDVGLAFLDVYPKIVAG 237

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                ++ ++R+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 238 RMGEAWTPEEREEQLVRRGRYVEFNLLYDRGTMFGLKTGGNVDSILSSMPPVVKWP 293


>gi|326387117|ref|ZP_08208727.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208298|gb|EGD59105.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 293

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 178/296 (60%), Gaps = 17/296 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS-QKEDLG 71
           D   R R+    FE+L+  IC  FE +E EA  ++       FT   W R+ + +  + G
Sbjct: 12  DATARARVW---FESLRDRICAAFEAIEREAGSDAC------FTYTPWNREHAGEPVENG 62

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGT-TKNPYFWATGLSVIVHPYNPH 130
           GG +  L  GKVFEK  V VSTV G  SP+F   I G   +NP F ATG+S++ H  NPH
Sbjct: 63  GGGVQGLMKGKVFEKVGVNVSTVGGVFSPEFARTINGADPENPTFTATGISLVAHMANPH 122

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R + T   WFGGG DL P +      YD D   FH   K  C  H    Y  
Sbjct: 123 VPAVHMNTRFLTTRKAWFGGGGDLNPPI-----PYDEDTAEFHAAFKAACDAHDEGYYPR 177

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K W D YFY+PHR+  RG+GGIF+DHL   P+M G +A+F+F   VG+ F+ ++P LVR
Sbjct: 178 FKAWADDYFYIPHRRVHRGVGGIFYDHL-ECPDMDGFEANFAFTRDVGEAFLDVFPRLVR 236

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     F+E ++ +QL+ RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 237 RRMGMPFTEAEKHQQLVWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEAIW 292


>gi|258541901|ref|YP_003187334.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632979|dbj|BAH98954.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636036|dbj|BAI02005.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639091|dbj|BAI05053.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642145|dbj|BAI08100.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645200|dbj|BAI11148.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648255|dbj|BAI14196.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651308|dbj|BAI17242.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654299|dbj|BAI20226.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 304

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 180/295 (61%), Gaps = 11/295 (3%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEA-HENS----ANRSPKIFTVKHWLRDKSQKEDLGG 72
           +  +++ FE+L+  IC  FE +E++A  +NS     + +   F  K W R        GG
Sbjct: 16  REPARQWFESLRDKICAAFEAIEDDAVKQNSPVLPGHEAAGRFERKSWNRLNEDGSPGGG 75

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G M+ +  G+VFEK  V VSTV G  +P+F   I G  ++P+F+ATG+S++ H  +P VP
Sbjct: 76  GVMSVM-HGRVFEKVGVNVSTVQGTFTPEFAATIPGAAEDPHFFATGISLVAHMCSPLVP 134

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMI+T   WFGGG D+TP       + D D   FH    + C+ H    Y  +K
Sbjct: 135 AAHFNTRMIITTKGWFGGGGDITPMFPESAEAQD-DAARFHAAFAQACNAHDPEYYPRFK 193

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD+YFYLPHR E RG+GGIF+D L+S    G +  DF+F   VG  F+K YP ++R  
Sbjct: 194 AWCDKYFYLPHRNEPRGLGGIFYDRLNS----GDVQEDFAFTKDVGLAFLKSYPEIIRSR 249

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++ + R+ QLIRRGRY EFNL++D+GT FG KTGG+ E+IL SMPP V WP
Sbjct: 250 MMEPWTPEQREAQLIRRGRYVEFNLVHDRGTLFGLKTGGHTEAILMSMPPEVKWP 304


>gi|294085753|ref|YP_003552513.1| coproporphyrinogen III oxidase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665328|gb|ADE40429.1| coproporphyrinogen III oxidase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 286

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 178/297 (59%), Gaps = 22/297 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++++K+ +   F +L+  IC  FE +E++ +  + +     F  K W R+       GGG
Sbjct: 9   LDDKKQAATAWFASLRDQICARFESIEDQ-YTGAPDLESGRFARKTWNREG------GGG 61

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + ++  G+VFEK  V +STV+G  S +F+D+I G      FWA G+S++ H  NPHVPA
Sbjct: 62  GVMSIMHGRVFEKVGVNISTVHGVFSDEFRDKIPGAETTGDFWAAGISLVAHMRNPHVPA 121

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIF---FHNTLKEMCSQHAVANYTH 190
            H N R I T   WFGGG DLTP L        PD I    FH  ++  C  H    Y  
Sbjct: 122 AHMNTRFITTSKSWFGGGGDLTPLL--------PDEINAAKFHLAMQSACDAHDPDYYPK 173

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK+WCD YFYLPHR E RG GGIF+D+L S    G  DADF+F   VG  F   Y ++V 
Sbjct: 174 YKKWCDDYFYLPHRDEPRGAGGIFYDNLDS----GNWDADFAFTRDVGIAFKDGYSAIVE 229

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            + +  +S+ +R EQL+RRGRY EFNLLYD+GT FG KTGGN+E+IL SMPP V WP
Sbjct: 230 ASMNQPWSDAERHEQLVRRGRYVEFNLLYDRGTLFGLKTGGNIEAILMSMPPQVRWP 286


>gi|71082810|ref|YP_265529.1| coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762767|ref|ZP_01264732.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|71061923|gb|AAZ20926.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91718569|gb|EAS85219.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 275

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 183/294 (62%), Gaps = 21/294 (7%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D E +K+++   F+ LQ+ IC + EKLE +  +         F  K W  ++S+ +D GG
Sbjct: 2   DKEIKKKLASNWFKLLQNTICNDIEKLEGKKSK---------FKSKTW--NRSEIKDEGG 50

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G    L  GK+FEK  V  S V+G  S     +I G +KNP FWA+G+S+++H  NPHVP
Sbjct: 51  GEFRILKNGKIFEKVGVNFSEVHGKFSKKMSKKIPGASKNPNFWASGISIVMHMKNPHVP 110

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG+D+TP ++  +        F H  LK+MC +H    Y  YK
Sbjct: 111 AIHFNTRFIYTTHGWFGGGMDVTPCIQDLKEKS-----FLHTELKKMCDRHDKKFYKKYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR+E+RGIGGIFFD+     E      DF F++ +G  F  L+ S+++  
Sbjct: 166 KWCDEYFYLPHRKETRGIGGIFFDYKKKDWE-----KDFKFVTDLGVTFQMLFNSIIQLK 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   ++ + ++ Q I+RGRYAEFNLLYD+GT FG +TGGNVE+IL S+PP+  W
Sbjct: 221 HKKKWTVKQKEIQYIKRGRYAEFNLLYDRGTKFGLQTGGNVEAILMSLPPIAKW 274


>gi|254455306|ref|ZP_05068735.1| coproporphyrinogen III oxidase, aerobic [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082308|gb|EDZ59734.1| coproporphyrinogen III oxidase, aerobic [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 275

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/294 (45%), Positives = 183/294 (62%), Gaps = 21/294 (7%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D E +K ++   F+ LQ+ IC +  KLEN    N  N     F    W R KS+ E  GG
Sbjct: 2   DNEIKKDLASNWFKLLQNAICDDIIKLEN----NKIN-----FQSTTWKRSKSKNE--GG 50

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G    L  GK+FEK  V  S V G     F+  ILG +K+P FWA+G+S+++H  NPH+P
Sbjct: 51  GEYRILKDGKIFEKVGVNFSKVNGKFPKKFQKNILGASKDPRFWASGISIVMHMQNPHIP 110

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG+D+TP+++  +         FH TLK MC +H+   Y  YK
Sbjct: 111 AMHFNTRYICTTQNWFGGGMDVTPAIKDNQEKSK-----FHKTLKTMCDRHSKKYYKKYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR+E+RGIGGIFFD+  +  E      DF F+  VG  F  L+ S++++ 
Sbjct: 166 KWCDEYFYLPHRKEARGIGGIFFDYKKNDFE-----NDFKFVRDVGVTFQMLFNSIIKKK 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               ++ +D++ Q ++RGRYAEFNLLYD+GT FG +TGGNVE IL S+PP+V W
Sbjct: 221 IKKKWTFKDKEMQYVKRGRYAEFNLLYDRGTKFGLQTGGNVEGILMSLPPIVKW 274


>gi|163795182|ref|ZP_02189150.1| coproporphyrinogen III oxidase [alpha proteobacterium BAL199]
 gi|159179580|gb|EDP64109.1| coproporphyrinogen III oxidase [alpha proteobacterium BAL199]
          Length = 293

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 173/288 (60%), Gaps = 17/288 (5%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLGGGRMATLC 79
           +Q  F +L+  IC  FE LE+       ++ P   FT K W RD       GGG   +L 
Sbjct: 22  AQAWFASLRDQICAAFEALEDAYDGPLRDQHPAGRFTRKTWDRDG------GGGGTMSLM 75

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G+VFEK  V +STV+G+ S +F+  I G  ++P F+A+G+S++ H  +P VPAVH N R
Sbjct: 76  HGRVFEKVGVNISTVHGEFSEEFRASIPGAAEDPRFFASGISLVAHLRSPRVPAVHMNTR 135

Query: 140 MIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
            I T   WFGGG DLTP +       D D   FH   +  C  H  A Y  +K WCD YF
Sbjct: 136 HIATTKSWFGGGADLTPMVPD-----DTDTRDFHAAFQAACDAHDPAYYPRFKAWCDEYF 190

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           +L HR E RG+GGIF+D++      G    D +F   VG  F+ +YPSLV R+    +++
Sbjct: 191 FLKHRNEPRGVGGIFYDYVD-----GDFATDLAFTRDVGLAFLDVYPSLVERHMSEPWTD 245

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            +RQ QL+RRGRY EFNLLYD+GT FG KTGGNVE+IL S+PP VAWP
Sbjct: 246 AERQHQLVRRGRYVEFNLLYDRGTLFGLKTGGNVEAILMSLPPEVAWP 293


>gi|296283258|ref|ZP_06861256.1| coproporphyrinogen III oxidase [Citromicrobium bathyomarinum JL354]
          Length = 284

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 174/294 (59%), Gaps = 13/294 (4%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D   + + ++  FE+L+  IC EFE +E EA  ++       F    W R++   +  GG
Sbjct: 3   DWSAQTQQARTWFESLRDQICAEFEAIEREAGSDA------TFQYTPWEREEEGNDSPGG 56

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G +  L  GKVFEK  V VSTV+G  +P+F   I G   +P F ATG+S++ H  NPHVP
Sbjct: 57  G-VQGLMKGKVFEKVGVNVSTVHGTFAPEFAKTINGAEDDPSFSATGISLVAHMANPHVP 115

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R +VTG  WFGGG DL P +      Y+ D   FH   +  C++H    Y  + 
Sbjct: 116 AVHMNTRFLVTGKAWFGGGADLNPPI-----PYEEDAQEFHAAFRAACAKHNPTYYERFS 170

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +W D YFY+PHR   RG+GGIF+DHL    E  G   +  F   VG  F++++P LVRR 
Sbjct: 171 KWADDYFYIPHRGVHRGVGGIFYDHLECDDE-SGFARNLDFTQDVGRAFLEIFPKLVRRR 229

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               ++E D++ QL  RGRYAEFNL+YD+GT FG KTGGNV++IL S+PP   W
Sbjct: 230 MESEWTEADKRTQLEWRGRYAEFNLVYDRGTLFGLKTGGNVDAILMSLPPEAVW 283


>gi|114798887|ref|YP_759079.1| coproporphyrinogen III oxidase [Hyphomonas neptunium ATCC 15444]
 gi|114739061|gb|ABI77186.1| coproporphyrinogen III oxidase, aerobic [Hyphomonas neptunium ATCC
           15444]
          Length = 297

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 171/292 (58%), Gaps = 7/292 (2%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           RK  +   F  LQ  I   FE +E+ A           F +K W R    ++  G     
Sbjct: 12  RKAQASAWFRALQEEIIGRFEAIEDAAVPPLYRGEAGRFDLKAWRRGDGSEDLGG--GRM 69

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-YFWATGLSVIVHPYNPHVPAVH 135
            L  GKVFEK  V  S V+G  S  F  QI G  K+   FWA+G+S+I HP NP VPA H
Sbjct: 70  GLMRGKVFEKVGVHFSEVHGTFSEAFAAQIPGADKSGGRFWASGISLIAHPLNPRVPAAH 129

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
            N RM+VT   WFGGG DLTP L  +R     D + FH  +K  C  H  A+Y H KE C
Sbjct: 130 MNTRMLVTSEAWFGGGGDLTPLLAYQRDQDFVDTVDFHAAMKAACDTHPGADYAHMKEHC 189

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           + YF+LPHR E RG GGIF+D  ++    G  +ADF+F   VG  F  +YP LVRR    
Sbjct: 190 ETYFHLPHRSEPRGTGGIFYDRFNT----GDWEADFAFTQEVGRKFADIYPGLVRRRMIE 245

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            +SE +R+ QLI+RGRY E+NLLYD+GT FG KTGGN+ESIL+SMPP+V WP
Sbjct: 246 PWSEAEREAQLIQRGRYVEYNLLYDRGTTFGLKTGGNIESILSSMPPVVKWP 297


>gi|85374711|ref|YP_458773.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
 gi|84787794|gb|ABC63976.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
          Length = 285

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 173/283 (61%), Gaps = 14/283 (4%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           FE+L+  IC EFE +E EA  ++A      F    W R+++  +D GGG +  L  GKVF
Sbjct: 15  FESLRDQICAEFEAIEREAGSDAA------FQYTPWDREEAGNDDPGGG-VQGLMKGKVF 67

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTT-KNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           EK  V VSTV G  +P+F   I G + ++P F ATG+S++ H  NPHVPAVH N R + T
Sbjct: 68  EKVGVNVSTVRGSFAPEFAATINGASVEHPGFTATGISLVAHMANPHVPAVHMNTRFLTT 127

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            A WFGGG DL P +      Y+ D   FH   +  C+ H    Y  +++W D YF++PH
Sbjct: 128 QAAWFGGGADLNPPI-----PYEQDTAEFHARFRAACAAHNPTYYERFRKWADDYFFIPH 182

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R   RG+GGIF+DHL    +    + +F+F   VG  F+ ++P LVRR     F+ +D+Q
Sbjct: 183 RGVHRGVGGIFYDHLECD-DAAAFERNFAFTQDVGKAFLDIFPQLVRRRMESDFTPEDKQ 241

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 242 TQLEWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEAVW 284


>gi|85710708|ref|ZP_01041772.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
 gi|85687886|gb|EAQ27891.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
          Length = 285

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 172/283 (60%), Gaps = 14/283 (4%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           FE+L+  IC  FE +E EA  +++      F    W R++   +D GGG +  L  GKVF
Sbjct: 15  FESLRDQICAAFESIEREAGSDAS------FQYTPWNREEEGNDDPGGG-VQGLMKGKVF 67

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTT-KNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           EK  V VSTV G  S  F +Q+ G + ++P F ATG+S++ H +NPHVPAVH N R + T
Sbjct: 68  EKVGVNVSTVRGRFSEQFANQVNGASVEHPEFTATGISLVAHMHNPHVPAVHMNTRFLTT 127

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            A WFGGG DL P +      Y+ D   FH +++  C  H    Y  YK+W D YFY+PH
Sbjct: 128 QAAWFGGGADLNPPI-----PYEEDTEEFHASMRAACMAHNPTYYERYKKWADDYFYIPH 182

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R+  RG+GGIF+DHL    +    D +F+F   VG  F+ +YP LVR+     F + D  
Sbjct: 183 REVHRGVGGIFYDHLECEDDQS-FDRNFAFTQDVGKAFLDIYPKLVRKRMESDFDDADVA 241

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 242 QQLEYRGRYAEFNLVYDRGTIFGLKTGGNIDAILMSLPPRATW 284


>gi|209966675|ref|YP_002299590.1| coproporphyrinogen III oxidase [Rhodospirillum centenum SW]
 gi|209960141|gb|ACJ00778.1| coproporphyrinogen III oxidase, aerobic [Rhodospirillum centenum
           SW]
          Length = 309

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 181/299 (60%), Gaps = 9/299 (3%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLR---DKSQK 67
           D + +RK  ++  F+ L+  IC  FE LE++ A    A   P  F    W R        
Sbjct: 15  DVLADRKARAEAWFQGLRDRICAAFEALEDDLADGPHAGLPPGRFERTAWDRPGHGDGPH 74

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG + ++  G+VFEK  V VSTV+G  S +F+  I G  ++  FWA+G+S++ H  
Sbjct: 75  AAPGGGGVMSVMRGRVFEKVGVNVSTVFGTFSEEFRGSIPGAAESGGFWASGISLVAHMR 134

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           +P VPAVH N R +VT   WFGGG DLTP     R + + D   FH  LK  C  H    
Sbjct: 135 SPLVPAVHMNTRHLVTSHAWFGGGADLTPMFLDTRETAE-DKADFHAALKAACDAHGPDF 193

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  + +WCDRYF+LPHR E RG+GGIF+D      + G  +ADF+F  AVG+ F+++YP 
Sbjct: 194 YARFSDWCDRYFFLPHRNEPRGVGGIFYD----GHDTGDWEADFAFTRAVGEAFLEVYPR 249

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           LVRR  H  ++E  R+ QL RRGRYAEFNL++D+GT FG KTGGN+++I+ S+PP V W
Sbjct: 250 LVRRRMHLPWTEAQREHQLHRRGRYAEFNLIHDRGTLFGLKTGGNIDAIMMSLPPEVKW 308


>gi|88607423|ref|YP_505026.1| coproporphyrinogen III oxidase [Anaplasma phagocytophilum HZ]
 gi|88598486|gb|ABD43956.1| coproporphyrinogen III oxidase, aerobic [Anaplasma phagocytophilum
           HZ]
          Length = 274

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 179/294 (60%), Gaps = 22/294 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++E+K +    F  L+  I + F  +E +  +N+    P I   + W R+          
Sbjct: 1   MDEKKDLVTEWFAVLRDKIVSAFLAVEADFSDNA----PTI-KKRKWEREGGGGG----- 50

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNPHVP 132
             + +  G VFEKA V  S V+G L  DF  +I G  + N  FWA+G+S++ H  +P VP
Sbjct: 51  -ESVIILGSVFEKAGVNFSIVHGKLKSDFAAEIPGARESNGEFWASGVSIVAHMCSPFVP 109

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+H N R I T   WFGGGIDLTP   +     D D IFFH+ LK MC++     Y  +K
Sbjct: 110 AIHMNTRFICTSKSWFGGGIDLTPVYHN-----DDDTIFFHDALKAMCNKFDAHYYDQFK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYLPHR+E RG+GGIF+D+L +     G + DF+F  AVG+CF+++YP++VRRN
Sbjct: 165 KNCDEYFYLPHRKEPRGVGGIFYDYLQT-----GFEKDFAFTRAVGECFLEVYPAIVRRN 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  +SE++R  QLI RGRY EFNLLYD+GT FG  T GN ++I+ SMPPL  W
Sbjct: 220 MHKEWSEEERDYQLISRGRYVEFNLLYDRGTRFGLMTDGNSDAIMMSMPPLAKW 273


>gi|260752591|ref|YP_003225484.1| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551954|gb|ACV74900.1| Coproporphyrinogen oxidase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 285

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 175/293 (59%), Gaps = 16/293 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+++++   F  L+  IC +FE++E +A       SP  F V  W ++        G 
Sbjct: 8   LNEQQQVTSDWFHQLRDRICQQFEEIERQA------ASPASFQVTPWQKNTEGYGIQTGH 61

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + +L  G++FEK  V +STV G  SPDF  +I GT  +P+F+ATG+S++ H  NPHVP 
Sbjct: 62  GIRSLMKGQIFEKVGVNISTVKGCFSPDFAKKIPGTEDDPHFFATGISLVAHMANPHVPN 121

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +H N R + T   WFGGGIDL PS       Y  D   FH  LK +C +H    Y+ + E
Sbjct: 122 IHMNCRFLQTTKSWFGGGIDLNPST-----PYAEDTAEFHQNLKTICDKHHPDYYSRFSE 176

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W DRYF +PHRQ  RG+GGIF+D+L S+       ADF+F   VG  F+ ++P LV R  
Sbjct: 177 WADRYFDIPHRQTKRGVGGIFYDYLDSN-----FAADFAFTKDVGKAFLDIFPKLVARRQ 231

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   +++D Q   + RGRY EFNLLYD+GT FG KTGG+ +++L S+PP+  W
Sbjct: 232 NRAANQEDFQRLAVYRGRYTEFNLLYDRGTLFGLKTGGDADAVLMSLPPMAIW 284


>gi|283856371|ref|YP_162686.2| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|283775370|gb|AAV89575.2| Coproporphyrinogen oxidase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 285

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 175/293 (59%), Gaps = 16/293 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+++++   F  L+  IC +FE++E +A       SP  F V  W ++        G 
Sbjct: 8   LNEQQQVTSDWFHQLRDRICQQFEEIERQA------ASPASFQVTPWQKNTEGYGIQTGR 61

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + +L  G++FEK  V +STV G  SPDF  +I GT  +P+F+ATG+S++ H  NPHVP 
Sbjct: 62  GIRSLMKGQIFEKVGVNISTVKGCFSPDFAKKIPGTEDDPHFFATGISLVAHMANPHVPN 121

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +H N R + T   WFGGGIDL PS       Y  D   FH  LK +C +H    Y+ + E
Sbjct: 122 IHMNCRFLQTTKSWFGGGIDLNPST-----PYAEDTAEFHQNLKTICDKHHPDYYSRFSE 176

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W DRYF +PHRQ  RG+GGIF+D+L S+       ADF+F   VG  F+ ++P LV R  
Sbjct: 177 WADRYFDIPHRQTKRGVGGIFYDYLDSN-----FAADFAFTKDVGKAFLDIFPKLVARRQ 231

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   +++D Q   + RGRY EFNLLYD+GT FG KTGG+ +++L S+PP+  W
Sbjct: 232 NRAANQEDFQRLAVYRGRYTEFNLLYDRGTLFGLKTGGDADAVLMSLPPMAIW 284


>gi|241761831|ref|ZP_04759917.1| Coproporphyrinogen oxidase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373745|gb|EER63305.1| Coproporphyrinogen oxidase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 285

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 175/293 (59%), Gaps = 16/293 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+++++   F  L+  IC +FE +E +A       SP  F V  W ++        G 
Sbjct: 8   LNEQQQVTSDWFHQLRDRICQQFEGIERQA------ASPASFQVTPWQKNTEGYGIQTGR 61

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + +L  G++FEK  V +STV G  SPDF  +I GT  +P+F+ATG+S++ H  NPHVP 
Sbjct: 62  GIRSLMKGQIFEKVGVNISTVKGCFSPDFAKKIPGTEDDPHFFATGISLVAHMANPHVPN 121

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +H N R + T   WFGGGIDL PS       Y  D   FH +LK +C +H    Y+ + E
Sbjct: 122 IHMNCRFLQTTKSWFGGGIDLNPST-----PYAEDTAEFHQSLKTICDKHHPDYYSRFSE 176

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W DRYF +PHRQ  RG+GGIF+D+L S+       ADF+F   VG  F+ ++P LV R  
Sbjct: 177 WADRYFDIPHRQTKRGVGGIFYDYLDSN-----FTADFAFTKDVGKAFLDIFPKLVARRQ 231

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   +++D Q   + RGRY EFNLLYD+GT FG KTGG+ +++L S+PP+  W
Sbjct: 232 NRAANQEDFQRLAVYRGRYTEFNLLYDRGTLFGLKTGGDADAVLMSLPPMAIW 284


>gi|330813687|ref|YP_004357926.1| coproporphyrinogen III oxidase, aerobic [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486782|gb|AEA81187.1| coproporphyrinogen III oxidase, aerobic [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 279

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 191/295 (64%), Gaps = 17/295 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           + I  RK+ + + F +L+++IC +FE  EN    N++ +  K FT   W + K++ E  G
Sbjct: 2   NSIHLRKKNTSKWFRDLRNLICKDFEYFEN----NNSKKKVK-FTRSKWNKSKTKSE--G 54

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG ++ L  GK+FEK  V +S V G    +FK++I GT K+  FWA+G+SV+ H  NP +
Sbjct: 55  GGEISILRNGKIFEKVGVNISAVNGRFDKNFKNRIPGTKKSSKFWASGISVVAHFQNPKI 114

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           P++HFN R I+T   WFGGG+D+TP ++      D    +FH  LK+MCS H    Y  +
Sbjct: 115 PSLHFNTRYIITSKEWFGGGMDVTPCIKD-----DKQKKYFHQELKKMCSNHNKNYYKLH 169

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K  CD+YF+LPHR E RG GGIF+D+L+S  E      DF +   VG+ F+K+  +++++
Sbjct: 170 KLNCDKYFFLPHRNEPRGDGGIFYDYLNSDWE-----KDFLYTKDVGEVFLKIAKNIIKK 224

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                ++++DR++QL++R RYAEFNLL+D+GT FG  TGGN+E+I  S+PPL +W
Sbjct: 225 KMKQKWTKKDRKKQLVKRARYAEFNLLHDRGTKFGLSTGGNIEAIFMSLPPLASW 279


>gi|316935314|ref|YP_004110296.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris DX-1]
 gi|315603028|gb|ADU45563.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris DX-1]
          Length = 304

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 169/293 (57%), Gaps = 8/293 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E R+  ++  FE L+  IC E E LE EA        P  FT K W R    K   GGG
Sbjct: 19  VEARRAQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPWQR----KTGAGGG 74

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               L  G++FEK  +  S+  G L+P+    + G   +  + +T +S+I+HP +P VP 
Sbjct: 75  VGGFLSNGRLFEKIGIHTSSANGRLTPEMAKNLPGDGVSLDYVSTSISLIMHPRSPRVPT 134

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H    Y  +K 
Sbjct: 135 VHMNTRFLSTSKGWFGGGADLTPMLPEQRSQDAEDAVIFHAAMKAACDAHDPNYYAKFKP 194

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W D YF+LPHR  +RG+GGIF+DHL S    G  D DF+F   VG   + +YP +VR+  
Sbjct: 195 WADTYFFLPHRGTARGVGGIFYDHLDS----GDFDRDFAFTRDVGSALLDIYPKIVRKRM 250

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++EQ+R +QL  RG Y EFNLLYDKGT FG +TGGN E+I++SMPPLV+W
Sbjct: 251 VEPWTEQERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNTETIMSSMPPLVSW 303


>gi|157829204|ref|YP_001495446.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933930|ref|YP_001650719.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. Iowa]
 gi|166217814|sp|A8GU63|HEM6_RICRS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|189028103|sp|B0BVQ3|HEM6_RICRO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157801685|gb|ABV76938.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165909017|gb|ABY73313.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. Iowa]
          Length = 279

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 178/291 (61%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 4   ENKEITSSWFTNLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRSSWQRNG------GGGGV 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP    +      + + FH   KE+C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEVCDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L++    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNN----GNFEQDFAFTQDVGKTLLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|15893292|ref|NP_361006.1| coproporphyrinogen III oxidase [Rickettsia conorii str. Malish 7]
 gi|34581044|ref|ZP_00142524.1| coproporphyrinogen III oxidase precursor [Rickettsia sibirica 246]
 gi|21362588|sp|Q92FV8|HEM6_RICCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15620514|gb|AAL03907.1| coproporphyrinogen III oxidase precursor [Rickettsia conorii str.
           Malish 7]
 gi|28262429|gb|EAA25933.1| coproporphyrinogen III oxidase precursor [Rickettsia sibirica 246]
          Length = 279

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 177/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 4   ENKEITSSWFTNLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRSSWQRNG------GGGGV 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L++    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNN----GNFEQDFAFTQDVGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|238651129|ref|YP_002916987.1| coproporphyrinogen III oxidase [Rickettsia peacockii str. Rustic]
 gi|259709758|sp|C4K2Y8|HEM6_RICPU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|238625227|gb|ACR47933.1| coproporphyrinogen III oxidase [Rickettsia peacockii str. Rustic]
          Length = 279

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 177/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 4   ENKEITSSWFTNLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRSSWQRNG------GGGGV 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGVELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L++    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNN----GNFEQDFAFTQDVGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|94495459|ref|ZP_01302039.1| Coproporphyrinogen oxidase [Sphingomonas sp. SKA58]
 gi|94424847|gb|EAT09868.1| Coproporphyrinogen oxidase [Sphingomonas sp. SKA58]
          Length = 294

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 181/298 (60%), Gaps = 13/298 (4%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD-KSQKE 68
            P  +++R++ ++  FE+L+  IC EFE +E EA  ++A      F    W R+ + Q  
Sbjct: 8   VPFALDDRQQAARGWFESLRDRICAEFESIEREADSDAA------FAFMPWDREAEGQAA 61

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
             GGG +  +  GKVFEK  V VSTV G+ +P F   I G  +NP F+ATG+S++ H  N
Sbjct: 62  GDGGGGVRGVMKGKVFEKVGVNVSTVGGEFAPGFAQTIHGADENPAFFATGISLVAHMAN 121

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N R +VT   WFGGG DL P L         D   FH  LK+ C  H   +Y
Sbjct: 122 PHVPAVHMNTRYLVTTKSWFGGGADLNPPLPREE-----DTAHFHAVLKDACDAHDPDHY 176

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K W D YF++PHR   RG+GGIF+DHL    +    DA+F+F  AVGD F+  +P +
Sbjct: 177 PRFKAWADDYFFIPHRGVHRGVGGIFYDHLECVDD-AAFDANFAFTRAVGDAFLAAFPPI 235

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           VRR     +S+ D +  L  RGRYAEFNL++D+GT FG KTGGN+++IL S+PP+ +W
Sbjct: 236 VRRRMGEPWSDADYRTMLEWRGRYAEFNLVHDRGTLFGLKTGGNIDAILMSLPPMASW 293


>gi|91978227|ref|YP_570886.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB5]
 gi|91684683|gb|ABE40985.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisB5]
          Length = 310

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 175/301 (58%), Gaps = 8/301 (2%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS 65
           ++      +E ++  ++  FE+L+  IC E E LE EA       +P  FT K W R   
Sbjct: 17  LDTATTSRVEHQRAQARTWFESLRDRICAEVEALEREAPAELFPGTPATFTYKPWQR--- 73

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
            K   GGG    L  G++FEK  +  S+  G L+P+    + G  ++  + +T +S+I+H
Sbjct: 74  -KTGAGGGVGGFLSNGRLFEKIGIHTSSANGRLTPEMAKTLPGDGQSLDYVSTSISLIMH 132

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H  
Sbjct: 133 PRSPRVPTVHMNTRFLSTAQGWFGGGADLTPMLPEQRSQDAEDAVTFHAAMKRACDAHDP 192

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  +K W D YF+LPHR  +RG+GGIF+DHL+S    G  D DF+F   VG   + +Y
Sbjct: 193 GYYGKFKPWADTYFFLPHRGTARGVGGIFYDHLNS----GDFDRDFAFTRDVGLALLAVY 248

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P +VR+     ++E++R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SMPPLV+
Sbjct: 249 PKIVRQRMQESWTEEERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSMPPLVS 308

Query: 306 W 306
           W
Sbjct: 309 W 309


>gi|192290099|ref|YP_001990704.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris TIE-1]
 gi|192283848|gb|ACF00229.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris TIE-1]
          Length = 303

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 171/293 (58%), Gaps = 9/293 (3%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E R+  ++  FE L+  IC E E LE EA        P  FT K W R    K   GGG
Sbjct: 19  VEARRTQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPWQR----KTGAGGG 74

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               L  G++FEK  +  S+  G L+P+    + G     Y  +T +S+I+HP +P VP 
Sbjct: 75  VGGFLSNGRLFEKIGIHTSSANGKLTPEMAKNVPGDGSLDYV-STSISLIMHPRSPRVPT 133

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H  A Y  +K 
Sbjct: 134 VHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDALIFHTAMKHACDAHDPAYYDKFKP 193

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W D YF+LPHR  +RG+GGIFFD+L+S    G  D DF+F  AVG   + +YP +VR+  
Sbjct: 194 WADTYFFLPHRGVARGVGGIFFDYLNS----GDFDRDFAFTRAVGSALLDVYPKIVRKRM 249

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              +++++R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SMPPLV+W
Sbjct: 250 IEPWTDEERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSMPPLVSW 302


>gi|39934586|ref|NP_946862.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris CGA009]
 gi|39648435|emb|CAE26956.1| putative coproporphyrinogen III oxidase precursor [Rhodopseudomonas
           palustris CGA009]
          Length = 303

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 170/293 (58%), Gaps = 9/293 (3%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E R+  ++  FE L+  IC E E LE EA        P  FT K W R    K   GGG
Sbjct: 19  VEARRTQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPWQR----KTGAGGG 74

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               L  G++FEK  +  S+  G L+P+    + G     Y  +T +S+I+HP +P VP 
Sbjct: 75  VGGFLSNGRLFEKIGIHTSSANGKLTPEMAKNVPGDGSLDYV-STSISLIMHPRSPRVPT 133

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H  A Y  +K 
Sbjct: 134 VHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDAVIFHTAMKHACDAHDPAYYDKFKP 193

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           W D YF+LPHR  +RG+GGIFFD+L+S    G  D DF+F  AVG   + +YP +VR+  
Sbjct: 194 WADTYFFLPHRGVARGVGGIFFDYLNS----GDFDRDFAFTRAVGSALLDVYPKIVRKRM 249

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              +++ +R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SMPPLV+W
Sbjct: 250 IEPWTDAERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSMPPLVSW 302


>gi|86751117|ref|YP_487613.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris HaA2]
 gi|86574145|gb|ABD08702.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris HaA2]
          Length = 303

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 172/295 (58%), Gaps = 8/295 (2%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D +E R+  ++  FE L+  IC E E LE EA        P  F+ K W R    K   G
Sbjct: 16  DPVEARRTQARAWFEGLRDRICAEIETLEREAPAALFPGEPATFSYKPWQR----KTGAG 71

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG    L  G++FEK  +  S+  G L+P+    + G      + +T +S+I+HP +P V
Sbjct: 72  GGVGGFLSGGRLFEKIGIHTSSANGTLTPEMAKNLPGDGVTRDYVSTSISLIMHPRSPRV 131

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           P VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H  A Y  +
Sbjct: 132 PTVHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDAVMFHAAMKAACDAHDPAYYAKF 191

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K W D YF+LPHR  +RG+GGIF+DHL+S    G  + DF+F   VG   +++YP +VR+
Sbjct: 192 KPWADTYFFLPHRGTARGVGGIFYDHLNS----GDFERDFAFTRDVGAALLEIYPRIVRK 247

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                ++EQ+R +QL  RG Y EFNLLYDKGT FG +TGGN E+I++SMPPLV+W
Sbjct: 248 RMVEPWTEQERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNTETIMSSMPPLVSW 302


>gi|157804279|ref|YP_001492828.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
 gi|157785542|gb|ABV74043.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
          Length = 277

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 179/291 (61%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E ++I+   F +L+ ++C EFEK+E E +    +  P  F   +W R+       GGG +
Sbjct: 2   ENRKITSNWFTDLRDLLCAEFEKIEEE-YTKEKDIEPAKFVRSNWERNG------GGGGV 54

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+SV+ H  +P +PA+H
Sbjct: 55  MSLMKGEVFEKVGVNISTVFGEFSPEFRTEIPGGELDGKFFATGISVVAHLKSPLIPAMH 114

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP      +  + +   FH   K+ C ++  + Y  +K+ C
Sbjct: 115 FNTRYIETSKSWFGGGGDLTPY-----YPEENETTKFHAAFKKACDKYDFSYYPKFKKQC 169

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           + YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR     
Sbjct: 170 NEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTKDVGKALLSVYPKIVRNKLFL 225

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 226 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTYGNVEAILMSLPPEVKW 276


>gi|296536751|ref|ZP_06898807.1| coproporphyrinogen III oxidase [Roseomonas cervicalis ATCC 49957]
 gi|296262918|gb|EFH09487.1| coproporphyrinogen III oxidase [Roseomonas cervicalis ATCC 49957]
          Length = 303

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 168/285 (58%), Gaps = 9/285 (3%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           FE+L+  +C EFE +E+          P   F    W R            + ++  G+V
Sbjct: 26  FESLRDRLCAEFEAIEDALQGGPHGALPAGRFARTAWERPGGGGG------VMSVMRGRV 79

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           FEK  V VSTV+G+ SP+F+ QI G  ++P F ATG+S++ H  +P VPA H N R IVT
Sbjct: 80  FEKVGVNVSTVWGEFSPEFRKQIPGAEEDPRFLATGVSLVAHMRSPRVPAAHMNTRFIVT 139

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
              WFGGG DLTP       S   D   FH   +  C +H  A Y  +K WCD YF+LPH
Sbjct: 140 RRAWFGGGGDLTPMTMDSPESLA-DGAAFHAAFQAACERHDPAYYPRFKAWCDEYFFLPH 198

Query: 204 RQESRGIGGIFFDHL-HSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDR 262
           R E RG+GGIF+D L    PE   +D  F+F   VG+ F+  YP+++RR     ++E +R
Sbjct: 199 RNEPRGLGGIFYDWLGRDEPEGERLDGHFAFTRDVGEAFLAAYPAIIRRRMGESWTEAER 258

Query: 263 QEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           + QL+RRGRY EFNLL+D+GT FG KTGGN E+IL SMPP V WP
Sbjct: 259 EHQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSMPPEVRWP 303


>gi|67459788|ref|YP_247412.1| coproporphyrinogen III oxidase [Rickettsia felis URRWXCal2]
 gi|75535824|sp|Q4UJP2|HEM6_RICFE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|67005321|gb|AAY62247.1| Coproporphyrinogen III oxidase precursor [Rickettsia felis
           URRWXCal2]
          Length = 279

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 177/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F +L+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 4   ENKEIASNWFTDLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRTSWQRNG------GGGGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP      +  + +   FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPF-----YPKENETAKFHAAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTQDVGRALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|157965037|ref|YP_001499861.1| coproporphyrinogen III oxidase [Rickettsia massiliae MTU5]
 gi|157844813|gb|ABV85314.1| Coproporphyrinogen III oxidase precursor [Rickettsia massiliae
           MTU5]
          Length = 281

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 177/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 6   ENKEITSSWFTNLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRSSWQRNG------GGGGV 58

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 59  MSLMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMH 118

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP      +  + + + FH   KE C ++  + Y  +K+ C
Sbjct: 119 FNTRYIETSKSWFGGGGDLTPF-----YPEENETVKFHAVFKEACDKYDSSYYPKFKKQC 173

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L++       + DF+F   VG   + +YP +VR     
Sbjct: 174 DEYFYLKHRKEPRGVGGIFYDYLNND----NFEQDFAFTQDVGKALLSVYPEIVRSKLFL 229

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 230 PWTTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 280


>gi|196019265|ref|XP_002118953.1| hypothetical protein TRIADDRAFT_34987 [Trichoplax adhaerens]
 gi|190577575|gb|EDV18562.1| hypothetical protein TRIADDRAFT_34987 [Trichoplax adhaerens]
          Length = 276

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 173/296 (58%), Gaps = 22/296 (7%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D    +KR++   F+ L+  IC EFEK+ENE   + +      F  K W RD       G
Sbjct: 2   DKFSNKKRLASNWFKKLRDNICDEFEKIENEFGSSVS------FKRKKWDRDG------G 49

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNPH 130
           GG   ++  G +FEK  V +STVYG  S  F  +I G    N  FWA+G+S++ H  +PH
Sbjct: 50  GGGEMSIMRGSIFEKVGVNISTVYGKFSDKFAKEIPGCENGNNNFWASGISLVAHMNSPH 109

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           +PAVHFN RMIVT   WFGGG DLTP   +     + D   FH   K  C +     Y  
Sbjct: 110 IPAVHFNTRMIVTTKQWFGGGGDLTPVFPN-----NADTELFHKHFKIACDKFDKNYYPR 164

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K+ CD YFYLPHR+E RG+GG+F+D+L+S    G  + DF F   +G  F K + S+++
Sbjct: 165 FKKNCDEYFYLPHRKEPRGVGGVFYDYLNS----GNWEKDFEFTKEIGVQFKKAFFSIIK 220

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RN    +++ ++  QL +RGRY EFNLLYD+GT FG  T GN E+IL SMPP+  W
Sbjct: 221 RNIMKKWTKVEKSIQLQKRGRYVEFNLLYDRGTKFGLMTNGNTEAILMSMPPMATW 276


>gi|88608200|ref|YP_506339.1| coproporphyrinogen III oxidase [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600369|gb|ABD45837.1| coproporphyrinogen III oxidase, aerobic [Neorickettsia sennetsu
           str. Miyayama]
          Length = 306

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 131/294 (44%), Positives = 175/294 (59%), Gaps = 20/294 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K  +   F  L+  I  EF  +E E   N   RS   F V+ W R+     ++   
Sbjct: 29  LSEKKETAAAWFRELRDCIRDEFVAIEKEFDHNF--RSG--FAVESWEREGGGGGEM--- 81

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-YFWATGLSVIVHPYNPHVP 132
              +L  G VFEK  V +STV+G  S DF  +I G  ++   FWA+G+S++ H  +P VP
Sbjct: 82  ---SLMYGTVFEKIGVNISTVHGVFSEDFASKIPGALESGGNFWASGISLVAHMSSPLVP 138

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N RMIVT  YWFGGG DLTP   +     + D   FH   KE C +H    Y  + 
Sbjct: 139 AVHMNTRMIVTDKYWFGGGADLTPMYYN-----EEDAKTFHAEFKETCDRHDSKYYNEFS 193

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +W D YFY+ HR E RGIGGIF+D+L +       + DF+F   VG CF+ +YP +VRRN
Sbjct: 194 KWADEYFYVKHRNEPRGIGGIFYDYLRTDD----WEKDFAFTKDVGKCFLSVYPKIVRRN 249

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  ++ + RQ QL++RGRY EFNLLYD+GT FG KTGGNV++IL S+PP+V W
Sbjct: 250 MHLSYTNEQRQFQLLKRGRYVEFNLLYDRGTEFGLKTGGNVKAILMSLPPVVEW 303


>gi|115523338|ref|YP_780249.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisA53]
 gi|115517285|gb|ABJ05269.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisA53]
          Length = 300

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 174/306 (56%), Gaps = 12/306 (3%)

Query: 5   TIEIGCP----DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           TI+   P      +E+++  ++  FE L+  IC E E+LE EA  N    +P  FT K W
Sbjct: 2   TIDTDAPPQLGTQVEQQRAQARAWFEGLRDRICAEIEQLEREAPANLYPGAPATFTYKPW 61

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R   Q   +       L  G++FEK  +  S+  G LSP+    + G  K   + +T +
Sbjct: 62  QRQTGQGGGV----GGFLSGGRLFEKIGIHTSSANGRLSPEMAKTLPGDGKQLDYVSTSI 117

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I+HP +P VP  H N R + T   WFGGG DLTP L   R     D + FH  +K  C
Sbjct: 118 SLIMHPRSPRVPTTHMNTRFLCTSQGWFGGGSDLTPMLPEHRSQDAEDAVIFHAAMKRAC 177

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H    Y  +K W D YFYLPHRQ +RG+GGIF+DHL++    G  + DF+F   VG  
Sbjct: 178 DAHDPGYYAKFKPWADDYFYLPHRQAARGVGGIFYDHLNT----GSFERDFAFTRDVGLA 233

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            + +YP +VR+     ++E +R +QL  R  Y EFNLLYD+GT FG +TGGNVE+I++SM
Sbjct: 234 LLDVYPRIVRKRMVEPWTEAERAQQLACRALYVEFNLLYDRGTMFGLQTGGNVETIMSSM 293

Query: 301 PPLVAW 306
           PPLV+W
Sbjct: 294 PPLVSW 299


>gi|157826380|ref|YP_001494100.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
 gi|166217812|sp|A8GQB7|HEM6_RICAH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157800338|gb|ABV75592.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
          Length = 279

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 173/291 (59%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E  +    + P  F    W R+       GGG +
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIEEEYAQTKCLK-PAKFVRTSWQRNG------GGGGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFSATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP       +       FH   KE C ++    Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPEENETEK-----FHAAFKEACDKYDSGYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGMALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|229587257|ref|YP_002845758.1| coproporphyrinogen III oxidase [Rickettsia africae ESF-5]
 gi|259709757|sp|C3PM25|HEM6_RICAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|228022307|gb|ACP54015.1| Coproporphyrinogen III oxidase precursor [Rickettsia africae ESF-5]
          Length = 279

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 176/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +  +    P  F    W R+       GGG +
Sbjct: 4   ENKEITSSWFTNLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRSSWQRNG------GGGGV 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G VFEK  V +STV+G +S +F+++I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 57  MSLMKGAVFEKVGVNISTVFGKISSEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L++    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNN----GNFEQDFAFTQDVGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 278


>gi|15604710|ref|NP_221228.1| coproporphyrinogen III oxidase [Rickettsia prowazekii str. Madrid
           E]
 gi|13431558|sp|Q9ZC86|HEM6_RICPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|3861405|emb|CAA15304.1| COPROPORPHYRINOGEN III OXIDASE PRECURSOR (hemF) [Rickettsia
           prowazekii]
 gi|292572547|gb|ADE30462.1| Coproporphyrinogen III oxidase precursor [Rickettsia prowazekii
           Rp22]
          Length = 279

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 176/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +       P  F    W R+       GG  +
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIE-EKYAQIKGLKPAKFVRTSWKRNG------GGCGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ S +F+ +ILG   +  F+ATG+SV+ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP      +  + +   FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKNWFGGGGDLTPF-----YPEENETAKFHTAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   +G   + +YP +VR     
Sbjct: 172 DEYFYLRHRKEPRGVGGIFYDYLNS----GNFEQDFAFTKDIGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP+V +
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPVVKF 278


>gi|307293832|ref|ZP_07573676.1| Coproporphyrinogen oxidase [Sphingobium chlorophenolicum L-1]
 gi|306879983|gb|EFN11200.1| Coproporphyrinogen oxidase [Sphingobium chlorophenolicum L-1]
          Length = 283

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 179/294 (60%), Gaps = 17/294 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK-SQKEDLGG 72
           ++ +++ ++  FE+L+  IC EFE +E EA  ++       F    W R+        GG
Sbjct: 5   LDPQQQAARTWFESLRDRICAEFEAIEREAGSDAR------FDYIAWDREAPGLTPGEGG 58

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G +  +  GKVFEK  V VSTV G  SP+F   I G +++P F+ATG+S++ H  NPHVP
Sbjct: 59  GGVRGVMKGKVFEKVGVNVSTVGGVFSPEFATTIHGASEDPSFFATGISLVAHMANPHVP 118

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R +VT   WFGGG DL P L       D D   FHN LK  C  H   +Y  +K
Sbjct: 119 AVHMNTRYLVTSKRWFGGGADLNPPLPR-----DEDTAHFHNVLKAACDAHDADHYPRFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            W D YF++PHR   RG+GGIF+DHL      G  DA+F+F   VG+ F+K +P +VRR 
Sbjct: 174 AWADEYFFIPHRGVHRGVGGIFYDHLE-----GDFDANFAFTRDVGEAFLKAFPPIVRRR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +S+++ +  L  RGRYAEFNL++D+GT FG KTGGNV++IL S+PP+ +W
Sbjct: 229 MGESWSQEEYRRMLEWRGRYAEFNLVHDRGTLFGLKTGGNVDAILMSLPPMASW 282


>gi|254796812|ref|YP_003081649.1| coproporphyrinogen III oxidase, aerobic [Neorickettsia risticii
           str. Illinois]
 gi|254590049|gb|ACT69411.1| coproporphyrinogen III oxidase, aerobic [Neorickettsia risticii
           str. Illinois]
          Length = 283

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 173/292 (59%), Gaps = 20/292 (6%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E+K  +   F  L+  I  EF  +E +   N  +     F V+ W R+     ++     
Sbjct: 8   EKKDTAAAWFRELRDRIRDEFIAIEKDFDPNFQSG----FAVESWEREGGGGGEM----- 58

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-YFWATGLSVIVHPYNPHVPAV 134
            +L  G VFEK  V +STV+G  S DF  +I G  +N   FWA+G+S++ H  +P VPAV
Sbjct: 59  -SLMYGTVFEKIGVNISTVHGIFSEDFASKIPGAAENGGKFWASGISLVAHMSSPLVPAV 117

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           H N RMIVT  YWFGGG DLTP   +     + D   FH   KE C +H    Y  + +W
Sbjct: 118 HMNTRMIVTDKYWFGGGADLTPMYYN-----EEDAKSFHAEFKETCDRHDSKYYDEFSKW 172

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
            D YFY+ HR E RGIGGIF+D+L +       + DF+F   VG CF+ +YP +VR+N H
Sbjct: 173 ADEYFYIKHRNEPRGIGGIFYDYLRTDD----WEKDFAFTKDVGKCFLSVYPKIVRKNMH 228

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             ++ + RQ QL++RGRY EFNLLYD+GT FG KTGGNV++IL S+PP+V W
Sbjct: 229 LSYTNEQRQFQLLKRGRYVEFNLLYDRGTEFGLKTGGNVKAILMSLPPVVEW 280


>gi|51474050|ref|YP_067807.1| coproporphyrinogen III oxidase [Rickettsia typhi str. Wilmington]
 gi|81610738|sp|Q68VN1|HEM6_RICTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|51460362|gb|AAU04325.1| Coprogen oxidase [Rickettsia typhi str. Wilmington]
          Length = 279

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 176/291 (60%), Gaps = 16/291 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +       P  F    W R+       GG  +
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIE-EKYAQIKGLKPAKFVRTSWKRNG------GGCGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ S +F+ +ILG   +  F+ATG+SV+ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP      +  + +   FH   KE C ++  + Y  +K  C
Sbjct: 117 FNTRYIETSKNWFGGGSDLTPF-----YPEENETAKFHTAFKEACDKYDSSYYPKFKRQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   +G   + +YP +VR     
Sbjct: 172 DEYFYLRHRKEPRGVGGIFYDYLNS----GNFEQDFAFTRDIGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++++ ++ QLI+RGRY EFNLLYD+GT FG  T GN+E+IL S+PP+V +
Sbjct: 228 PWTDEQKEYQLIKRGRYVEFNLLYDRGTKFGLMTDGNIEAILMSLPPVVKF 278


>gi|221640139|ref|YP_002526401.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides KD131]
 gi|221160920|gb|ACM01900.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides KD131]
          Length = 291

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 178/302 (58%), Gaps = 21/302 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++ +K  +   F  L++ I   FE LE+ A   S A+ +P  F V      ++ +E  
Sbjct: 3   DAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEVT-----ETSREAG 57

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VSTV+G L+P  +  +      G  ++P FWA+G+S++ H
Sbjct: 58  GGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLVAH 117

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P L+     Y  D   FH TL+  C  H 
Sbjct: 118 MQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTEHFHATLRRACEAHG 172

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+  
Sbjct: 173 ADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFLPA 228

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 229 FVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 288

Query: 305 AW 306
            W
Sbjct: 289 KW 290


>gi|239946625|ref|ZP_04698378.1| coproporphyrinogen III oxidase, aerobic [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239920901|gb|EER20925.1| coproporphyrinogen III oxidase, aerobic [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 314

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 176/289 (60%), Gaps = 16/289 (5%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           + I+   F +L+ ++C EFEK+E E +  +    P  F    W R+       GGG + +
Sbjct: 41  REITSSWFTDLRDLLCKEFEKIEEE-YAQTKGLKPAKFVRTSWQRNG------GGGGVMS 93

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +PA+HFN
Sbjct: 94  LMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMHFN 153

Query: 138 IRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
            R I T   WFGGG DLTP      +  + +   FH   KE C ++  + Y  +K+ CD 
Sbjct: 154 TRYIETSKSWFGGGGDLTPF-----YPEENETAKFHAAFKEACDKYDSSYYPKFKKQCDE 208

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR      +
Sbjct: 209 YFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTQDVGKALLSVYPEIVRSKLFLPW 264

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V +
Sbjct: 265 TTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKF 313


>gi|89056339|ref|YP_511790.1| coproporphyrinogen III oxidase [Jannaschia sp. CCS1]
 gi|88865888|gb|ABD56765.1| Coproporphyrinogen oxidase [Jannaschia sp. CCS1]
          Length = 292

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 169/288 (58%), Gaps = 18/288 (6%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F +L+  I   FE++E E H   A     +F V +  R      D GGG M+ +  G+VF
Sbjct: 16  FRSLRDDIVAAFEQVE-ETHGGDA--PAGVFEVTNTKRTSDDGSDAGGGLMSVMRGGRVF 72

Query: 85  EKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
           EK  V VS VYG+L    +  +      G   +P FWA+G+S++ H  NP VPAVH N R
Sbjct: 73  EKVGVNVSEVYGELGERAQKAMAARGVPGMESDPRFWASGISLVAHMQNPRVPAVHMNTR 132

Query: 140 MIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
           M  T GA+WFGGG DL P++E     YD D  FFH TLK+ C  H    Y  YK W D Y
Sbjct: 133 MFWTPGAWWFGGGSDLNPAIE-----YDEDTAFFHQTLKDHCDPHGADLYDRYKAWADEY 187

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FY+PHR  +RG+GGIF+D  ++    G  +ADF+F   VG  F+  +   V +  H  F+
Sbjct: 188 FYVPHRNRARGVGGIFYDDHNT----GDWNADFAFTQDVGRAFLPAFLGCVEKRRHEAFT 243

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + DR++QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+  W
Sbjct: 244 DDDREKQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPIAKW 291


>gi|126463097|ref|YP_001044211.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104761|gb|ABN77439.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides ATCC 17029]
          Length = 291

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 178/302 (58%), Gaps = 21/302 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++ +K  +   F  L++ I   FE LE+ A   S A+ +P  F V      ++ +E  
Sbjct: 3   DAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEVT-----ETSREAG 57

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VSTV+G L+P  +  +      G  ++P FWA+G+S++ H
Sbjct: 58  GGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLVAH 117

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P L+     Y  D   FH TL+  C  H 
Sbjct: 118 MQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTEHFHATLRHACEAHG 172

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+  
Sbjct: 173 ADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFLPA 228

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 229 FVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 288

Query: 305 AW 306
            W
Sbjct: 289 KW 290


>gi|332559144|ref|ZP_08413466.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
 gi|332276856|gb|EGJ22171.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
          Length = 291

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 178/302 (58%), Gaps = 21/302 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++ +K  +   F  L++ I   FE LE+ A   S A+ +P  F V      ++ +E  
Sbjct: 3   DAMDGQKARASEWFRELRNRILAAFEGLEDMATGGSPADAAPGRFEVT-----ETSREAG 57

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VSTV+G L+P  +  +      G  ++P FWA+G+S++ H
Sbjct: 58  GGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLVAH 117

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P L+     Y  D   FH TL+  C  H 
Sbjct: 118 MQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTKHFHATLRHACEAHG 172

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+  
Sbjct: 173 ADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFLPA 228

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 229 FVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 288

Query: 305 AW 306
            W
Sbjct: 289 KW 290


>gi|294013041|ref|YP_003546501.1| coproporphyrinogen III oxidase [Sphingobium japonicum UT26S]
 gi|292676371|dbj|BAI97889.1| coproporphyrinogen III oxidase [Sphingobium japonicum UT26S]
          Length = 283

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 176/294 (59%), Gaps = 17/294 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK-SQKEDLGG 72
           ++ +++ ++  FE+L++ IC EFE +E EA  ++       F    W R+        GG
Sbjct: 5   LDPQQQAARTWFESLRNRICAEFEAIEREAGSDAR------FDYIAWDREAPGLAPGEGG 58

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G +  +  GKVFEK  V VSTV G  SP+F   I G +++P F+ATG+S++ H  NPHVP
Sbjct: 59  GGVRGVMKGKVFEKVGVNVSTVGGAFSPEFAKTIHGASEDPSFFATGISLVAHMANPHVP 118

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R +VT   WFGGG DL P L       D D   FH  LK  C  H    Y  +K
Sbjct: 119 AVHMNTRYLVTSKRWFGGGADLNPPLPR-----DEDTAHFHAALKAACDAHDADYYPRFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            W D YF++PHR   RG+GGIF+DHL      G  DA F+F   VG+ F++ +P +VRR 
Sbjct: 174 AWADDYFFIPHRGVHRGVGGIFYDHLE-----GDFDAGFAFTRDVGEAFLRAFPPIVRRR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +SE D +  L  RGRYAEFNL++D+GT FG KTGGNV++IL S+PP+ +W
Sbjct: 229 MGESWSEDDYRRMLEWRGRYAEFNLVHDRGTLFGLKTGGNVDAILMSLPPMASW 282


>gi|87200549|ref|YP_497806.1| coproporphyrinogen III oxidase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136230|gb|ABD26972.1| Coproporphyrinogen oxidase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 287

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 172/284 (60%), Gaps = 14/284 (4%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD-KSQKEDLGGGRMATLCAGKV 83
           FE+L+  IC EFE +E EA  ++       F    W R+ + +  + GGG +  L  G+V
Sbjct: 15  FESLRDRICAEFEAIEREAGSDAR------FAYTPWNREHEGETVENGGGGVQGLMKGRV 68

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKN-PYFWATGLSVIVHPYNPHVPAVHFNIRMIV 142
           FEK  V VSTV G+ S +F   I G + + P F ATG+S++ H  NPHVPAVH N R + 
Sbjct: 69  FEKVGVNVSTVQGEFSKEFAGTINGASADAPGFTATGISLVAHMANPHVPAVHMNTRFLT 128

Query: 143 TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
           T   WFGGG DL P +      Y+ D + FH   K  C +H    Y  +K+W D YF++P
Sbjct: 129 TSKAWFGGGGDLNPPI-----PYEEDTVEFHAEYKAACDRHDPEYYPRFKKWADDYFWIP 183

Query: 203 HRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDR 262
           HR+  RG+GGIF+DHL  + +    +A+F+F   VG+ FI ++P LVRR     F+  ++
Sbjct: 184 HRKVHRGVGGIFYDHLECADD-AAFEANFAFTRDVGEAFINVFPRLVRRRMGMDFTPAEK 242

Query: 263 QEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             QL  RGRYAEFNL++D+GT FG KTGGN+++IL S+PP   W
Sbjct: 243 LTQLEYRGRYAEFNLVWDRGTLFGLKTGGNIDAILMSLPPEAVW 286


>gi|91206195|ref|YP_538550.1| coproporphyrinogen III oxidase [Rickettsia bellii RML369-C]
 gi|122425139|sp|Q1RGQ3|HEM6_RICBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91069739|gb|ABE05461.1| Coproporphyrinogen III oxidase precursor [Rickettsia bellii
           RML369-C]
          Length = 279

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 173/292 (59%), Gaps = 16/292 (5%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           ++ + ++   F NL+ ++C EFEK+E E +  +    P  F    W RD           
Sbjct: 3   KKNREVTSSWFTNLRDLVCAEFEKIEEE-YAKAKGLKPGKFVRSSWERDGGGG------G 55

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
           + ++  GKVFEK  V +STV+G+ S  F+ +I G   +  F+ATG+S++ H  +P +PA+
Sbjct: 56  VMSVMKGKVFEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPAM 115

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           HFN R I T   WFGGG DLTP      +  + +   FH   KE C ++    Y  +K+ 
Sbjct: 116 HFNTRYIETSKNWFGGGGDLTPF-----YPEEDETAKFHAAFKEACDKYDSGYYPKFKKQ 170

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR    
Sbjct: 171 CDEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGKALLSVYPEIVRNKLF 226

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             ++++ ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 227 LPWTDEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKW 278


>gi|157827804|ref|YP_001496868.1| coproporphyrinogen III oxidase [Rickettsia bellii OSU 85-389]
 gi|166217813|sp|A8GY81|HEM6_RICB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157803108|gb|ABV79831.1| coproporphyrinogen III oxidase [Rickettsia bellii OSU 85-389]
          Length = 279

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 173/292 (59%), Gaps = 16/292 (5%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           ++ + ++   F NL+ ++C EFEK+E E +  +    P  F    W RD           
Sbjct: 3   KKNREVTSSWFTNLRDLVCAEFEKIEEE-YAKAKGLKPGKFVRSSWERDGGGG------G 55

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
           + ++  G+VFEK  V +STV+G+ S  F+ +I G   +  F+ATG+S++ H  +P +PA+
Sbjct: 56  VMSVMKGEVFEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPAM 115

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           HFN R I T   WFGGG DLTP      +  + +   FH   KE C ++    Y  +K+ 
Sbjct: 116 HFNTRYIETSKNWFGGGGDLTPF-----YPEEDETAKFHAAFKEACDKYDSGYYPKFKKQ 170

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR    
Sbjct: 171 CDEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGKALLSVYPEIVRNKLF 226

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             ++++ ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 227 LPWTDEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKW 278


>gi|84500367|ref|ZP_00998616.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
 gi|84391320|gb|EAQ03652.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
          Length = 297

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 168/299 (56%), Gaps = 18/299 (6%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           ER R +   F  L+  I   FE LE+   E   ++R P  F V    R      D GGG 
Sbjct: 8   ERTRAAD-WFRGLRDEIVAAFEGLEDAQAEGPLSDREPGRFDVTETRRATPDGSDAGGGL 66

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL------GTTKNPYFWATGLSVIVHPYN 128
           M+ +  G+VFEK  V VSTVYG+L P+ +  +       G  ++P FWA+G+S++ H  N
Sbjct: 67  MSVMRGGRVFEKVGVNVSTVYGELGPEAQAAMAARKGLPGMQEDPRFWASGISLVAHMQN 126

Query: 129 PHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           PH PAVH N RM  T   +WFGGG DL P +E     YD D   FH  L++ C  H    
Sbjct: 127 PHCPAVHMNTRMFWTPHGWWFGGGADLNPCIE-----YDEDTAHFHRVLEDHCDPHGAGQ 181

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y   K W D YFY+PHR  +RG+GGIF D  H S   G  +ADF+FI  +G  F+  Y  
Sbjct: 182 YDRLKAWADEYFYIPHRGRARGVGGIFLDD-HCS---GDWEADFAFIRDIGRAFLPAYLP 237

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           LV +     +S+ D++ QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP+  W
Sbjct: 238 LVEKRRRSPWSDADKEVQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPMAKW 296


>gi|90422774|ref|YP_531144.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB18]
 gi|90104788|gb|ABD86825.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisB18]
          Length = 304

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 120/294 (40%), Positives = 172/294 (58%), Gaps = 8/294 (2%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           + E+ +  ++  FE+L+  IC+E E LE EA        P  FT K W R   Q   +  
Sbjct: 18  EAEQHRARAKAWFESLRDRICSEVEALEREAPAALFPGEPARFTYKPWQRQTGQGGGV-- 75

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
                L  G++FEK  +  S+  G L+P+    + G   +  + ++ +S+I+HP +P VP
Sbjct: 76  --GGFLSGGRLFEKIGIHTSSANGRLTPEMAKTLPGDGVSLNYVSSSISLIMHPRSPRVP 133

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
            VH N R + T   WFGGG DLTP L  +R +   D + FH  ++  C  H    Y  +K
Sbjct: 134 TVHMNTRFLATSQGWFGGGADLTPMLAEQRRADAEDCVTFHAAMQRACDAHDPGYYAKFK 193

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            W D YF+LPHR  +RG+GGIF+DHL+S    G  + DF+F   VG   +++YP +VR+ 
Sbjct: 194 PWADSYFFLPHRGTARGVGGIFYDHLNS----GDFERDFAFTREVGLALLEVYPKIVRKR 249

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +S+ +R +QL  RG Y EFNLLYDKGT FG +TGGN+E+IL+SMPPLV+W
Sbjct: 250 MQEPWSDAERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNIETILSSMPPLVSW 303


>gi|83951018|ref|ZP_00959751.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
 gi|83838917|gb|EAP78213.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
          Length = 296

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 172/302 (56%), Gaps = 18/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDL 70
           D+ E K  +   F  L+  I   FE++E   HE+   A++    F ++   R      D 
Sbjct: 4   DLPEEKSRAAAWFRALRDEIVDAFEEVETR-HEDGPRADQPAGRFELRDTKRTAEDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VS V+G LSP  +  +      G  +NP FWA+G+S++ H
Sbjct: 63  GGGLMSVMRNGRVFEKVGVNVSEVHGRLSPAAQKSMAARGVPGIAENPSFWASGISLVAH 122

Query: 126 PYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T GA+WFGGG DL P LE     YD D   FH+TL+     H 
Sbjct: 123 MQNPHVPAVHMNTRMFWTPGAWWFGGGADLNPCLE-----YDEDTAHFHSTLQSHLDPHD 177

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A Y   K W D YFY+PHR  +RG+GG+F D  +S    G  +ADF+    +G  F+  
Sbjct: 178 PALYPDLKRWADEYFYIPHRGRARGVGGVFMDDRNS----GDWEADFALTQDIGRAFLPA 233

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV R     ++E D++ QL+ RG YAE+NL+YD+GT FG  TG + +++L S+PPL 
Sbjct: 234 YLPLVERRRGQTWTEADKEAQLVHRGLYAEYNLVYDRGTKFGLATGHDPDAVLMSLPPLA 293

Query: 305 AW 306
            W
Sbjct: 294 KW 295


>gi|77464255|ref|YP_353759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides 2.4.1]
 gi|77388673|gb|ABA79858.1| coproporphyrinogen III oxidase, aerobic [Rhodobacter sphaeroides
           2.4.1]
          Length = 291

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 176/302 (58%), Gaps = 21/302 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++ +K  +   F  L++ I   FE LE+ A   S A+ +P  F +      ++ +E  
Sbjct: 3   DAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEMT-----ETSREAG 57

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VSTV+G L+   +  +      G  ++P FWA+G+S++ H
Sbjct: 58  GGGLMSVMRGGRVFEKVGVNVSTVHGTLASRAQQAMAARGVPGMAEDPRFWASGISLVAH 117

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P L+     Y  D   FH TL+  C  H 
Sbjct: 118 MQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTKHFHATLRHACEAHG 172

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K W D YF++PHR  +RG+GGIFFD L++       +ADF+F  AVG+ F+  
Sbjct: 173 ADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNTDD----WEADFAFTRAVGEAFLPA 228

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 229 FVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 288

Query: 305 AW 306
            W
Sbjct: 289 KW 290


>gi|260574200|ref|ZP_05842205.1| Coproporphyrinogen oxidase [Rhodobacter sp. SW2]
 gi|259023666|gb|EEW26957.1| Coproporphyrinogen oxidase [Rhodobacter sp. SW2]
          Length = 287

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 172/302 (56%), Gaps = 23/302 (7%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D+ + RK  +   F NL+  I T FE +E      +A   P       +    + + D G
Sbjct: 3   DEFDARKTRAAAWFRNLRDQIVTAFEAIE------TAQGGPA--PAGRFELTPTSRPDGG 54

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVHP 126
           GG M+ +  G+VFEK  V VS V+G L+P  +       + G  ++P FWA+G+S++ H 
Sbjct: 55  GGLMSVMRHGRVFEKIGVAVSEVHGTLAPRAQQAMAARGVPGMAEDPRFWASGVSLVAHM 114

Query: 127 YNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH PAVH N RM  T GA WFGGG DL P +E     Y  D  FFH  L++ C  HA 
Sbjct: 115 QNPHAPAVHLNTRMFWTPGACWFGGGSDLNPCIE-----YPEDTAFFHGVLRQACDAHAP 169

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  +K W D YFY+PHR  +RG+GGIFFD  H++   G  +ADF+F   VG  F+  +
Sbjct: 170 DYYPRFKAWADEYFYVPHRNRARGVGGIFFDD-HAT---GDWEADFAFTQDVGRAFLPAF 225

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +  R     ++E DR+ QL+ RG YAE+NL+YD+GT FG +TG +  ++L +MPP+  
Sbjct: 226 LPITERRLGTPWTEADREAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMTMPPIAK 285

Query: 306 WP 307
           WP
Sbjct: 286 WP 287


>gi|329114328|ref|ZP_08243090.1| Coproporphyrinogen-III oxidase, aerobic [Acetobacter pomorum DM001]
 gi|326696404|gb|EGE48083.1| Coproporphyrinogen-III oxidase, aerobic [Acetobacter pomorum DM001]
          Length = 228

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/233 (47%), Positives = 149/233 (63%), Gaps = 5/233 (2%)

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
           M ++  G+VFEK  V VSTV G  +P+F   I G  ++P F+ATG+S++ H  +P VPA 
Sbjct: 1   MMSVMHGRVFEKVGVNVSTVQGTFTPEFAATIPGAAEDPTFFATGISLVAHMCSPLVPAA 60

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           HFN RMI+T   WFGGG D+TP       + D D   FH    + C+ H    Y  +K W
Sbjct: 61  HFNTRMIITTKGWFGGGGDITPMFPDSAEAQD-DAARFHAAFAQACNAHDPEYYPRFKAW 119

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD+YF+LPHR E RG+GGIF+D L+S    G +  DF+F   VG  F+ ++P ++R    
Sbjct: 120 CDKYFFLPHRNEPRGLGGIFYDRLNS----GDVQEDFAFTKDVGLAFLNVFPEIIRSRMM 175

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
             ++ + R+ QLIRRGRY EFNLL+D+GT FG KTGG+ E+IL SMPP V WP
Sbjct: 176 EPWTPEQREAQLIRRGRYVEFNLLHDRGTLFGLKTGGHTEAILMSMPPEVKWP 228


>gi|159043227|ref|YP_001532021.1| coproporphyrinogen III oxidase [Dinoroseobacter shibae DFL 12]
 gi|157910987|gb|ABV92420.1| coproporphyrinogen 3 oxidase [Dinoroseobacter shibae DFL 12]
          Length = 297

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 172/304 (56%), Gaps = 17/304 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           +D  ERK  +   F  L+  I   FE LE+   E   A+ +P  F V    R      D 
Sbjct: 3   EDFTERKARASAWFRTLRDEIVAAFEALEDTQTEGPFADLAPGRFEVTETTRASDDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDF------KDQILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +STVYG L+P        +  + G   +P FWA+G+S++ 
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNISTVYGALAPRAQAAMAARKGVPGMDTDPRFWASGISLVA 122

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T   +WFGGG DL P +E    + D     FH  L++ C +H
Sbjct: 123 HMRNPHAPAVHMNTRMFWTPQTWWFGGGSDLNPCIEKPEDTAD-----FHKVLQDYCDKH 177

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
             A Y  YK W D YF++PHR  +RG+GGIF+D  ++    G  +ADF+F   VG  F+ 
Sbjct: 178 DPALYPKYKAWADEYFFVPHRGRARGVGGIFYDDRNT----GDWEADFAFTQDVGRAFLP 233

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            +  +  RN +  +++ D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP 
Sbjct: 234 AFLPVTERNRNLPWTDADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDATAVLMSLPPE 293

Query: 304 VAWP 307
             WP
Sbjct: 294 AKWP 297


>gi|218508262|ref|ZP_03506140.1| coproporphyrinogen III oxidase [Rhizobium etli Brasil 5]
          Length = 177

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 128/177 (72%)

Query: 117 ATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           A+G+S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  +
Sbjct: 1   ASGISLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAM 60

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           +  C  HAVA+Y  YK WCD YF+L HR E RGIGGIF+D LHSS + GG +ADF+F   
Sbjct: 61  EIACRNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIFYDWLHSSEDSGGWNADFAFTRD 120

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           VG  F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNV
Sbjct: 121 VGRAFAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNV 177


>gi|114768873|ref|ZP_01446499.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
 gi|114549790|gb|EAU52671.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
          Length = 294

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 176/301 (58%), Gaps = 20/301 (6%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +++K   +  F NL++ IC  FE +EN        +  P  F +    RD+      GGG
Sbjct: 6   QKQKEEVENWFSNLRNEICMSFENIENNQSTGPHCDLPPGKFELTETKRDEGSG---GGG 62

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDF------KDQILGTTKNPYFWATGLSVIVHPY 127
            M+ +  G+VFEK  V +STVYG L+P        + ++ G   NP FWA+G+S++ H  
Sbjct: 63  LMSVMRGGRVFEKVGVNISTVYGKLNPLMQKSMASRKEMTGIEDNPIFWASGISLVAHMN 122

Query: 128 NPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           +P VPAVH N RM  T  A WFGGG DL P +E    +      FFH  LK+ C ++   
Sbjct: 123 SPKVPAVHMNTRMFWTPVASWFGGGTDLNPMIEVAEETK-----FFHKVLKKTCDKYNPE 177

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK+W D YF + H  E+RG+GGIFFD L++    G  +ADF+F   VG  F+  Y 
Sbjct: 178 YYPKYKKWADEYFLIKHWNETRGVGGIFFDDLNT----GNWNADFNFTKDVGKAFLAAYV 233

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L  +N  + +++ +R+ QLI+RG+YAEFNL+YD+GT+FG ++G +  ++L S+PP+  W
Sbjct: 234 PLCEKNQANSWTDAEREVQLIKRGKYAEFNLVYDRGTHFGLQSGHDPSAVLMSLPPVAKW 293

Query: 307 P 307
           P
Sbjct: 294 P 294


>gi|88657656|ref|YP_507402.1| coproporphyrinogen III oxidase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599113|gb|ABD44582.1| coproporphyrinogen III oxidase, aerobic [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 284

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 123/294 (41%), Positives = 181/294 (61%), Gaps = 34/294 (11%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F+ LQ+ + +EF  +E +     ++  P++   KHW R        GGG  + +  GKVF
Sbjct: 12  FKTLQNQLLSEFISIEKQF----SSFIPQV-DHKHWERPG------GGGGHSIVIYGKVF 60

Query: 85  EKAAVLVSTVYGDLS-----------PDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           EKA + VS VYGD+             +  +  +G  K   FWA+G+SV+ H  +P VPA
Sbjct: 61  EKAGINVSEVYGDMEQNHELSHAVNPSELSNTFIGKDKK--FWASGISVVAHMCSPFVPA 118

Query: 134 VHFNIRMI-VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           VH N R I ++   WFGGGIDLTP+ E+++     D   FH+ L+EMC Q+  + Y  +K
Sbjct: 119 VHMNTRFICISDKNWFGGGIDLTPTYENKK-----DQELFHSNLREMCDQYDKSYYQKFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YF+L HR+E RGIGGIF+D+++S    G  +ADF +  AVG   + +YP +V+RN
Sbjct: 174 QQCDEYFFLHHRKEPRGIGGIFYDNINS----GNWEADFQYTQAVGKFLLDIYPIIVKRN 229

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  ++ ++R+ QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPP+V W
Sbjct: 230 LHTPWTAEEREYQLVKRGRYVEFNLIYDRGTRFGLLTNGNSDAIMMSMPPIVKW 283


>gi|332188858|ref|ZP_08390566.1| coproporphyrinogen III oxidase family protein [Sphingomonas sp.
           S17]
 gi|332011124|gb|EGI53221.1| coproporphyrinogen III oxidase family protein [Sphingomonas sp.
           S17]
          Length = 286

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 170/306 (55%), Gaps = 21/306 (6%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MN  T +I     ++  +  ++  FE L+  IC EFE +E EA  ++       FT   W
Sbjct: 1   MNSRTPDIA----LDAEQDAARLWFETLRDRICAEFEAIEREAGSDA------TFTYTAW 50

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R      + GGG +  +  G+VFEK  V VSTV G     F   I G   +P F ATG+
Sbjct: 51  DR-ADPSGEPGGGGVRGVMKGRVFEKVGVNVSTVGGTFEGPFAKTIHGAGDDPRFVATGI 109

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S++ H  NPHVPAVH N R + T   WFGGG DL P L     + D     FH  LK  C
Sbjct: 110 SLVAHMANPHVPAVHMNTRFLTTTKRWFGGGADLNPPLPIEEDTAD-----FHARLKAAC 164

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H    +  +K W D YFY+PHRQ  RG+GGIF+DHL      G    +F+F   VG+ 
Sbjct: 165 DAHNPEYHPRFKAWADDYFYIPHRQVHRGVGGIFYDHLE-----GDFTGNFAFTRDVGEA 219

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+ ++P +VRR     F+E DR   L  RGRYAEFNL+YD+GT FG KTGGN+++IL S+
Sbjct: 220 FLDVFPRIVRRRMGLPFTEADRAAMLAWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSL 279

Query: 301 PPLVAW 306
           PPL  W
Sbjct: 280 PPLATW 285


>gi|84685223|ref|ZP_01013122.1| coproporphyrinogen III oxidase, aerobic [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666955|gb|EAQ13426.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           HTCC2654]
          Length = 296

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 167/302 (55%), Gaps = 16/302 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++++K  +   F +L+  I   FE LE+       A  +P  F VK   R      D 
Sbjct: 3   DMMDDQKARASAWFRDLRDQIVAAFEALEDSQTTGPFAENAPGRFEVKSTTRTSDDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V +STVYG L    +  +      G   +P FWA+G+S++ H
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNISTVYGVLGEAAQKSMAARGVPGIEADPSFWASGISLVAH 122

Query: 126 PYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T GA+WFGGG DL P +E     YD D   FH  +K  C  H 
Sbjct: 123 MQNPHSPAVHMNTRMFWTPGAWWFGGGADLNPCIE-----YDEDTAHFHAAMKAGCDPHD 177

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A Y  YK W D YFY+PHR+ +RG+GGIF+D  ++    G  +ADF+F   VG  F+  
Sbjct: 178 PAYYDRYKAWADEYFYIPHRRRARGVGGIFYDDHNT----GDWEADFAFTQDVGRAFLPA 233

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  +  +     +   D+  QL+ RG YAE+NL+YD+GT FG  T  + +++L S+PPL 
Sbjct: 234 FLPVTEKRRDTPWDAADKDTQLVHRGLYAEYNLVYDRGTKFGLATSHDPDAVLMSLPPLA 293

Query: 305 AW 306
            W
Sbjct: 294 KW 295


>gi|146276600|ref|YP_001166759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554841|gb|ABP69454.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides ATCC 17025]
          Length = 291

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 176/302 (58%), Gaps = 21/302 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D ++ +K  +   F  L++ I   FE LE+ A   S  + +P  F V      ++ +E  
Sbjct: 3   DAMDGQKARAADWFRELRNRILAAFEGLEDAAAGGSPTDPAPGRFEVS-----ETTREAG 57

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVH 125
           GGG M+ L  G+VFEK  V VSTV+G L+   +       + G  ++P FWA+G+S++ H
Sbjct: 58  GGGLMSVLRGGRVFEKVGVNVSTVHGTLAARAQQAMAARGVPGMAEDPRFWASGISLVAH 117

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P L+     +  D   FH TL+  C  H 
Sbjct: 118 MQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----HPEDTEHFHATLRRGCEAHG 172

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K W D YF++PHR  +RG+GGIF+D L+S    G  +ADF+F  AVG+ F+  
Sbjct: 173 ADYYPRFKAWADEYFFIPHRGRARGVGGIFYDDLNS----GDWEADFAFTRAVGEAFLPA 228

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 229 FVPLVERRMGTPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 288

Query: 305 AW 306
            W
Sbjct: 289 KW 290


>gi|103486833|ref|YP_616394.1| coproporphyrinogen III oxidase [Sphingopyxis alaskensis RB2256]
 gi|98976910|gb|ABF53061.1| Coproporphyrinogen oxidase [Sphingopyxis alaskensis RB2256]
          Length = 286

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 128/294 (43%), Positives = 174/294 (59%), Gaps = 13/294 (4%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ +++ ++  FE+L+  IC EFE +E EA  ++       FT   W R+    E   GG
Sbjct: 4   LDPQQQKARNWFESLRDRICAEFEAIEAEAGSDAR------FTYTSWDREAEGLEPGEGG 57

Query: 74  RMAT-LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
                +  GKVFEK  V VSTV G+ +PDF   I G   +P F+ATG+S++ H  NPHVP
Sbjct: 58  GGVRGVMTGKVFEKVGVNVSTVGGEFAPDFASSIHGAGDDPRFFATGISLVAHMANPHVP 117

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R +VT   WFGGG DL P +      Y  D   FH  L+  C+      Y  Y 
Sbjct: 118 AVHMNTRFLVTTKRWFGGGADLNPPI-----PYQEDTDAFHARLRAACAPFGPDVYERYA 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +W D YFY+PHR   RG+GGIF+DHL    +    D +F    AVG+ F+ ++P +VRR 
Sbjct: 173 KWADEYFYIPHRGVHRGVGGIFYDHLECGDD-AEFDRNFQLTQAVGEAFLDIFPRIVRRR 231

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F++ +R  QL+ RGRYAEFNL+YD+GT FG KTGGN+++IL S+PPL  W
Sbjct: 232 MDQPFTDAERDAQLVWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPLAKW 285


>gi|126740635|ref|ZP_01756322.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
 gi|126718436|gb|EBA15151.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
          Length = 297

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 168/303 (55%), Gaps = 19/303 (6%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDL 70
           +++E+K ++   F  L++ I   FE+LE ++H     A   P  F V    R   +  D 
Sbjct: 4   EMKEQKALAAAWFRELRNQIVAAFEELE-QSHTTGPFAELEPGSFEVTETKRGSDEGADA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +S VYG L      +   +  + G   +P FWA+G+S++ 
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNISEVYGTLGERAQMAMAARKGLPGMKDDPRFWASGISLVA 122

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NP VPAVH N RM  T   +WFGGG DL P +E     YD D   FH T K     H
Sbjct: 123 HMRNPRVPAVHMNTRMFWTPHGWWFGGGSDLNPCIE-----YDEDTAHFHQTQKRHLDPH 177

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y+  K+W D YFY+PHR  +RG+GGIF D  +S    G   ADF+    +G  F+ 
Sbjct: 178 GEDLYSQLKDWADEYFYIPHRGRARGVGGIFMDDRNS----GDWQADFALTQDIGRAFLP 233

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +     FSE DR+ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL
Sbjct: 234 AYVPLVEKRRQQGFSEADREAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPL 293

Query: 304 VAW 306
             W
Sbjct: 294 AKW 296


>gi|254464105|ref|ZP_05077516.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           Y4I]
 gi|206685013|gb|EDZ45495.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           Y4I]
          Length = 297

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 165/301 (54%), Gaps = 18/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGG 72
           IEE+ R +   F  L+  I   FE LE+   E   A  +P  F V    R      D GG
Sbjct: 6   IEEKARAAAW-FRQLRDQIVAAFEGLEDSHSEGPFAEMAPGRFEVTQTKRSSDDGSDAGG 64

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVHP 126
           G M+ +  G+VFEK  V +S VYG L      +   +  I G   +P FWA+G+S++ H 
Sbjct: 65  GLMSVMRGGRVFEKVGVNISEVYGTLGDRAQAAMAARKGIPGMKDDPRFWASGISLVAHM 124

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPHVPAVH N RM  T  A+WFGGG DL P +E     Y+ D   FH T K+    H  
Sbjct: 125 RNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YEEDTAHFHATQKQHLDPHGP 179

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y   K W D YFY+PHR+ +RG+GGIF D  +S    G   ADF+    +G  F+  +
Sbjct: 180 DQYPRLKAWADEYFYIPHRKRARGVGGIFMDDQNS----GDWAADFALTQDIGRAFLPAF 235

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV +     +SE D++ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  
Sbjct: 236 VPLVEKRRVQDYSEADKEAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAK 295

Query: 306 W 306
           W
Sbjct: 296 W 296


>gi|56698473|ref|YP_168848.1| coproporphyrinogen III oxidase [Ruegeria pomeroyi DSS-3]
 gi|56680210|gb|AAV96876.1| coproporphyrinogen III oxidase, aerobic [Ruegeria pomeroyi DSS-3]
          Length = 294

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 163/301 (54%), Gaps = 17/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGG 72
            E  K  +   F +L+  I   FE LE+   E   +  +P  F V    R      D GG
Sbjct: 2   FETEKSTASAWFRDLRDQIVAAFEGLEDSHAEGPFSEMAPGRFEVTETTRQSDDGSDAGG 61

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVHP 126
           G M+ +  G+VFEK  V +STVYG L      +   +  I G   +P FWA+G+S++ H 
Sbjct: 62  GLMSVMRGGRVFEKVGVNISTVYGTLGERAQAAMAARKGIPGMADDPRFWASGISLVAHM 121

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPHVPAVH N RM  T  A+WFGGG DL P +E     Y  D   FH T +     H  
Sbjct: 122 QNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHATQRAHLDPHGS 176

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
            +Y   K W D YFY+PHR+ +RG+GGIF D L +    G   ADF+    +G  F+  Y
Sbjct: 177 EHYPRLKAWADEYFYIPHRKRARGVGGIFMDDLCT----GDWQADFALTQDIGRAFLPAY 232

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
            SLV R     F E +++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  
Sbjct: 233 LSLVERRRVQPFDEAEKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAK 292

Query: 306 W 306
           W
Sbjct: 293 W 293


>gi|114765846|ref|ZP_01444939.1| coproporphyrinogen III oxidase [Pelagibaca bermudensis HTCC2601]
 gi|114541845|gb|EAU44882.1| coproporphyrinogen III oxidase [Roseovarius sp. HTCC2601]
          Length = 298

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 164/303 (54%), Gaps = 18/303 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKED 69
           D   ERK  +   F  L+  I   FE LE ++H+    ++ +P  F V    R      D
Sbjct: 5   DAFAERKIRASDWFRALRDEIVAAFEGLE-QSHDTGPFSDDAPGAFEVTPTSRTAEDGSD 63

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIV 124
            GGG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S++ 
Sbjct: 64  AGGGLMSVMRGGRVFEKVGVNVSTVYGTLGEAAQKSMAARGVPGIESDPRFWASGISLVA 123

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPHVPAVH N RM  T  A+WFGGG DL P +E     YD D   FH T K     H
Sbjct: 124 HMRNPHVPAVHMNTRMFWTPNAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHLDPH 178

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
             A Y   K W D YFY+PHR+ +RG+GGIF D  ++    G  DADF+    +G  F+ 
Sbjct: 179 GPALYPELKAWADEYFYIPHRKRARGVGGIFMDDRNT----GDWDADFALTQDIGRAFLP 234

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +         DR+ QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL
Sbjct: 235 AYLPLVEKRRVMPCDAADRETQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPL 294

Query: 304 VAW 306
             W
Sbjct: 295 AKW 297


>gi|126724992|ref|ZP_01740835.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
 gi|126706156|gb|EBA05246.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
          Length = 293

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 170/304 (55%), Gaps = 23/304 (7%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKEDL 70
           ++ +++K  +   F  L++ I T FE LE++   +  A R    F V    R      D 
Sbjct: 3   NNFDQQKSQASAWFRQLRNEIRTSFEGLEDKFGGDAPAGR----FEVTETTRTSDDGSDA 58

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-------PYFWATGLSVI 123
           GGG M+ +  G+VFEK  V +STVYG L  +   + +   KN       P FWA G+S++
Sbjct: 59  GGGEMSVMRGGRVFEKIGVNISTVYGTLG-ERAQKAMAAQKNIPEMRDDPRFWAAGISLV 117

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T  A+WFGGG DL P +E     Y  D   FH T +  C  
Sbjct: 118 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTEHFHATQRAHCDP 172

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +KEW D YFY+PHR  +RG+GGIF+D L++    G  D DF+F   VG  F+
Sbjct: 173 HDAGYYDKFKEWADTYFYIPHRHRARGVGGIFYDDLNT----GDWDKDFAFTQDVGRAFL 228

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  L+++     +++ D+  QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 229 PAYVPLIQKRMQQPWNDADKDAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 288

Query: 303 LVAW 306
           +  W
Sbjct: 289 MAKW 292


>gi|126733458|ref|ZP_01749205.1| coproporphyrinogen III oxidase [Roseobacter sp. CCS2]
 gi|126716324|gb|EBA13188.1| coproporphyrinogen III oxidase [Roseobacter sp. CCS2]
          Length = 311

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 160/301 (53%), Gaps = 18/301 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D  E  K  +   F  L+  I   FE LE+    +  + +   F V   +R      D G
Sbjct: 22  DGFEAEKSKASSWFRTLRDQIVASFEGLEDS---HKGDGTAGRFEVTETMRTSDDGSDAG 78

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVHP 126
           GG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S++ H 
Sbjct: 79  GGLMSVMRGGRVFEKVGVNVSTVYGQLGASAQKAMAARGVPGMEDDPRFWASGISLVAHM 138

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH PAVH N RM  T  A+WFGGG DL P +E     YD D   FH T K     H  
Sbjct: 139 QNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHLDPHGE 193

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y   K W D YFY+PHR  +RG+GGIF D   +    G  +ADF+    +G  F+  Y
Sbjct: 194 AHYPKLKAWADEYFYIPHRNRARGVGGIFMDDYCT----GDWEADFTLTQDIGKAFLPAY 249

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL  
Sbjct: 250 IPLVEKRRDTPWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLAK 309

Query: 306 W 306
           W
Sbjct: 310 W 310


>gi|163733943|ref|ZP_02141385.1| coproporphyrinogen III oxidase, aerobic [Roseobacter litoralis Och
           149]
 gi|161393054|gb|EDQ17381.1| coproporphyrinogen III oxidase, aerobic [Roseobacter litoralis Och
           149]
          Length = 297

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 165/302 (54%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D +  K  +   F  L+  I   FE+LE++ AH   ++    +F V    R      D G
Sbjct: 4   DFDTEKTRASAWFRELRDQIVAAFEELESDHAHGPLSDGEAAVFDVSETKRQSDDGSDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STVYG L    +        I G   +P FWA+G+S++ H
Sbjct: 64  GGLMSVMRGGRVFEKVGVNISTVYGTLGTRAQSAMAARKGIPGMKDDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P +E     YD D   FH   +E    H 
Sbjct: 124 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHAQQQEKLDPHG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K+W D YFY+PHR  +RG+GGIF D  H + +    + DFS    +G  F+  
Sbjct: 179 TDFYPRLKDWADEYFYIPHRNRARGVGGIFMDD-HCTNDW---EQDFSLTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LVR+     ++E D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 235 YVPLVRKRRAQDWTEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|73667068|ref|YP_303084.1| coproporphyrinogen III oxidase [Ehrlichia canis str. Jake]
 gi|72394209|gb|AAZ68486.1| Coproporphyrinogen oxidase [Ehrlichia canis str. Jake]
          Length = 282

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 185/301 (61%), Gaps = 28/301 (9%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +EE+++ +   F  LQ+ + ++F  +E E     ++ SP++   K+W R           
Sbjct: 1   MEEKQKRAVNWFTTLQNQLLSKFISIEKEF----SSFSPQV-DNKNWERPGGGGGH---- 51

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFK-------DQILGTTKNPYFWATGLSVIVHP 126
             + +  GKVFEKA + VS VYGD++   +        +I  ++    FWA+G+SV+ H 
Sbjct: 52  --SIIIYGKVFEKAGINVSEVYGDITKTHELSNVLNNSEIFNSSSEKKFWASGISVVAHM 109

Query: 127 YNPHVPAVHFNIRMI-VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            +P VPA+H N R I ++   WFGGG+DLTP+ ++ +     D   FH++L+++C QH  
Sbjct: 110 CSPFVPAIHMNTRFICISDKSWFGGGVDLTPTYKNTQ-----DQELFHDSLRKICDQHNK 164

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y+ +K+ CD YF+L HRQE RGIGGIF+D+++S    G  + DF +  AVG   + +Y
Sbjct: 165 EYYSKFKQQCDEYFFLHHRQEPRGIGGIFYDNINS----GNWEDDFQYTQAVGKFLLDIY 220

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P ++RRN +  ++ ++R+ QLI+RGRY EFNL+YD+GT FG  T GN ++I+ SMPP+V 
Sbjct: 221 PIIIRRNLNKKWTVEEREYQLIKRGRYVEFNLIYDRGTKFGLLTNGNPDAIMMSMPPVVK 280

Query: 306 W 306
           W
Sbjct: 281 W 281


>gi|260432445|ref|ZP_05786416.1| coproporphyrinogen III oxidase, aerobic [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416273|gb|EEX09532.1| coproporphyrinogen III oxidase, aerobic [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 294

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 164/302 (54%), Gaps = 19/302 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDLG 71
            +  K  +   F +L+  I   FE LE+ +H+    +   P  F VK   R      D G
Sbjct: 2   FDTEKATASAWFRSLRDQIVAAFEALED-SHDTGPFSEAEPGRFEVKETRRHSEDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTVYG L    +        I G   +P FWA+G+S++ H
Sbjct: 61  GGLMSVMRGGRVFEKVGVNVSTVYGTLGERAQQAMAARKGIPGMADDPRFWASGISLVAH 120

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P +E     Y  D   FH T K     H 
Sbjct: 121 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHATQKAHLDPHG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
             +Y   KEW D YFY+PHR+ +RG+GGIF D   +    G   ADF+    +G  F+  
Sbjct: 176 PGHYPRLKEWADEYFYIPHRKRARGVGGIFMDDYCT----GDWQADFALTQDIGRAFLPA 231

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV +     F+E D+  QLI RG YAE+NL+YD+GT FG +TG + +++L S+PPL 
Sbjct: 232 FLPLVEKRRVQPFTEADKDTQLIHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPPLA 291

Query: 305 AW 306
            W
Sbjct: 292 KW 293


>gi|83941604|ref|ZP_00954066.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
 gi|83847424|gb|EAP85299.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
          Length = 297

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 165/302 (54%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLG 71
           D E  K  +   F +L+  I   FE LE +  E   ++ +P  F V    R      D G
Sbjct: 4   DFEAEKTRAAEWFRSLRDQIVEAFETLERDHAEGPLSDAAPGTFEVTPTKRSSDDGSDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTV+G L      +   +  I G  ++P FWA+G+S++ H
Sbjct: 64  GGLMSVMRGGRVFEKVGVNVSTVFGTLGERAQVAMAARKGIPGMAEDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A WFGGG DL P +E     YD D   FH   K     H 
Sbjct: 124 MQNPHAPAVHMNTRMFWTPHASWFGGGSDLNPCIE-----YDEDTAHFHAVQKAHLDPHG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K W D YFY+PHR  +RG+GGIF D  H++   G  +ADF+    +G  F+  
Sbjct: 179 SDLYPRLKAWADEYFYIPHRHRARGVGGIFMDD-HAT---GDWEADFALTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV++     +SE D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 235 YLPLVQKRITQDWSEADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|126732065|ref|ZP_01747867.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
 gi|126707354|gb|EBA06418.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
          Length = 293

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 160/298 (53%), Gaps = 17/298 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           E+ R S   F +L+  I   FE LE+  H    A      F V    R      D GGG 
Sbjct: 5   EKDRASTW-FRDLRDQIVAAFEALEDSHHAGPFAEADAGRFEVTQTTRHSDDGSDAGGGL 63

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVHPYNP 129
           M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S++ H  NP
Sbjct: 64  MSVMRGGRVFEKVGVNVSTVYGTLGVPAQQAMAARGVPGIEDDPRFWASGISLVAHMQNP 123

Query: 130 HVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H PAVH N RM  T GA+WFGGG DL P +E     YD D   FH T K     H   +Y
Sbjct: 124 HCPAVHMNTRMFWTPGAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHLDPHGDEHY 178

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
              K W D YFY+PHR+ +RG+GGIF D  +S    G  +ADF+    +G  F+  +  L
Sbjct: 179 PALKAWADEYFYIPHRKRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLPAFVPL 234

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             +     FS+ D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL  W
Sbjct: 235 TEKRRTQPFSDADKDVQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLAKW 292


>gi|149913904|ref|ZP_01902436.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. AzwK-3b]
 gi|149812188|gb|EDM72019.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. AzwK-3b]
          Length = 296

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 162/300 (54%), Gaps = 17/300 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI-FTVKHWLRDKSQKEDLGG 72
           +EE++R +   F  L+  I   FE LE+       + +P   F V    R      D GG
Sbjct: 6   LEEKQRAAA-WFRQLRDEIVAAFEGLEDSHATGPMSDAPAARFEVTETKRSSDDGSDAGG 64

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVHPY 127
           G M+ +  G+VFEK  V VS VYG L    +       + G   +P FWA+G+S++ H  
Sbjct: 65  GLMSVMRGGRVFEKVGVNVSEVYGSLGAAAQQAMAARGVPGMESDPRFWASGISLVAHMQ 124

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPH PAVH N RM  T GA+WFGGG DL P LE     YD D   FH T K     H  A
Sbjct: 125 NPHCPAVHMNTRMFWTPGAWWFGGGSDLNPCLE-----YDEDTAHFHATQKAHLDPHDEA 179

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y   K W D YFY+PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+  Y 
Sbjct: 180 LYPALKAWADEYFYVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFLPAYV 235

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            LV +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL  W
Sbjct: 236 PLVEQRRVQDWSEADKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLAKW 295


>gi|254512236|ref|ZP_05124303.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           KLH11]
 gi|221535947|gb|EEE38935.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           KLH11]
          Length = 294

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 164/302 (54%), Gaps = 19/302 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDLG 71
            E  K  +   F  L+  I   FE LE ++H+    ++  P  F VK   R      D G
Sbjct: 2   FETEKATASAWFRQLRDDIVNAFEALE-DSHDTGPFSDAQPGRFEVKDTKRRSDDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTVYG L    ++       I G   +P FWA+G+S++ H
Sbjct: 61  GGLMSVMRGGRVFEKVGVNVSTVYGTLGERAQNAMAARKGIAGMKDDPRFWASGISLVAH 120

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P +E     YD D   FH T K     H 
Sbjct: 121 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDDDTAHFHATQKAHLDPHG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A+Y   K+W D YFY+PHR+ +RG+GGIF D   +    G    DF+    +G  F+  
Sbjct: 176 PAHYPRLKDWADEYFYIPHRKRARGVGGIFMDDYCT----GDWQVDFALTQDIGRAFLPA 231

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV +     F E  +  QLI RG YAE+NL+YD+GT FG +TG + +++L S+PPL 
Sbjct: 232 FVPLVEKRRVQGFDETAKNTQLIHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPPLA 291

Query: 305 AW 306
            W
Sbjct: 292 KW 293


>gi|91791399|ref|YP_561050.1| coproporphyrinogen III oxidase [Shewanella denitrificans OS217]
 gi|123357279|sp|Q12T99|HEM6_SHEDO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91713401|gb|ABE53327.1| Coproporphyrinogen oxidase [Shewanella denitrificans OS217]
          Length = 305

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 160/285 (56%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ+ IC E E+L+ EA           F  + W     Q+ + GGG    L  GK+FE+A
Sbjct: 16  LQTNICAELEQLDGEAS----------FKAESW-----QRAEGGGGTSRVLTQGKLFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
            V  S V G   P              F A G+S+++HP NP++P  H N+R  +     
Sbjct: 61  GVNFSHVKGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIASKEG 120

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + +  DV+ +H T  ++C+      Y  YK+WCD YF+L
Sbjct: 121 ADPVWWFGGGFDLTPY-----YPFKEDVLSWHQTAADLCAPFGEEVYPKYKKWCDDYFFL 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GG+FFD L+ +    G +  F+F+ AVG+ FI+ Y  +V R     F E +
Sbjct: 176 PHRNETRGVGGLFFDDLNQA----GFEQSFAFMRAVGEGFIQAYAPIVERRKALSFGEHE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|148554318|ref|YP_001261900.1| coproporphyrinogen III oxidase [Sphingomonas wittichii RW1]
 gi|148499508|gb|ABQ67762.1| Coproporphyrinogen oxidase [Sphingomonas wittichii RW1]
          Length = 286

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 128/294 (43%), Positives = 170/294 (57%), Gaps = 14/294 (4%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ ++  ++  FE+L+  IC  FE +E EA  ++       F    W RD       GGG
Sbjct: 5   LDAQQTAARAWFESLRDRICAAFEAIEAEAGSDAR------FGYTPWNRDDDPAG-AGGG 57

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNPHVP 132
            +  L  G+VFEK  V VSTV G   P+F   I G  + NP F+ATG+S++ H  +PHVP
Sbjct: 58  GVRGLMKGRVFEKVGVNVSTVGGAFQPEFAKTIHGAGEDNPGFFATGISLVAHMASPHVP 117

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R + T   WFGGG DL P +      YD D   FH  LK  C  H    Y  +K
Sbjct: 118 AVHMNTRFLTTTKRWFGGGADLNPPI-----PYDADTDAFHARLKAACDPHGADYYDRFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            W D YF++PHRQ  RG+GGIF+DHL    +  G DA F+F   VG+ F+ ++P +VR  
Sbjct: 173 AWADDYFWIPHRQVHRGVGGIFYDHLDVEDD-AGFDAHFAFTRDVGEAFLDIFPKIVRAR 231

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                S +DR+  L  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 232 MDQPASAEDRRRMLNFRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEATW 285


>gi|219848205|ref|YP_002462638.1| coproporphyrinogen III oxidase [Chloroflexus aggregans DSM 9485]
 gi|219542464|gb|ACL24202.1| Coproporphyrinogen oxidase [Chloroflexus aggregans DSM 9485]
          Length = 302

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 169/295 (57%), Gaps = 24/295 (8%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           I + + +        Q  +C  FE+++            + F  + W R        GGG
Sbjct: 3   ITDTRSLVHELMRTGQQNLCAAFEEIDGH----------QRFVAETWERPGG-----GGG 47

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               +  G VFE+A V VS VYG+  P    Q   +T+   ++ATG+S+++HP NP+VPA
Sbjct: 48  TARVMTDGAVFERAGVNVSAVYGEEVPPSIWQHRPSTRGQPYFATGISMVLHPRNPYVPA 107

Query: 134 VHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
            H N R    G  +WFGGG+DLTP+     + +  D   FH TL++ C +H++A+Y   K
Sbjct: 108 FHANFRYFEAGDDWWFGGGMDLTPN-----YGFAEDARHFHVTLRDYCGRHSIADYRTMK 162

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLH-SSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           E CDRYF+L HR E RGIGGIFFD LH   P+  G D  F+F+S      +  Y  +VRR
Sbjct: 163 ETCDRYFFLKHRNEMRGIGGIFFDDLHPDGPD--GFDRAFAFVSDGITTILDAYLPIVRR 220

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H  + E++R  QL RRGRY EFNL+YD+GT FG +TGGN+E+IL S+PPL  W
Sbjct: 221 RMHTPYGERERSWQLYRRGRYVEFNLIYDRGTLFGLQTGGNIEAILMSLPPLARW 275


>gi|83855080|ref|ZP_00948610.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
 gi|83842923|gb|EAP82090.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
          Length = 297

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 165/302 (54%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLG 71
           D E  K  +   F +L+  I   FE LE +  E   ++ +P  F V    R      D G
Sbjct: 4   DFEAEKTRAAEWFRSLRDQIVEAFETLERDHAEGPLSDAAPGTFEVTPTKRSSDDGSDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTV+G L      +   +  I G  ++P FWA+G+S++ H
Sbjct: 64  GGLMSVMRGGRVFEKVGVNVSTVFGTLGERAQVAMAARKGIPGMAEDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N R+  T  A WFGGG DL P +E     YD D   FH   K     H 
Sbjct: 124 MQNPHAPAVHMNTRLFWTPHASWFGGGSDLNPCIE-----YDEDTAHFHAVQKAHLDPHG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K W D YFY+PHR  +RG+GGIF D  H++   G  +ADF+    +G  F+  
Sbjct: 179 SDLYPRLKAWADEYFYIPHRHRARGVGGIFMDD-HAT---GDWEADFALTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV++     +SE D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 235 YLPLVQKRITQDWSEADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|254462839|ref|ZP_05076255.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           HTCC2083]
 gi|206679428|gb|EDZ43915.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 297

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 165/302 (54%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSAN-RSPKIFTVKHWLRDKSQKEDLG 71
           D++  K  + R F+ L+  I T F+ LE+       N +S   F V    R      D G
Sbjct: 4   DMQAEKVQAARWFKTLRDDIVTAFQSLEDSHSVGPMNDKSAGAFEVTKTTRHSDDGTDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDF------KDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STV+G L+P        +  I G  ++P FWA+G+S++ H
Sbjct: 64  GGEMSVMRGGRVFEKVGVNISTVFGTLAPRAQAAMAARKGIEGMAEDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P LE     Y+ D   FH T K     H 
Sbjct: 124 MQNPHCPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YEEDTEHFHKTQKVFLDPHG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
             +Y   K W D YF++PHR  +RG+GGIF D   +    G  DADF     +G  F+  
Sbjct: 179 SEHYPALKAWADEYFFIPHRGRARGVGGIFMDDRCT----GNWDADFKLTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  L+ +     +SE D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 235 YQPLIEKRRVDDWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|163848150|ref|YP_001636194.1| coproporphyrinogen III oxidase [Chloroflexus aurantiacus J-10-fl]
 gi|222526051|ref|YP_002570522.1| coproporphyrinogen III oxidase [Chloroflexus sp. Y-400-fl]
 gi|163669439|gb|ABY35805.1| Coproporphyrinogen oxidase [Chloroflexus aurantiacus J-10-fl]
 gi|222449930|gb|ACM54196.1| Coproporphyrinogen oxidase [Chloroflexus sp. Y-400-fl]
          Length = 302

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 123/295 (41%), Positives = 167/295 (56%), Gaps = 24/295 (8%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           I + + I      + Q  +C  FE+++  A           F  + W R        GGG
Sbjct: 3   ITDTRTIVHDLMRSGQQRLCAAFEEIDQHAQ----------FVAESWERPGG-----GGG 47

Query: 74  RMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
               +  G VFE+A V VS VYG ++ P        T   PYF ATG+S+++HP NP+VP
Sbjct: 48  TARVMTEGAVFERAGVNVSAVYGVEVPPSIWQHRPSTRGQPYF-ATGISMVLHPRNPYVP 106

Query: 133 AVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           A H N R    G  +WFGGG+DLTPS     + +  D   FH TL++ C++H +A+Y   
Sbjct: 107 AFHANFRYFEAGDDWWFGGGMDLTPS-----YGFAEDARHFHVTLRDYCARHPIADYREM 161

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K  CD YF+L HR E RGIGGIFFD LH + +  G +  F+F+S      +  Y  +VRR
Sbjct: 162 KATCDNYFFLKHRNEMRGIGGIFFDDLHPAGD-DGFERAFAFVSDGITTILDAYLPIVRR 220

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H  + E++R  QL RRGRY EFNL+YD+GT FG +TGGN+E+IL S+PPL  W
Sbjct: 221 RMHTPYGERERMWQLYRRGRYVEFNLIYDRGTLFGLQTGGNIEAILMSLPPLARW 275


>gi|269467897|gb|EEZ79636.1| coproporphyrinogen III oxidase [uncultured SUP05 cluster bacterium]
          Length = 302

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 160/285 (56%), Gaps = 29/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQS ICT+ E+++ +A           F   +W ++       GGG    L  G VFE+A
Sbjct: 12  LQSDICTQLEQVDGKAS----------FIKDNWKKEGGA----GGGLTRVLTDGAVFEQA 57

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA-- 145
            V  S V GD  P     +        F A G+S+++HP+NP+ P  H N+R  +     
Sbjct: 58  GVNFSLVRGDNMPASATALRPELAGRSFTALGVSLVIHPHNPYAPTSHANVRFFIAEKEG 117

Query: 146 ----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + +D D I +H T KE C       Y  YK+WCD YFYL
Sbjct: 118 EDPIWWFGGGFDLTPY-----YGFDEDAILWHQTAKEACDPFGKDVYAKYKKWCDDYFYL 172

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E RG+GG+FFD L+     GG D  F+F+ +VG+ +IK Y  +V++     + E++
Sbjct: 173 KHRDEQRGVGGLFFDDLNE----GGFDECFAFMQSVGNGYIKAYRPIVQKRKDTSYGERE 228

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 229 RQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLVRW 273


>gi|269958699|ref|YP_003328486.1| coproporphyrinogen 3 oxidase [Anaplasma centrale str. Israel]
 gi|269848528|gb|ACZ49172.1| coproporphyrinogen 3 oxidase [Anaplasma centrale str. Israel]
          Length = 275

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 172/295 (58%), Gaps = 23/295 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K      F  L+  I  +F  +E E     ++  P+I   + W R+          
Sbjct: 1   MNEKKERVAGWFHELRDRIVDQFLAIEEEF----SDSRPEI-KRRTWDREGGGGG----- 50

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-FWATGLSVIVHPYNPHVP 132
             + +  GKVFEKA V  STVYG +  +F  +I G  ++   FWA+G+SV+ H  +P VP
Sbjct: 51  -ESVVIVGKVFEKAGVNFSTVYGVMDGNFAREIPGAQESGGDFWASGISVVAHMQSPFVP 109

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPD-VIFFHNTLKEMCSQHAVANYTHY 191
           AVH N R + T   WFGGG+DLTP+       YD D    FH  ++  C +     Y  +
Sbjct: 110 AVHMNTRFMCTSKSWFGGGMDLTPTY------YDEDDKTTFHEGIRAACDKFNPEYYPKF 163

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+ CD YFYLPHR+E RG+GGIF+D+L +    G  + DF+F   VG CF+++Y ++VRR
Sbjct: 164 KQRCDEYFYLPHRKEMRGVGGIFYDNLCT----GNWEQDFAFTQEVGKCFLRVYSAIVRR 219

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           N H  +  ++R  QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 220 NMHKTWGAEERNFQLLKRGRYVEFNLIYDRGTRFGLMTNGNPDAIMMSMPPLVRW 274


>gi|157273512|gb|ABV27411.1| coproporphyrinogen III oxidase aerobic [Candidatus
           Chloracidobacterium thermophilum]
          Length = 317

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 162/283 (57%), Gaps = 23/283 (8%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F++LQ  IC   E+L+  A           F    W R+              +  G+VF
Sbjct: 27  FKDLQDEICMALEQLDGGAQ----------FREDLWEREGGGGGR-----TRVIVEGRVF 71

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EK  V  S+VYG +S     +++   +   F+ATG+S+++HP NP VP VH N R +  G
Sbjct: 72  EKGGVNFSSVYGIMSEKLAARMM-PDEGRNFYATGISLVIHPRNPMVPTVHANFRYLEQG 130

Query: 145 -AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            + WFGGG DLTP      + Y  DVI FH TLKE C +H    Y  +K+WCD YF+LPH
Sbjct: 131 NSAWFGGGADLTPY-----YPYREDVIHFHQTLKEACDKHHPDYYPRFKQWCDEYFFLPH 185

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R E+RG+ GIFFD+L +  E   ++A F+F+   G  F+  Y  +V R  H  + E +R+
Sbjct: 186 RNETRGVSGIFFDYLKAD-EHTDLEAIFAFVQTAGRAFLPAYLPIVERRQHEPYGEAERE 244

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QLIRRGRY EFNL+YD+GT FG +T G  ESIL S+PPL  W
Sbjct: 245 FQLIRRGRYVEFNLIYDRGTVFGLETRGRTESILMSLPPLAKW 287


>gi|110678607|ref|YP_681614.1| coproporphyrinogen III oxidase [Roseobacter denitrificans OCh 114]
 gi|109454723|gb|ABG30928.1| coproporphyrinogen III oxidase, aerobic [Roseobacter denitrificans
           OCh 114]
          Length = 297

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 164/302 (54%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D +  K  +   F +L+  I   FE+LE + A    ++    +F V    R      D G
Sbjct: 4   DYDTEKTRASAWFRDLRDQIVAAFEELERDHATGPLSDGEAAVFDVSETKRQSDDGSDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STVYG L    +        I G   +P FWA+G+S++ H
Sbjct: 64  GGLMSVMRGGRVFEKVGVNISTVYGTLGTRAQSAMAARKGIPGMKDDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P +E     YD D   FH   +E    H 
Sbjct: 124 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHAQQQEKLDPHG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   KEW D YFY+PHR  +RG+GGIF D  H + +    + DF+    +G  F+  
Sbjct: 179 AELYPRLKEWADEYFYIPHRNRARGVGGIFMDD-HCTNDW---ERDFALTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LVR+     +++ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 235 YVPLVRKRRTQDWTDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|255003234|ref|ZP_05278198.1| coproporphyrinogen III oxidase [Anaplasma marginale str. Puerto
           Rico]
          Length = 275

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 172/295 (58%), Gaps = 23/295 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K      F  L+  I  +F  +E E     ++  P+I   + W R+          
Sbjct: 1   MNEKKERVAGWFHELRDRIVDQFLAIEEEF----SDSRPEI-KRRTWDREGGGGG----- 50

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-FWATGLSVIVHPYNPHVP 132
             + +  GKVFEKA V  STVYG +  +F  +I G  ++   FWA+G+SV+ H  +P VP
Sbjct: 51  -ESVVIVGKVFEKAGVNFSTVYGVMDSNFACEIPGAQESGGDFWASGISVVAHMQSPFVP 109

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPD-VIFFHNTLKEMCSQHAVANYTHY 191
           AVH N R + T   WFGGG+DLTP+       YD D    FH  ++  C +     Y  +
Sbjct: 110 AVHMNTRFMCTSKSWFGGGMDLTPTY------YDEDDKTTFHEGIRAACDKFNPEYYPKF 163

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+ CD YFYLPHR+E RG+GGIF+D+L +    G  + DF+F   VG CF+++Y ++VRR
Sbjct: 164 KQRCDEYFYLPHRKEMRGVGGIFYDNLCT----GNWEQDFAFTQEVGKCFLRVYSAIVRR 219

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           N H  +  ++R  QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 220 NMHKTWGAEERNFQLLKRGRYVEFNLIYDRGTRFGLMTNGNPDAIMMSMPPLVRW 274


>gi|56416886|ref|YP_153960.1| coproporphyrinogen III oxidase [Anaplasma marginale str. St.
           Maries]
 gi|222475251|ref|YP_002563667.1| coproporphyrinogen III oxidase (hemF) [Anaplasma marginale str.
           Florida]
 gi|56388118|gb|AAV86705.1| coproporphyrinogen III oxidase [Anaplasma marginale str. St.
           Maries]
 gi|222419388|gb|ACM49411.1| coproporphyrinogen III oxidase (hemF) [Anaplasma marginale str.
           Florida]
          Length = 292

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 172/295 (58%), Gaps = 23/295 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K      F  L+  I  +F  +E E     ++  P+I   + W R+          
Sbjct: 18  MNEKKERVAGWFHELRDRIVDQFLAIEEEF----SDSRPEI-KRRTWDREGGGGG----- 67

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-FWATGLSVIVHPYNPHVP 132
             + +  GKVFEKA V  STVYG +  +F  +I G  ++   FWA+G+SV+ H  +P VP
Sbjct: 68  -ESVVIVGKVFEKAGVNFSTVYGVMDSNFACEIPGAQESGGDFWASGISVVAHMQSPFVP 126

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPD-VIFFHNTLKEMCSQHAVANYTHY 191
           AVH N R + T   WFGGG+DLTP+       YD D    FH  ++  C +     Y  +
Sbjct: 127 AVHMNTRFMCTSKSWFGGGMDLTPTY------YDEDDKTTFHEGIRAACDKFNPEYYPKF 180

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+ CD YFYLPHR+E RG+GGIF+D+L +    G  + DF+F   VG CF+++Y ++VRR
Sbjct: 181 KQRCDEYFYLPHRKEMRGVGGIFYDNLCT----GNWEQDFAFTQEVGKCFLRVYSAIVRR 236

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           N H  +  ++R  QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 237 NMHKTWGAEERNFQLLKRGRYVEFNLIYDRGTRFGLMTNGNPDAIMMSMPPLVRW 291


>gi|127514657|ref|YP_001095854.1| coproporphyrinogen III oxidase [Shewanella loihica PV-4]
 gi|126639952|gb|ABO25595.1| Coproporphyrinogen oxidase [Shewanella loihica PV-4]
          Length = 303

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 160/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+L+ EA           F    W     ++E+ GGG    L  GKVFE+
Sbjct: 14  DLQQRICEGLEQLDGEAK----------FVADSW-----EREEGGGGTSRVLTKGKVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYVPTTHANVRFFIAEKE 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV+ +H + K +C       Y  YK+WCD YF+
Sbjct: 119 GADPVWWFGGGFDLTPY-----YPFEEDVVAWHQSAKALCEPFGEDVYPKYKKWCDEYFF 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+K Y  +V +     + E+
Sbjct: 174 LPHRNETRGVGGLFFDDLNEP----GFENSFAFMQAVGEGFLKAYAPIVEKRKETAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|163745166|ref|ZP_02152526.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
 gi|161381984|gb|EDQ06393.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
          Length = 293

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 164/303 (54%), Gaps = 21/303 (6%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           D+++++K  +   F  L+  I   F  +E     E  A R    F V +  R      D 
Sbjct: 3   DNMQDQKTCAADWFRKLRDDIVQAFHDIEARHVGEEEAGR----FVVSNTTRTAPDGSDA 58

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +STVYG L      +   +  + G   +P FWA+G+S++ 
Sbjct: 59  GGGEMSVMRGGRVFEKVGVNISTVYGTLGERAQVAMAARKGLPGMADDPRFWASGISLVA 118

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPHVPAVH N RM  T  A+WFGGG DL P +E     YD D   FH  +K  C  H
Sbjct: 119 HMQNPHVPAVHMNTRMFWTPHAWWFGGGADLNPCIE-----YDEDTAHFHAEMKGACDPH 173

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y   K W D YFY+PHR+ +RG+GGIF+D  +S    G   ADF+    VG  F+ 
Sbjct: 174 GATLYDELKAWADEYFYIPHRKRARGVGGIFYDDRNS----GDWAADFALTQDVGRAFLP 229

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +     +   D+  QL  RG YAE+NL+YD+GT FG +TG + +++L S+PP+
Sbjct: 230 AYVPLVDKRREMDWDMDDKDVQLRHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPPM 289

Query: 304 VAW 306
             W
Sbjct: 290 AKW 292


>gi|262277149|ref|ZP_06054942.1| coproporphyrinogen III oxidase, aerobic [alpha proteobacterium
           HIMB114]
 gi|262224252|gb|EEY74711.1| coproporphyrinogen III oxidase, aerobic [alpha proteobacterium
           HIMB114]
          Length = 271

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 168/294 (57%), Gaps = 27/294 (9%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE++K+++   F++LQ+ +   FE L+            K F  K W R        GG
Sbjct: 4   NIEDKKKLTSNWFQDLQNQMIVSFESLDT-----------KKFEKKTWDRPGG-----GG 47

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G MA +  G+VFEK  V +S V+G  S +F+ +I GT  NP FWA G+S++ H  NP + 
Sbjct: 48  GTMAVM-KGEVFEKVGVNISVVHGKFSEEFRKKIPGTENNPNFWAAGISIVAHMKNPKIA 106

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN R I T   WFGGG DLTP++     +       FH  L+ +C +++  +Y  +K
Sbjct: 107 AAHFNTRFIATEKSWFGGGCDLTPAVPENEETKS-----FHTGLENLCKKNSY-DYPKWK 160

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIFFD+L+        + +F FI  +G  F     +   R 
Sbjct: 161 KECDEYFYLKHRKEPRGVGGIFFDYLNED----NFENEFDFIKNLGVYFKDFVHNNAERK 216

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               ++E+D ++ + +R RY EFNLLYD+GT FG KT GNVE+IL SMPP   W
Sbjct: 217 KDLSYNEEDMKKLMHKRSRYVEFNLLYDRGTLFGLKTDGNVEAILMSMPPKAEW 270


>gi|260428651|ref|ZP_05782630.1| coproporphyrinogen III oxidase, aerobic [Citreicella sp. SE45]
 gi|260423143|gb|EEX16394.1| coproporphyrinogen III oxidase, aerobic [Citreicella sp. SE45]
          Length = 298

 Score =  221 bits (564), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 158/302 (52%), Gaps = 16/302 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDL 70
           D   ERK  +   F +L+  I   FE LE    E   ++ +P  F V    R      D 
Sbjct: 5   DAFAERKSRASAWFRSLRDEIVAAFEGLEASHAEGPFSDMAPGSFEVTPTTRTADDGSDA 64

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S++ H
Sbjct: 65  GGGLMSVMRGGRVFEKVGVNVSTVYGTLGEAAQKSMAARGVPGIEADPRFWASGISLVAH 124

Query: 126 PYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P LE     YD D   FH   +     H 
Sbjct: 125 MQNPHVPAVHMNTRMFWTPNAWWFGGGSDLNPCLE-----YDEDTAHFHAMQQAHLDPHD 179

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A Y   K W D YFY+PHR   RG+GGIF D  ++    G  +ADF+    +G  F+  
Sbjct: 180 PALYPALKAWADEYFYIPHRARGRGVGGIFMDDRNT----GDWEADFALTQDIGRAFLPA 235

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV       F   ++  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL 
Sbjct: 236 WVPLVESRRTLRFGTAEKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLA 295

Query: 305 AW 306
            W
Sbjct: 296 KW 297


>gi|119384489|ref|YP_915545.1| coproporphyrinogen III oxidase [Paracoccus denitrificans PD1222]
 gi|119374256|gb|ABL69849.1| Coproporphyrinogen oxidase [Paracoccus denitrificans PD1222]
          Length = 286

 Score =  221 bits (564), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 115/300 (38%), Positives = 166/300 (55%), Gaps = 22/300 (7%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           ++++ ++ +   F  L+  I   FE LE+          P  F +    R+  + ED GG
Sbjct: 2   EMQDERQEAAAWFRALRDRIVAAFEALEDR---GPGAVPPGRFEI----RETRRGEDGGG 54

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVHPY 127
           G M+ +  G+VFEK  V  S V+G LS   +       + G   +P FWA+G+S++ H  
Sbjct: 55  GLMSVMRGGRVFEKVGVNWSAVHGQLSAAARQAMAARGVPGIEADPRFWASGISLVAHMQ 114

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPH PAVH N RM  T GA+WFGGG DL P LE        D   FH TL+  C+ H   
Sbjct: 115 NPHAPAVHMNTRMFWTPGAWWFGGGADLNPCLERAE-----DTAHFHATLRAACAPHGAD 169

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  ++ W D YF++PHR  +RG+GGIF+D L++    G   ADF+F  AVG+ F+  + 
Sbjct: 170 YYDRFRAWADEYFFVPHRGRARGVGGIFYDDLNT----GDWRADFAFTKAVGEAFLPAFL 225

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L        + E ++  QL+ RG YAE+NL+YD+GT FG  TG + E++L S+PP+  W
Sbjct: 226 PLAETRMAEPWGEAEKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDPEAVLMSLPPMAKW 285


>gi|86139105|ref|ZP_01057676.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
 gi|85824336|gb|EAQ44540.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
          Length = 297

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 159/302 (52%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLG 71
           D+   K  +   F  L+  I   FE LE+   +   A   P  F V    R      D G
Sbjct: 4   DMSTEKAQAAAWFRTLRDEIVAAFEALEDRHDQGPFAELEPGRFEVTQTKRAAEDGSDAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL------GTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +S VYG L    ++ +       G  ++P FWA+G+S++ H
Sbjct: 64  GGLMSVMRGGRVFEKVGVNISEVYGTLGERAQNAMAARKGLPGMKEDPRFWASGISLVAH 123

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P LE     YD D   FH T K     + 
Sbjct: 124 MRNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDEDTAHFHATQKAHLDPYG 178

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K+W D YFY+PHR  +RG+GGIF D  +S    G    DF+    +G  F+  
Sbjct: 179 ADLYPRLKDWADEYFYIPHRNRARGVGGIFMDDHNS----GDWATDFALTQDIGRAFLPA 234

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV +     FSE D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+ 
Sbjct: 235 YLPLVDKRRVQDFSEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPMA 294

Query: 305 AW 306
            W
Sbjct: 295 KW 296


>gi|58584966|ref|YP_198539.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
 gi|58419282|gb|AAW71297.1| Coproporphyrinogen III oxidase [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
          Length = 274

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/237 (44%), Positives = 153/237 (64%), Gaps = 10/237 (4%)

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNP 129
           GGG  +T+  G VFEK  V +S VYG  +    ++I G ++ N  FWA+G+S++ H  +P
Sbjct: 46  GGGGESTIIYGDVFEKVGVNISKVYGKFADSVVNEIPGASESNGEFWASGISLVSHMQSP 105

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            VPA H N R+I T   WFGGG+D TP+ ++     + D  + H ++K  C +     Y 
Sbjct: 106 LVPAAHMNTRLIYTSKQWFGGGMDFTPTYKN-----EEDYKYIHESIKTTCDKFDAEYYL 160

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KE CD YF+L HR+E RGIGGIF+D+L+S    G  + DF F  AVG+ F+K+Y  ++
Sbjct: 161 KFKEQCDNYFFLQHRKEPRGIGGIFYDNLNS----GRWENDFEFTKAVGETFLKIYLHII 216

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R++    ++++ R+ QLI+RGRY EFNLLYD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 217 RQHMRKPWTKEQRETQLIKRGRYVEFNLLYDRGTKFGLMTDGNPDAIMMSMPPLVKW 273


>gi|163737213|ref|ZP_02144631.1| Coproporphyrinogen oxidase [Phaeobacter gallaeciensis BS107]
 gi|161389817|gb|EDQ14168.1| coproporphyrinogen 3 oxidase, aerobic [Phaeobacter gallaeciensis
           BS107]
          Length = 297

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 168/303 (55%), Gaps = 19/303 (6%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDL 70
           D+ ++K  +   F++L+  I   FE LE+ +H+    ++++   F +    R      D 
Sbjct: 4   DMIDQKARAAAWFKSLRDDIVAAFEALED-SHDTGPFSDQTAGRFEISETKRTAEDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +S VYG L    +        I G   +P FWA+G+S++ 
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNISEVYGTLGARAQSAMAARKGIPGMQDDPRFWASGISLVA 122

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T  A+WFGGG DL P +E     YD D   FH T ++  + H
Sbjct: 123 HMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHRTQEQHLAPH 177

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y   KEW D YFY+PHR  +RG+GGIF D  +S    G  +ADF+    +G  F+ 
Sbjct: 178 GDTLYGQLKEWADEYFYIPHRNRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLP 233

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +    +F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+
Sbjct: 234 AYLPLVEKRRPMVFGAAEKDIQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPM 293

Query: 304 VAW 306
             W
Sbjct: 294 AKW 296


>gi|163740376|ref|ZP_02147770.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
 gi|161386234|gb|EDQ10609.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
          Length = 297

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 168/303 (55%), Gaps = 19/303 (6%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDL 70
           D+ ++K  +   F++L+  I   FE LE+ +H+    ++++   F +    R      D 
Sbjct: 4   DMIDQKARAAAWFKSLRDDIVAAFEALED-SHDTGPFSDQTAGRFEISETKRTAEDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +S VYG L    +        I G   +P FWA+G+S++ 
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNISEVYGTLGARAQSAMAARKGIPGMQDDPRFWASGISLVA 122

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T  A+WFGGG DL P +E     YD D   FH T ++  + H
Sbjct: 123 HMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHRTQEQHLAPH 177

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y   KEW D YFY+PHR  +RG+GGIF D  +S    G  +ADF+    +G  F+ 
Sbjct: 178 GDTLYGELKEWADEYFYIPHRNRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLP 233

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +    +F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+
Sbjct: 234 AYLPLVEKRRPMVFGAAEKDIQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPM 293

Query: 304 VAW 306
             W
Sbjct: 294 AKW 296


>gi|167621975|ref|YP_001672269.1| coproporphyrinogen III oxidase [Shewanella halifaxensis HAW-EB4]
 gi|189028106|sp|B0TLD7|HEM6_SHEHH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167351997|gb|ABZ74610.1| Coproporphyrinogen oxidase [Shewanella halifaxensis HAW-EB4]
          Length = 304

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E L+  A                +  D  ++E+ GGG+   L  G VFE+
Sbjct: 15  DLQHRICNGLEALDGSAK---------------FAEDAWKREEGGGGQSRVLTGGTVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NPH+P  H N+R  +    
Sbjct: 60  AGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPNNPHIPTTHANVRFFIAHKD 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + Y  DV+ +H + K +C       Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTP-----YYPYLEDVVEWHQSAKSLCEPFGDEIYPEYKQWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  F+F+ AVG+ F+  Y  +V R    ++ E 
Sbjct: 175 LPHRNETRGVGGLFFDDLNKQ----GFDTSFAFMQAVGNGFLTAYAPIVERRKDTVYGEH 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|170724415|ref|YP_001758441.1| coproporphyrinogen III oxidase [Shewanella woodyi ATCC 51908]
 gi|226740902|sp|B1KCX1|HEM6_SHEWM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|169809762|gb|ACA84346.1| Coproporphyrinogen oxidase [Shewanella woodyi ATCC 51908]
          Length = 306

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 120/286 (41%), Positives = 160/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+L+ EA           F    W     ++E+ GGG    L  GKVFE+
Sbjct: 15  DLQQRICDGLEQLDGEAK----------FKADSW-----KREEGGGGTSRVLTQGKVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAKKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + +  DVI +H    ++C       Y  YK+WCD YFY
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFKEDVIEWHQNAHDLCLPFGEEVYPKYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L++     G D  F+F+ AVG+ F+  Y  +V+R     + E+
Sbjct: 175 LPHRDETRGVGGLFFDDLNAE----GFDTSFAFMQAVGNGFLTAYAPIVQRRKETQYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 EREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|89074768|ref|ZP_01161226.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
 gi|89049532|gb|EAR55093.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
          Length = 302

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 164/286 (57%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ E               T   + +D+ Q+E+ GGGR   L  G++FE+
Sbjct: 16  DLQDRICQALEQQE---------------TTVAFEQDQWQREEGGGGRSRVLRDGEIFEQ 60

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S VYG   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 61  AGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVPTSHANVRFFIAEKD 120

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 121 GEAPVWWFGGGFDLTPF-----YPFEEDCQHWHDTAKQLCAPFGDDVYQEHKAWCDKYFF 175

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  F+++ AVG+ FI  Y  +V++ YH  + E+
Sbjct: 176 LPHRNETRGVGGLFFDDLNQW----GFDKSFAYMQAVGNGFINAYMPIVKQRYHLSYGER 231

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPLV W
Sbjct: 232 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLVRW 277


>gi|57239183|ref|YP_180319.1| coproporphyrinogen III oxidase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579141|ref|YP_197353.1| coproporphyrinogen III oxidase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161262|emb|CAH58183.1| coproporphyrinogen III oxidase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417767|emb|CAI26971.1| Coproporphyrinogen III oxidase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 288

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 182/304 (59%), Gaps = 33/304 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++++++++   F+ LQ+ + + F  +E    E  ++  P++   K W R +      GGG
Sbjct: 6   MKDKQKMAVNWFKELQNKLLSAFLSVE----EKFSSSVPEV-QYKDWTRSE------GGG 54

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGT----------TKNPYFWATGLSVI 123
             + +  G VFEKA + VS VYG+++ +   ++L             +   FWA+G+SV+
Sbjct: 55  GHSIILQGNVFEKAGINVSEVYGNITQN--SELLSVMNSHKFNASYVEGTEFWASGISVV 112

Query: 124 VHPYNPHVPAVHFNIRMI-VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  +P VPAVH N R I +    WFGGGIDLTP+ E++      D  FFH  L+ MC +
Sbjct: 113 AHMCSPFVPAVHMNTRFISICDKNWFGGGIDLTPTYENKE-----DEEFFHANLRTMCDR 167

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K+ CD YF+L HR+E RGIGGIF+D+++S    G  ++DF +   VG   +
Sbjct: 168 HNQKYYPKFKQQCDEYFFLHHRKEPRGIGGIFYDNINS----GDWESDFYYTKEVGKFLL 223

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
            +YP +V RN +  +S+ +R+ QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPP
Sbjct: 224 DIYPVIVMRNMYKSWSQDEREYQLLKRGRYVEFNLIYDRGTRFGLLTNGNPDAIMMSMPP 283

Query: 303 LVAW 306
           +V W
Sbjct: 284 VVKW 287


>gi|58617194|ref|YP_196393.1| coproporphyrinogen III oxidase [Ehrlichia ruminantium str. Gardel]
 gi|58416806|emb|CAI27919.1| Coproporphyrinogen III oxidase [Ehrlichia ruminantium str. Gardel]
          Length = 288

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 181/304 (59%), Gaps = 33/304 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +++++ ++   F+ LQ+ + + F  +E    E  ++  P++   K W R +      GGG
Sbjct: 6   MKDKQNMAVNWFKELQNKLLSAFLSVE----EKFSSSVPEV-QYKDWTRSE------GGG 54

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGT----------TKNPYFWATGLSVI 123
             + +  G VFEKA + VS VYG+++ +   ++L             +   FWA+G+SV+
Sbjct: 55  GHSIILQGNVFEKAGINVSEVYGNITQN--SELLSVMNSHKFNTSYVEGTEFWASGISVV 112

Query: 124 VHPYNPHVPAVHFNIRMI-VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  +P VPAVH N R I V    WFGGGIDLTP+ E++      D  FFH  L+ MC +
Sbjct: 113 AHMCSPFVPAVHMNTRFISVCDKSWFGGGIDLTPTYENKE-----DEEFFHANLRTMCDR 167

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K+ CD YF+L HR+E RGIGGIF+D+++S    G  ++DF +   VG   +
Sbjct: 168 HNQKYYPKFKQQCDEYFFLHHRKEPRGIGGIFYDNINS----GDWESDFYYTKEVGKFLL 223

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
            +YP +V RN +  +S+ +R+ QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPP
Sbjct: 224 DIYPVIVMRNMYKSWSQDEREYQLLKRGRYVEFNLIYDRGTRFGLLTNGNPDAIMMSMPP 283

Query: 303 LVAW 306
           +V W
Sbjct: 284 VVKW 287


>gi|212632973|ref|YP_002309498.1| coproporphyrinogen III oxidase [Shewanella piezotolerans WP3]
 gi|226740901|sp|B8CHB9|HEM6_SHEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|212554457|gb|ACJ26911.1| Coproporphyrinogen III oxidase, aerobic [Shewanella piezotolerans
           WP3]
          Length = 304

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 154/285 (54%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ+ IC   E L+                V  +  D  ++E+ GGG+   L  GKVFE+A
Sbjct: 16  LQNNICNGLEALDG---------------VASFKEDSWKREEGGGGQSRVLTGGKVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA-- 145
            V  S V G   P              F A G+S+++HP NPH+P  H N+R  +     
Sbjct: 61  GVNFSHVMGASMPASATAHRPELAGRNFEAMGVSLVIHPNNPHIPTTHANVRFFIAHKEG 120

Query: 146 ----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + Y  DV+ +H + K +C       Y  YK+WCD YF+L
Sbjct: 121 TDPIWWFGGGFDLTP-----YYPYLEDVVSWHQSAKALCEPFGDETYPKYKKWCDEYFWL 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GG+FFD L+      G D  F F+ AVG+ F+  Y  +V R     + E +
Sbjct: 176 PHRNETRGVGGLFFDDLNKQ----GFDKSFDFMQAVGNGFLTAYAPIVERRKETEYGEHE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|254487459|ref|ZP_05100664.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. GAI101]
 gi|214044328|gb|EEB84966.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. GAI101]
          Length = 297

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 158/290 (54%), Gaps = 17/290 (5%)

Query: 25  FENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           F  L+  I + FE LEN       A+ +P  F V    R      D GGG M+ +  G+V
Sbjct: 16  FRELRDQIVSAFEGLENNHVSGPMADAAPGAFEVTKTTRTSEDGSDAGGGLMSVMRGGRV 75

Query: 84  FEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           FEK  V +STVYG L      +   +  I G   +P FWA+G+S++ H  NPH PAVH N
Sbjct: 76  FEKVGVNISTVYGTLGERAQHAMAARKGIPGMKDDPRFWASGISLVAHMQNPHAPAVHMN 135

Query: 138 IRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            RM  T  A+WFGGG DL P +E     Y  D   FH+  K     H  A Y   K W D
Sbjct: 136 TRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHDQQKAHLDPHGDAFYPKLKAWAD 190

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFY+PHR  +RG+GGIF D  H +   G  +ADF+    +G  F+  Y  LV +     
Sbjct: 191 EYFYIPHRNRARGVGGIFMDD-HCT---GDWEADFALTHDIGRAFLPAYLPLVEKRKAQD 246

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           ++E D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  W
Sbjct: 247 WNEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAKW 296


>gi|319424447|gb|ADV52521.1| Coproporphyrinogen oxidase [Shewanella putrefaciens 200]
          Length = 302

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 120/286 (41%), Positives = 160/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           FT   W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQA----------TFTADSWTRAEG-----GGGTSKVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVLHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKETGFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|90581184|ref|ZP_01236983.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
 gi|90437705|gb|EAS62897.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
          Length = 302

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 162/286 (56%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ E               T   + +D+ Q+E+ GGG    L  G++FE+
Sbjct: 16  DLQDRICQALEQQE---------------TTVAFEQDQWQREEGGGGSSRVLRGGEIFEQ 60

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S VYG   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 61  AGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVPTSHANVRFFIAEKD 120

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 121 GEAPVWWFGGGFDLTPF-----YPFDEDCQHWHDTAKQLCAPFGDDVYQEHKAWCDKYFF 175

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  FS++ AVG+ FI  Y  +V++ YH  + E+
Sbjct: 176 LPHRNETRGVGGLFFDDLNQW----GFDKSFSYMQAVGNGFINAYMPIVQQRYHLPYGER 231

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 232 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 277


>gi|217971253|ref|YP_002356004.1| coproporphyrinogen III oxidase [Shewanella baltica OS223]
 gi|254800277|sp|B8E3K7|HEM6_SHEB2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|217496388|gb|ACK44581.1| Coproporphyrinogen oxidase [Shewanella baltica OS223]
          Length = 302

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 120/286 (41%), Positives = 158/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQAR----------FAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQE----GFDQSFSFMQAVGNGFLTAYAPIVERRKDTEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|148244605|ref|YP_001219299.1| coproporphyrinogen III oxidase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326432|dbj|BAF61575.1| coproporphyrinogen III oxidase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 308

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 160/291 (54%), Gaps = 29/291 (9%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           Q+    LQS IC +FE+L+ +            F    W     +  + G G    L  G
Sbjct: 6   QKYLLMLQSDICEQFEQLDGKVK----------FIKDAW----KKPNNTGNGLTRILVNG 51

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            VFE+A V  S +  +  P    ++        F A G+S+++HP+NP+VP  H N+R  
Sbjct: 52  AVFEQAGVNFSIIRSNDMPASATELRPELAGRSFTALGVSLVIHPHNPYVPTSHANVRFF 111

Query: 142 VTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG DLTP      + +D D IF+H + K+ C       Y  YK+WC
Sbjct: 112 IAKKKGKIPIWWFGGGFDLTPY-----YGFDEDAIFWHQSAKQACDLFGKDVYLKYKKWC 166

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E RGIGG+FFD L+     GG D  F+F+ +VGD +IK Y  +V R    
Sbjct: 167 DDYFYLKHRNEQRGIGGLFFDDLNE----GGFDKCFAFMRSVGDGYIKAYQPIVERRKDT 222

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +++ +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 SYTDHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSIPPLVRW 273


>gi|157959868|ref|YP_001499902.1| coproporphyrinogen III oxidase [Shewanella pealeana ATCC 700345]
 gi|189028107|sp|A8GYI0|HEM6_SHEPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157844868|gb|ABV85367.1| Coproporphyrinogen oxidase [Shewanella pealeana ATCC 700345]
          Length = 304

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   E L+  A                +  D  ++E+ GGG+   L  G VFE+
Sbjct: 15  DLQNRICNGLEALDGAAQ---------------FAEDSWKREEGGGGQSRVLTGGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NPH+P  H N+R  +    
Sbjct: 60  AGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPKNPHIPTTHANVRFFIAHKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + Y  DV+ +H + K +C       Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPYLEDVVEWHQSAKSLCEPFGEEVYPKYKQWCDEYFW 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+  Y  +V R     + E 
Sbjct: 175 LPHRNETRGVGGLFFDDLNKQ----GFEQSFAFMQAVGNGFLTAYAPIVERRRDTEYGEH 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|255262623|ref|ZP_05341965.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
 gi|255104958|gb|EET47632.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
          Length = 297

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 163/303 (53%), Gaps = 17/303 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSP-KIFTVKHWLRDKSQKEDL 70
           D + + K  + + F  L+  I   F + EN          P   F V    R      D 
Sbjct: 3   DMLSDNKARAAQWFRELRDQIVARFVEFENTQVAGPFVDQPVGAFEVTATTRTSDDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDF------KDQILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +STVYG L+P        +  I G   +P FWA+G+S++ 
Sbjct: 63  GGGEMSVMRGGRVFEKVGVNISTVYGTLAPRAQAAMAARKGIPGMVDDPRFWASGISLVA 122

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPHVPAVH N RM  T  A+WFGGG DL P LE     YD D   FH T KE    H
Sbjct: 123 HMQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDDDTAHFHATQKEHLDPH 177

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y   KEW D YFY+ HR  +RG+GGIF D  H +   G  +ADF+    +G  F+ 
Sbjct: 178 GADLYPRLKEWADEYFYILHRHRARGVGGIFMDD-HCT---GDWEADFALTQDIGRAFLP 233

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV +  +  + ++++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL
Sbjct: 234 AYAPLVEKRRNDPWGDEEKHAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPL 293

Query: 304 VAW 306
             W
Sbjct: 294 AKW 296


>gi|160873163|ref|YP_001552479.1| coproporphyrinogen III oxidase [Shewanella baltica OS195]
 gi|160858685|gb|ABX47219.1| Coproporphyrinogen oxidase [Shewanella baltica OS195]
          Length = 323

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 159/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 36  DLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQGAVFEQ 80

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 81  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 140

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 141 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 195

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 196 LPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGER 251

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 252 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 297


>gi|84516583|ref|ZP_01003942.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
 gi|84509619|gb|EAQ06077.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
          Length = 292

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 159/301 (52%), Gaps = 18/301 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           ++   +K  +   F  L+  I   FE LE+    ++A+     F V    R      D G
Sbjct: 3   EEFATQKAKASAWFRALRDDIVAAFEALEDS---HTADTPAGRFEVTETSRHSDDGSDAG 59

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVHP 126
           GG M+ +  G+VFEK  V +STVYG L    +  +      G   +P FWA+G+S++ H 
Sbjct: 60  GGLMSVMRGGRVFEKVGVNISTVYGQLGDGAQRAMAARGVPGMADDPRFWASGISLVAHM 119

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH PAVH N RM  T  A+WFGGG DL P +E     Y  D   FH T K     H +
Sbjct: 120 QNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHATQKAHLDPHGL 174

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
            +Y   K W D YFY+PHR  +RG+GGIF D   +    G  DADF+    +G  F+  Y
Sbjct: 175 DHYPKLKAWADEYFYIPHRNRARGVGGIFMDDYCT----GDWDADFTLTQDIGRAFLPAY 230

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV       +++ D+  QLI RG YAE+NL+YD+GT FG  TG +  ++L S+PPL  
Sbjct: 231 VPLVETRRETPWTDADKDTQLIHRGLYAEYNLVYDRGTKFGLTTGHDANAVLMSLPPLAK 290

Query: 306 W 306
           W
Sbjct: 291 W 291


>gi|126172294|ref|YP_001048443.1| coproporphyrinogen III oxidase [Shewanella baltica OS155]
 gi|152998588|ref|YP_001364269.1| coproporphyrinogen III oxidase [Shewanella baltica OS185]
 gi|166217816|sp|A3CYL1|HEM6_SHEB5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217817|sp|A6WHB7|HEM6_SHEB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|125995499|gb|ABN59574.1| Coproporphyrinogen oxidase [Shewanella baltica OS155]
 gi|151363206|gb|ABS06206.1| Coproporphyrinogen oxidase [Shewanella baltica OS185]
          Length = 302

 Score =  218 bits (555), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 159/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQAR----------FAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|114561218|ref|YP_748731.1| coproporphyrinogen III oxidase [Shewanella frigidimarina NCIMB 400]
 gi|114332511|gb|ABI69893.1| Coproporphyrinogen oxidase [Shewanella frigidimarina NCIMB 400]
          Length = 310

 Score =  218 bits (555), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 157/285 (55%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E L+ +A           F    W     ++E+ GGG    L  G+VFE+A
Sbjct: 21  LQQNICQRLELLDGKA----------TFKADSW-----EREEGGGGTSRVLTQGQVFEQA 65

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---G 144
            V  S V G   P              F A G+S+++HP NP +P  H N+R  +    G
Sbjct: 66  GVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPFIPTTHANVRFFIARKEG 125

Query: 145 A---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           A   +WFGGG DLTP      + +  DV+ +H T K++C       Y  YK+WCD YF+L
Sbjct: 126 ADPVWWFGGGFDLTPY-----YPFKEDVVSWHQTAKDICDPFGEDVYPKYKKWCDEYFFL 180

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GG+FFD L+      G +  F F+ AVG+ FI+ Y  +V RN    + + +
Sbjct: 181 PHRNETRGVGGLFFDDLNEP----GFERSFEFMQAVGNGFIEAYAPIVERNKELEYGDDE 236

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 237 RQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 281


>gi|304412741|ref|ZP_07394344.1| Coproporphyrinogen oxidase [Shewanella baltica OS183]
 gi|307305794|ref|ZP_07585540.1| Coproporphyrinogen oxidase [Shewanella baltica BA175]
 gi|304348951|gb|EFM13366.1| Coproporphyrinogen oxidase [Shewanella baltica OS183]
 gi|306911287|gb|EFN41713.1| Coproporphyrinogen oxidase [Shewanella baltica BA175]
          Length = 302

 Score =  218 bits (555), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 159/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|315265388|gb|ADT92241.1| Coproporphyrinogen oxidase [Shewanella baltica OS678]
          Length = 302

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 159/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|120596863|ref|YP_961437.1| coproporphyrinogen III oxidase [Shewanella sp. W3-18-1]
 gi|146291141|ref|YP_001181565.1| coproporphyrinogen III oxidase [Shewanella putrefaciens CN-32]
 gi|166217818|sp|A4Y1D3|HEM6_SHEPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217820|sp|A1RDY8|HEM6_SHESW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|120556956|gb|ABM22883.1| Coproporphyrinogen oxidase [Shewanella sp. W3-18-1]
 gi|145562831|gb|ABP73766.1| Coproporphyrinogen oxidase [Shewanella putrefaciens CN-32]
          Length = 302

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 158/286 (55%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   + L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIAQKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K++C+      Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  FSF+ AVG+ F+  Y  +V R     F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQD----GFEQSFSFMQAVGNGFLTAYAPIVERRKETEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|255263112|ref|ZP_05342454.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
 gi|255105447|gb|EET48121.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
          Length = 296

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 153/289 (52%), Gaps = 16/289 (5%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           FE L+  I T FE+LE+   +      P   F      R      D GGG M+ +  G+V
Sbjct: 16  FETLRDEIVTAFERLEDTQTDGPTAHLPAGRFEQTATTRSSDNGADAGGGLMSVMRGGRV 75

Query: 84  FEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
           FEK  V  STVYG L    +  +      G   +P FWA+G+S++ H  NPHVPAVH N 
Sbjct: 76  FEKVGVNTSTVYGQLGESAQKAMAARGVPGMAVDPRFWASGISLVAHVQNPHVPAVHMNT 135

Query: 139 RMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
           RM  T  A+WFGGG DL P +E     YD D   FH   K    +H  A+Y   K W D 
Sbjct: 136 RMFWTPHAWWFGGGSDLNPCIE-----YDDDTAHFHAVQKRHLDRHDTAHYPKLKAWADE 190

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFY+PHR  +RG+GGIF D   +    G    DF+    +G  F+  Y  LV       +
Sbjct: 191 YFYIPHRNRARGVGGIFMDDYCT----GDWATDFALTQDIGCAFLPAYVPLVENRRTLGW 246

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           S+ D+  QLI RG YAE+NL+YD+GT FG  TG +  ++L S+PP+  W
Sbjct: 247 SDADKDTQLIHRGLYAEYNLVYDRGTKFGLTTGHDANAVLMSLPPMAKW 295


>gi|189184685|ref|YP_001938470.1| coproporphyrinogen III oxidase [Orientia tsutsugamushi str. Ikeda]
 gi|189181456|dbj|BAG41236.1| coproporphyrinogen III oxidase precursor [Orientia tsutsugamushi
           str. Ikeda]
          Length = 278

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 169/298 (56%), Gaps = 25/298 (8%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE +++  Q  F+ L+  +   FE +E     +   +  K F+   W R        GGG
Sbjct: 2   IEYQEKCYQW-FKELRDELIKAFELIEQHYASSKKVKVAK-FSQSQWSRAG------GGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              ++  G VF K  V +S VYGD+     D I  T  +  F+ATG+SV+ H  +P VPA
Sbjct: 54  GEMSIMRGNVFAKVGVNISKVYGDMPIALCDIIPCTNYSSNFFATGISVVAHMKSPLVPA 113

Query: 134 VHFNIRMIVTGAYWFGGGIDLTP----SLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           VHFN R + T  YWFGGG DLTP     LE+++         FH   + +C ++  + Y 
Sbjct: 114 VHFNTRYLETNNYWFGGGSDLTPLYPDKLETKK---------FHQAFQVVCDKYNPSYYE 164

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K  CD YFYLPHR+E RG+GG+F+D+L+S       D DF+F  ++G+ F+ +YP +V
Sbjct: 165 KFKAECDNYFYLPHRKEVRGVGGVFYDYLNSK----NFDIDFNFTKSIGEAFLAIYPDIV 220

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +      +S    +  L++RGRY EFNLLYD+GT FG  T GNV++IL S+PP V WP
Sbjct: 221 KSKMFLPWSNSQYEALLVKRGRYVEFNLLYDRGTKFGLMTDGNVDAILMSLPPEVKWP 278


>gi|254474344|ref|ZP_05087730.1| coproporphyrinogen III oxidase, aerobic [Ruegeria sp. R11]
 gi|214028587|gb|EEB69422.1| coproporphyrinogen III oxidase, aerobic [Ruegeria sp. R11]
          Length = 293

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 162/301 (53%), Gaps = 18/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLGG 72
           I+E+ R +   F++L+  I   FE LE+       +  P   F V    R      D GG
Sbjct: 2   IDEKARAAAW-FKSLRDSIVAAFEGLEDSHDTGPFSDQPAGRFDVSETKRTAEDGSDAGG 60

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDL------SPDFKDQILGTTKNPYFWATGLSVIVHP 126
           G M+ +  G+VFEK  V +S VYG L      +   +  I G   +P FWA+G+S++ H 
Sbjct: 61  GLMSVMRGGRVFEKVGVNISEVYGTLGERAQHAMAARKGIPGMKDDPRFWASGISLVAHM 120

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPHVPAVH N RM  T  A+WFGGG DL P LE     YD D   FH+  K     H  
Sbjct: 121 QNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDEDTAHFHHVQKRHLGPHGE 175

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y   K W D YFY+PHR+ +RG+GGIF D  +S    G  +ADF+    +G  F+  Y
Sbjct: 176 DLYPRLKAWADDYFYIPHRKRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLPAY 231

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV +     F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  
Sbjct: 232 LPLVEQRRTLAFGAAEKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAK 291

Query: 306 W 306
           W
Sbjct: 292 W 292


>gi|149201111|ref|ZP_01878086.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
 gi|149145444|gb|EDM33470.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
          Length = 296

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 160/302 (52%), Gaps = 16/302 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           D+  ++K  +   F  L+  I T FE LE N A    ++ +P  F V    R      D 
Sbjct: 3   DEFTQQKSRAAAWFRQLRDDIVTAFEGLEDNHATGPLSDAAPARFEVSDTSRHSDDGSDA 62

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIVH 125
           GGG M+ +  G+VFEK  V VS VYG L    +  +      G   +P FWA+G+S++ H
Sbjct: 63  GGGLMSVMRGGRVFEKVGVNVSEVYGTLGEAAQRAMAARGVPGMDSDPRFWASGISLVAH 122

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPH PAVH N RM  T  A+WFGGG DL P +E     Y  D   FH   +     H 
Sbjct: 123 MQNPHCPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHGQQRAHLDPHG 177

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K W D YF++PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+  
Sbjct: 178 ADLYPKLKAWADEYFFVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFLPA 233

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV +     +S+ D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL 
Sbjct: 234 YVPLVEKRRVQPWSDADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLA 293

Query: 305 AW 306
            W
Sbjct: 294 KW 295


>gi|89069763|ref|ZP_01157099.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
 gi|89044709|gb|EAR50820.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
          Length = 296

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 166/301 (55%), Gaps = 18/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKEDLG 71
           ++  K  +   F  L+  I   FE LE ++H +   + R+   F ++  +R      + G
Sbjct: 5   MQSEKARAAAWFRTLRDEIVAAFEALE-QSHTDGPLSERAAGRFELRETVRRADDGSEAG 63

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVHP 126
           GG M+ L  G+VFEK  V VSTV+G L    +       + G   +P FWA+G+S++ H 
Sbjct: 64  GGLMSVLREGRVFEKVGVNVSTVHGTLGAAAQGAMAARGVPGIEDDPSFWASGISLVAHM 123

Query: 127 YNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH PAVH N RM  T GA+WFGGG DL P+L       + D   FH  L+   + H  
Sbjct: 124 QNPHAPAVHMNTRMFWTPGAWWFGGGADLNPAL-----PVEADTEHFHAELERHVAPHGE 178

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y   K W D YF++PHR  +RG+GGIF D  +S    G  +ADF+ +  +G  F+  +
Sbjct: 179 GLYPELKAWADEYFFIPHRGRARGVGGIFMDDRNS----GDWEADFALVQDIGRAFLPAF 234

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             L  R     F++ DR+ QLI RG YAE+NL+YD+GT FG  TG + +++L S+PPL  
Sbjct: 235 LPLAERRRATPFTDADREAQLIHRGLYAEYNLVYDRGTKFGLATGHDPDAVLMSLPPLAK 294

Query: 306 W 306
           W
Sbjct: 295 W 295


>gi|310815395|ref|YP_003963359.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
 gi|308754130|gb|ADO42059.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
          Length = 301

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 160/300 (53%), Gaps = 16/300 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +EE ++ +   F +L+  I T FE  E  +    +A+  P  F V    R     EDLGG
Sbjct: 10  MEEERKTAADWFRSLRDEIVTAFEAAEHGDLAGPTADLPPARFEVTPTPRHGENGEDLGG 69

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDF-----KDQILGTTKNPYFWATGLSVIVHPY 127
           G M+ +  G+VFEK  V  S V G L         +  + G   +P FWA G+S++ H  
Sbjct: 70  GIMSVMRGGRVFEKVGVNFSAVEGTLGEGAIRSMAQRGVPGIEADPRFWAAGISLVAHMQ 129

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPHVPAVH N RM  T  A+WFGGG DL P +      Y  D   FH T +   + H   
Sbjct: 130 NPHVPAVHMNTRMFWTPSAWWFGGGADLNPPI-----PYAEDTAHFHATQESFIAPHGEG 184

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y   K W D YF++PHR  +RG+GG F D  ++    G   ADF+    +G  F+  Y 
Sbjct: 185 LYPQLKAWADEYFFIPHRGRARGVGGTFMDDRNT----GDWAADFALTRDIGRAFLPSYL 240

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L+ R  +  ++E DR  QLI RG YAE+NL++D+GT FG  TG N +++L S+PPL  W
Sbjct: 241 PLIERRRNTPWTEADRDTQLIYRGLYAEYNLVWDRGTKFGLATGHNADAVLMSLPPLAKW 300


>gi|85704463|ref|ZP_01035565.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
 gi|85670871|gb|EAQ25730.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
          Length = 296

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 162/303 (53%), Gaps = 18/303 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENS--ANRSPKIFTVKHWLRDKSQKED 69
           D+  ++K  +   F  L+  I   FE LE ++H N   ++ +P  F V    R      D
Sbjct: 3   DEFTQQKTRAAAWFRQLRDDIVAAFEGLE-DSHANGPLSDTAPGRFEVSDTRRHSEDGSD 61

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-----GTTKNPYFWATGLSVIV 124
            GGG M+ L  G+VFEK  V VS VYG L    +  +      G   +P FWA+G+S++ 
Sbjct: 62  AGGGLMSVLRGGRVFEKVGVNVSEVYGTLGEAAQRSMAARGVPGMDSDPRFWASGISLVA 121

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T  A+WFGGG DL P +E     Y  D   FH   +     H
Sbjct: 122 HMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHAQQQAHLDPH 176

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
            +  Y   K W D YF++PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+ 
Sbjct: 177 GIDLYPTLKAWADEYFFVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFLP 232

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  L+ +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP+
Sbjct: 233 AYVPLIEKRRVQDWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPM 292

Query: 304 VAW 306
             W
Sbjct: 293 AKW 295


>gi|58698198|ref|ZP_00373119.1| coproporphyrinogen III oxidase, aerobic [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630880|ref|YP_002727671.1| coproporphyrinogen III oxidase [Wolbachia sp. wRi]
 gi|58535279|gb|EAL59357.1| coproporphyrinogen III oxidase, aerobic [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592861|gb|ACN95880.1| coproporphyrinogen III oxidase [Wolbachia sp. wRi]
          Length = 274

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 160/263 (60%), Gaps = 17/263 (6%)

Query: 45  ENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKD 104
           E  ++  PKI   + W R        GGG  +T+  G VFEK  V VS V+G  +    +
Sbjct: 27  EKQSSAEPKI-EKRKWDRPG------GGGGESTIIFGNVFEKVGVNVSKVHGKFADSAIN 79

Query: 105 QILGTTK-NPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRH 163
           +I G ++ N  FWA+G+S++ H  +P +PA H N R+I T   WFGGG+D TP   +   
Sbjct: 80  EIPGASESNGEFWASGISLVSHMQSPLIPAAHMNTRLIYTSKQWFGGGMDFTPIYRN--- 136

Query: 164 SYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE 223
             + D  + H ++K +C +     Y  +KE CD YF+L HR+E RGIGGIF+D+L S   
Sbjct: 137 --EEDCKYIHESIKMICDRFDTGYYPKFKEQCDNYFFLQHRKEPRGIGGIFYDNLSS--- 191

Query: 224 MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
            G  + DF F  AVG+ F+++Y  ++R++    ++++ R+ QLI+RGRY EFNLLYD+GT
Sbjct: 192 -GNWENDFEFTKAVGEAFLEIYLHIIRKHIQKSWTKEQRENQLIKRGRYVEFNLLYDRGT 250

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG  T GN ++I+ SMPPLV W
Sbjct: 251 RFGLMTDGNPDAIMMSMPPLVKW 273


>gi|284929730|ref|YP_003422252.1| coproporphyrinogen oxidase [cyanobacterium UCYN-A]
 gi|284810174|gb|ADB95871.1| coproporphyrinogen oxidase [cyanobacterium UCYN-A]
          Length = 344

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 172/330 (52%), Gaps = 47/330 (14%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           N  + +I  P + + + R+SQ   +NLQ  IC   EK +              F   +W 
Sbjct: 8   NSSSYKISTPPE-DAKTRVSQF-MKNLQDEICHSLEKADRRGQ----------FQEDNW- 54

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
               Q+E+ GGGR   L  G + E+  V  S V+G+  P    +     +   F+ATG S
Sbjct: 55  ----QREEGGGGRSRVLKNGDLLEQGGVNFSEVWGEKLPLSIIKQRPEAQGHKFYATGTS 110

Query: 122 VIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP+NP++P VH N R    G  +WFGGGIDLTP      + +  D  FFH TLK+ C
Sbjct: 111 MVLHPHNPYIPTVHLNYRYFEAGPVWWFGGGIDLTPY-----YPFAEDATFFHKTLKQTC 165

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS-PEMGGIDAD--------- 230
            +H    Y  +K WCD YFYL HRQE+RG+GGIFFD+   S P   G   D         
Sbjct: 166 DKHHEQYYPTFKSWCDEYFYLKHRQETRGVGGIFFDYQDGSYPLYRGSSTDKTVSKDDAQ 225

Query: 231 --------------FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFN 276
                         F+F+S  G  F+  Y  +V +     + +++RQ QL RRGRY EFN
Sbjct: 226 ISISESKPRTWEDIFAFVSDCGQTFLPAYLPIVEKRRDLQYGDRERQFQLYRRGRYVEFN 285

Query: 277 LLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           L+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 286 LVYDRGTIFGLQTNGRTESILMSLPPLVRW 315


>gi|225677206|ref|ZP_03788199.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590730|gb|EEH11964.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 274

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 160/263 (60%), Gaps = 17/263 (6%)

Query: 45  ENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKD 104
           E  ++  PKI   + W R        GGG  +T+  G VFEK  V VS V+G  +    +
Sbjct: 27  EKQSSAEPKI-EKRKWDRPG------GGGGESTIIFGNVFEKVGVNVSKVHGKFADSAIN 79

Query: 105 QILGTTK-NPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRH 163
           +I G ++ N  FWA+G+S++ H  +P +P+ H N R+I T   WFGGG+D TP  ++   
Sbjct: 80  EIPGASESNGEFWASGISLVSHMQSPLIPSAHMNTRLIYTSKQWFGGGMDFTPIYKN--- 136

Query: 164 SYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE 223
             + D  + H ++K  C +     Y  +KE CD YF+L HR+E RGIGGIF+D+L S   
Sbjct: 137 --EEDCKYIHESIKMTCDRFDTGYYPKFKEQCDNYFFLQHRKEPRGIGGIFYDNLSS--- 191

Query: 224 MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
            G  + DF F  AVG+ F+++Y  ++R++    ++++ R+ QLI+RGRY EFNLLYD+GT
Sbjct: 192 -GNWENDFEFTKAVGEAFLEIYSHVIRKHMQKSWTKEQRENQLIKRGRYVEFNLLYDRGT 250

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG  T GN ++I+ SMPPLV W
Sbjct: 251 RFGLMTDGNPDAIMMSMPPLVKW 273


>gi|262273072|ref|ZP_06050889.1| coproporphyrinogen III oxidase aerobic [Grimontia hollisae CIP
           101886]
 gi|262222828|gb|EEY74136.1| coproporphyrinogen III oxidase aerobic [Grimontia hollisae CIP
           101886]
          Length = 307

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 162/302 (53%), Gaps = 32/302 (10%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P+ ++  K   +R   +LQ  IC   EK +  A           F    W R        
Sbjct: 7   PEQVD--KEAVKRFLLSLQDTICAALEKEDGSA----------TFQEDAWERTAG----- 49

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG+   +  G VFE+A V  S V+GD  P              F A G+S++VHP NPH
Sbjct: 50  GGGKSRVMRDGAVFEQAGVNFSHVFGDKMPGSATAHRPELAGRSFEAMGVSLVVHPKNPH 109

Query: 131 VPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           VP  H N+R  +         +WFGGG DLTP      +  + D I +H T K +C+   
Sbjct: 110 VPTSHANVRFFIAEKEGEAPVWWFGGGFDLTPF-----YPVEEDCIHWHQTAKSLCAPFG 164

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  +K WCDRYF+LPHR E+RG+GG+FFD L+      G DA F +I AVG+ ++  
Sbjct: 165 GHVYAEHKAWCDRYFFLPHRNETRGVGGLFFDDLNQW----GFDASFGYIKAVGEGYLDA 220

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V++     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPLV
Sbjct: 221 YLPIVQKRKTTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLV 280

Query: 305 AW 306
            W
Sbjct: 281 RW 282


>gi|42521011|ref|NP_966926.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410752|gb|AAS14860.1| coproporphyrinogen III oxidase, aerobic, degenerate [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 256

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 160/263 (60%), Gaps = 17/263 (6%)

Query: 45  ENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKD 104
           E  ++  PKI   + W R        GGG  +T+  G VFEK  V VS V+G  +    +
Sbjct: 9   EKQSSAEPKI-EKRKWDRPG------GGGGESTIIFGNVFEKVGVNVSKVHGKFADSAIN 61

Query: 105 QILGTTK-NPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRH 163
           +I G ++ N  FWA+G+S++ H  +P +PA H N R+I T   WFGGG+D TP  ++   
Sbjct: 62  EIPGASESNGEFWASGISLVSHMQSPLIPAAHMNTRLIYTSKQWFGGGMDFTPIYKN--- 118

Query: 164 SYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE 223
             + D  + H ++K  C +     Y  +KE CD YF+L HR+E RGIGGIF+D+L SS  
Sbjct: 119 --EEDCKYIHESIKMTCDRFDTGYYPKFKEQCDNYFFLQHRKEPRGIGGIFYDNLSSS-- 174

Query: 224 MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
               + DF F  AVG+ F+++Y  ++R++    ++++ R+ QLI+RGRY EFNLLYD+GT
Sbjct: 175 --NWENDFEFTKAVGEAFLEIYLHIIRKHIQKSWTKEQRENQLIKRGRYVEFNLLYDRGT 232

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG  T GN ++I+ SMPPLV W
Sbjct: 233 RFGLMTDGNPDAIMMSMPPLVKW 255


>gi|330447324|ref|ZP_08310974.1| coproporphyrinogen III oxidase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491515|dbj|GAA05471.1| coproporphyrinogen III oxidase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 302

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 164/286 (57%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ E               T   + +D+ Q+E+ GGGR   L  G++FE+
Sbjct: 16  DLQDRICQALEQQE---------------TTVSFEQDQWQREEGGGGRSRVLRNGEIFEQ 60

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S VYG   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 61  AGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVPTSHANVRFFIAEKD 120

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K++C+      Y+ +K WCD+YF+
Sbjct: 121 GEAPVWWFGGGFDLTPF-----YPFEEDCQHWHDTAKQLCAPFGDEVYSEHKAWCDQYFF 175

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+++ AVG+ +I  Y  ++++ YH  + E+
Sbjct: 176 LPHRNETRGVGGLFFDDLNQW----GFEKSFAYMQAVGNGYIDAYIPILKQRYHLPYGER 231

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 232 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 277


>gi|259417249|ref|ZP_05741168.1| coproporphyrinogen III oxidase, aerobic [Silicibacter sp.
           TrichCH4B]
 gi|259346155|gb|EEW57969.1| coproporphyrinogen III oxidase, aerobic [Silicibacter sp.
           TrichCH4B]
          Length = 300

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 115/290 (39%), Positives = 155/290 (53%), Gaps = 17/290 (5%)

Query: 25  FENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           F  L+  I   FE LE+   +   A      F V    R      D GGG M+ +  G+V
Sbjct: 19  FRELRDQIVAAFEGLEDSHTDGPFAEMEAGRFDVSETKRTAEDGSDAGGGLMSVMRGGRV 78

Query: 84  FEKAAVLVSTVYGDLSPDFKDQIL------GTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           FEK  V +S VYG L    ++ +       G  ++P FWA+G+S++ H  NPHVPAVH N
Sbjct: 79  FEKVGVNISEVYGTLGERAQNAMAARKGLPGMKEDPRFWASGISLVAHMRNPHVPAVHMN 138

Query: 138 IRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            RM  T   +WFGGG DL P LE     YD D + FH   +     H    Y   K W D
Sbjct: 139 TRMFWTPHGWWFGGGSDLNPCLE-----YDEDTVHFHGVQQAHLDPHGGDLYPRLKAWAD 193

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YF++PHR  +RG+GGIF D  ++    G   ADF+ +  +G  F+  +  LV +   H 
Sbjct: 194 EYFFIPHRGRARGVGGIFLDDHNT----GDWAADFALVQDIGRAFLPAFVPLVEKRRVHS 249

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            SE D+  QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  W
Sbjct: 250 CSEADKDAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAKW 299


>gi|148284093|ref|YP_001248183.1| coproporphyrinogen III oxidase [Orientia tsutsugamushi str.
           Boryong]
 gi|146739532|emb|CAM79254.1| coproporphyrinogen III oxidase precursor [Orientia tsutsugamushi
           str. Boryong]
          Length = 281

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 166/298 (55%), Gaps = 25/298 (8%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE +++  Q  F+ L+  +   FE +E     N   +  K F    W R        GGG
Sbjct: 5   IEYQEKCYQW-FKELRDELIKTFELIEQHYASNKKVKVAK-FIQSQWSRAGG-----GGG 57

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G VF K  V +S VYGD+     D I        F+ATG+SV+ H  +P VPA
Sbjct: 58  EMSIM-RGNVFAKVGVNISKVYGDVPIALCDIIPCANYGSNFFATGISVVAHMKSPLVPA 116

Query: 134 VHFNIRMIVTGAYWFGGGIDLTP----SLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           VHFN R + T  YWFGGG DLTP     LE+++         FH   + +C ++  + Y 
Sbjct: 117 VHFNTRYLQTNNYWFGGGSDLTPLYPDKLETKK---------FHQAFQLVCDKYNPSYYE 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K  CD YFYLPHR+E RG+GGIF+D+L+S       D DF+F   +G+ F+ +YP +V
Sbjct: 168 KFKAACDNYFYLPHRKEFRGVGGIFYDYLNSK----NFDTDFNFTKNIGEAFLAIYPDIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +      +S    +  L++RGRY EFNLLYD+GT FG  T GN+++IL S+PP V WP
Sbjct: 224 KSKMFLPWSNSQYEALLVKRGRYVEFNLLYDRGTKFGLMTDGNIDAILMSLPPEVKWP 281


>gi|113968381|ref|YP_732174.1| coproporphyrinogen III oxidase [Shewanella sp. MR-4]
 gi|114045546|ref|YP_736096.1| coproporphyrinogen III oxidase [Shewanella sp. MR-7]
 gi|122944260|sp|Q0HPA0|HEM6_SHESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123327055|sp|Q0I0R6|HEM6_SHESR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|113883065|gb|ABI37117.1| Coproporphyrinogen oxidase [Shewanella sp. MR-4]
 gi|113886988|gb|ABI41039.1| Coproporphyrinogen oxidase [Shewanella sp. MR-7]
          Length = 302

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   E+L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLEQLDGQAS----------FAADSWTRTEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRFFIAHKD 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K +C       Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTAKNLCLPFGDDIYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R     + E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKETPYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 EREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|120552990|ref|YP_957341.1| coproporphyrinogen III oxidase [Marinobacter aquaeolei VT8]
 gi|120322839|gb|ABM17154.1| Coproporphyrinogen oxidase [Marinobacter aquaeolei VT8]
          Length = 308

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 158/291 (54%), Gaps = 40/291 (13%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E ++ +A                ++RD  Q+ + GGG    L  G V EK
Sbjct: 16  GLQERICQRLEAVDGQAS---------------FIRDSWQRPEGGGGISRVLADGGVIEK 60

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYF----W-ATGLSVIVHPYNPHVPAVHFNIRMI 141
             V  S V G+  P        T   P+     W A G+S+++HP NP+VP  H N+R  
Sbjct: 61  GGVNFSHVMGETMP-----ASATAHRPHLAGAPWQAMGVSLVIHPNNPYVPTSHANVRFF 115

Query: 142 VTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         YWFGGG DLTP      + ++ D + +H T K  C     + Y  YK WC
Sbjct: 116 IATPEDSAPVYWFGGGYDLTPY-----YGFEEDCVHWHRTAKAACQPFGDSVYADYKRWC 170

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HRQE RG+GG+FFD  ++    G  D DF+F+ AVGD +I+ Y  +VRR    
Sbjct: 171 DDYFYLKHRQEPRGVGGLFFDDYNT----GDFDRDFAFMQAVGDSYIEAYEPIVRRRMDQ 226

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 227 PWGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 277


>gi|157373183|ref|YP_001471783.1| coproporphyrinogen III oxidase [Shewanella sediminis HAW-EB3]
 gi|189028108|sp|A8FP82|HEM6_SHESH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157315557|gb|ABV34655.1| Coproporphyrinogen oxidase [Shewanella sediminis HAW-EB3]
          Length = 306

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+L+ +            F    W R     E+ GGG    L  GKVFE+
Sbjct: 15  DLQQRICEGLEQLDGKG----------TFEADSWKR-----EEGGGGTSRVLTNGKVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P          +   F A G+S+++HP NP +P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATANRSELEGRSFEAMGVSLVIHPKNPFLPTTHANVRFFIAKKE 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DVI +H    ++C     + Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVIEWHQNAHDLCQPFGESVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F F+ AVG+ F+  Y  +V R     + E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQD----GFEKSFEFMQAVGNGFLTSYAPIVERRKDTEYGEK 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 EREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|328702769|ref|XP_001952689.2| PREDICTED: coproporphyrinogen-III oxidase-like [Acyrthosiphon
           pisum]
          Length = 367

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 169/307 (55%), Gaps = 44/307 (14%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI-FTVKHWLRDKSQKEDLGGG 73
           E+ K I +    N+Q+  C   EK E           PK+ F V  W+R +      GGG
Sbjct: 61  EDMKTIMELMIMNIQAEFCRALEKEE-----------PKVKFIVDRWVRPEG-----GGG 104

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-------PYFWATGLSVIVHP 126
               +  G+VFEKA V VS V+G+L P   DQ+    KN       P+F A G+S ++HP
Sbjct: 105 VTCVMQEGEVFEKAGVNVSVVHGNLPPRAIDQMRARGKNFKGGQILPFF-AAGVSAVIHP 163

Query: 127 YNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
            NP+VP +HFN R         T  +WFGGG DLTP      +  + D I FH +LK  C
Sbjct: 164 RNPYVPTIHFNYRYFEVTLPDNTIEWWFGGGTDLTPY-----YLNEEDAIHFHRSLKNAC 218

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            QH  A Y  +K WCD YF +PHR E RG+GGIFFD L +        + FSF+ +  + 
Sbjct: 219 DQHDKAYYPRFKRWCDDYFNIPHRGERRGVGGIFFDDLDTP-------STFSFVKSCAEA 271

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILAS 299
            I  Y  LV+++ + L+++++R+ QL+RRGRY EFNL+YD+GT FG  T G   ESIL S
Sbjct: 272 VIPSYLPLVQKHKNDLYNDKEREWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILMS 331

Query: 300 MPPLVAW 306
           +P    W
Sbjct: 332 LPLSANW 338


>gi|294138841|ref|YP_003554819.1| coproporphyrinogen III oxidase, aerobic [Shewanella violacea DSS12]
 gi|293325310|dbj|BAJ00041.1| coproporphyrinogen III oxidase, aerobic [Shewanella violacea DSS12]
          Length = 305

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 152/285 (53%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E+L+ +           +F    W     ++E+ GGG    L  G VFE+A
Sbjct: 16  LQQQICEGLEQLDGKG----------VFKADSW-----EREEGGGGTSRVLTKGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
            V  S V G   P              F A G+S+++HP NP++P  H N+R  +     
Sbjct: 61  GVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRFFIASKEG 120

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ DVI +H   K  C       Y  YK+WCD YFYL
Sbjct: 121 ADPVWWFGGGFDLTP-----YYPFEQDVIEWHQHSKSFCDPFGDEVYPKYKKWCDEYFYL 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GG+FFD L+      G D  F F+ AVG  F+  Y  +V+R     + E++
Sbjct: 176 PHRDETRGVGGLFFDDLNQE----GFDTSFEFMQAVGTGFLTAYAPIVKRRKDTEYGEKE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|117918500|ref|YP_867692.1| coproporphyrinogen III oxidase [Shewanella sp. ANA-3]
 gi|166217819|sp|A0KR67|HEM6_SHESA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|117610832|gb|ABK46286.1| coproporphyrinogen III oxidase [Shewanella sp. ANA-3]
          Length = 302

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 156/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   E+L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQNRICAGLEQLDGQAS----------FAADSWTRTEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRFFIAHKD 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H T K +C       Y  YK+WCD YF+
Sbjct: 120 GADPVWWFGGGFDLTPY-----YPFEEDVREWHQTAKNLCLPFGDDVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R     + E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKETPYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|163751674|ref|ZP_02158893.1| coproporphyrinogen III oxidase [Shewanella benthica KT99]
 gi|161328413|gb|EDP99569.1| coproporphyrinogen III oxidase [Shewanella benthica KT99]
          Length = 306

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 151/285 (52%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E+L+ +            F    W     ++E+ GGG    L  G VFE+A
Sbjct: 16  LQQQICEGLEQLDGKGE----------FKADSW-----EREEGGGGTSRVLTKGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
            V  S V G   P              F A G+S+++HP+NP++P  H N+R  +     
Sbjct: 61  GVNFSHVTGASMPASATAHRPELAGRSFEAMGVSLVIHPHNPYIPTTHANVRFFIASKEG 120

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ DVI +H   K  C       Y  YK+WCD YFYL
Sbjct: 121 ADPVWWFGGGFDLTPY-----YPFEEDVIEWHQDAKSFCDPFGDEVYPKYKQWCDEYFYL 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RG+GG+FFD L+      G D  F F+ AVG  F+  Y  +V R     + E++
Sbjct: 176 PHRDETRGVGGLFFDDLNQE----GFDTSFEFMQAVGTGFLTSYAPIVNRRKDTEYGEKE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|308047753|ref|YP_003911319.1| coproporphyrinogen oxidase [Ferrimonas balearica DSM 9799]
 gi|307629943|gb|ADN74245.1| Coproporphyrinogen oxidase [Ferrimonas balearica DSM 9799]
          Length = 304

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 156/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   E  + EA                + RD+ Q+E+ GGG    L  G VFE+
Sbjct: 14  SLQNQICEALEGADGEAR---------------FQRDQWQREEGGGGESRVLRDGAVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V G   P              F A G+S+++HP+NPH+P  H N+R  +    
Sbjct: 59  AGVNFSHVMGAQMPASATAHRPELAGRRFEAMGVSLVIHPHNPHIPTTHANVRFFIAEKD 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  D D+  +H    ++C+      Y  YK WCDRYF+
Sbjct: 119 GEDPVWWFGGGFDLTPY-----YPVDEDIRHWHQVAHDLCAPFGDQVYDEYKAWCDRYFF 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L++     G +  F+ + AVG+ F+  Y  +V R     + E+
Sbjct: 174 LKHRDETRGVGGLFFDDLNAP----GFEQSFALMQAVGNGFLDAYLPIVARRKDDAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|99082371|ref|YP_614525.1| coproporphyrinogen III oxidase [Ruegeria sp. TM1040]
 gi|99038651|gb|ABF65263.1| Coproporphyrinogen oxidase [Ruegeria sp. TM1040]
          Length = 300

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 157/302 (51%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENS-ANRSPKIFTVKHWLRDKSQKEDLG 71
           ++ + K  +   F  L+  I   FE LE+  HE          F V    R      D G
Sbjct: 7   EMRDEKARAAAWFRELRDQIVAAFEGLEDSHHEGPFTEMGAGRFDVSDTKRTAEDGSDAG 66

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +S VYG L    +        + G  ++P FWA+G+S++ H
Sbjct: 67  GGLMSVMRGGRVFEKVGVNISEVYGTLGARAQQAMAARKGLPGMKEDPRFWASGISLVAH 126

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH   +     H 
Sbjct: 127 MRNPHVPAVHMNTRMFWTPHGWWFGGGSDLNPCIE-----YDEDTAHFHEVQQTHLDPHG 181

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y   K W D YF++PHR  +RG+GGIF D  ++    G    DF+ I  +G  F+  
Sbjct: 182 ADLYPRLKAWADEYFFIPHRGRARGVGGIFLDDHNT----GDWAQDFALIQDIGRAFLPA 237

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV R   H  S  D++ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 238 FLPLVERRRGHACSADDKEAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 297

Query: 305 AW 306
            W
Sbjct: 298 KW 299


>gi|124002104|ref|ZP_01686958.1| coproporphyrinogen III oxidase, aerobic [Microscilla marina ATCC
           23134]
 gi|123992570|gb|EAY31915.1| coproporphyrinogen III oxidase, aerobic [Microscilla marina ATCC
           23134]
          Length = 296

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 162/284 (57%), Gaps = 25/284 (8%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F+ LQ  IC   EK + +A           F    W R           R   +  G+V 
Sbjct: 10  FKGLQDNICAALEKADGKAK----------FEEDLWERPGGGGG-----RTRIMRNGQVI 54

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM--IV 142
           EK  V  S+V+G      +D++     +  F+ATG+S+++HP NP VP +H N+R   + 
Sbjct: 55  EKGGVNFSSVFGRTPQALQDKMGFPPSD--FYATGVSIVLHPANPMVPIIHMNVRYFELS 112

Query: 143 TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
           TG  WFGGGIDLTP     + +      FFH  LK++C QH    YT +K+W D YFY+P
Sbjct: 113 TGTAWFGGGIDLTPIYIVPQQAQ-----FFHEQLKQVCDQHHADYYTEFKQWADNYFYIP 167

Query: 203 HRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDR 262
           HR E+RGIGGIFFD L ++ ++  ++  F+F+ +VG+ F  +Y  L+  N +  F E+ +
Sbjct: 168 HRNETRGIGGIFFDRLQATDDIS-LEDRFAFVQSVGNAFAPIYTHLIGENRNKSFDEKHK 226

Query: 263 QEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + Q +RRGRY EFNL+YDKGT FG +T G +ESIL S+P   +W
Sbjct: 227 EWQRVRRGRYVEFNLVYDKGTKFGLETSGRIESILMSLPAHASW 270


>gi|190571359|ref|YP_001975717.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018757|ref|ZP_03334565.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357631|emb|CAQ55073.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995708|gb|EEB56348.1| coproporphyrinogen III oxidase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 274

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 149/237 (62%), Gaps = 10/237 (4%)

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNP 129
           GG   +T+  G +FEK  + VS VYG L     ++I G ++ N  FWA+G+S++ H  +P
Sbjct: 46  GGSGESTIIFGNIFEKVGINVSRVYGKLEDSAINEISGASESNGEFWASGISLVSHMQSP 105

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            +PA H N R+I T   WFGGG+D TP  +      + D  + H ++K  C +  +  Y 
Sbjct: 106 LIPAAHMNTRLIYTSKQWFGGGMDFTPIYKD-----EGDCKYIHESIKATCDEFNIEYYP 160

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K+ CD YF+L HR+E RGIGGIF+D+L S    G    DF F  AVG+ F+++Y  ++
Sbjct: 161 KFKKQCDDYFFLQHRKEPRGIGGIFYDNLTS----GNWKNDFEFTKAVGEAFLEIYLHII 216

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++    ++++ R+EQLI+RGRY EFNLLYD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 217 HKHMQKSWTKEQREEQLIKRGRYVEFNLLYDRGTRFGLMTNGNPDAIMMSMPPLVKW 273


>gi|37523445|ref|NP_926822.1| coproporphyrinogen III oxidase [Gloeobacter violaceus PCC 7421]
 gi|41017108|sp|Q7NEK3|HEM6_GLOVI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|35214449|dbj|BAC91817.1| coproporphyrinogen III oxidase [Gloeobacter violaceus PCC 7421]
          Length = 289

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/265 (42%), Positives = 155/265 (58%), Gaps = 13/265 (4%)

Query: 44  HENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGD-LSPDF 102
            +N  +R   +     ++ D  ++E+ GGGR   L  G+VFE+A +  S V+G  L P  
Sbjct: 5   QDNITSRLEAVDGEGRFVEDLWEREEGGGGRSRILTEGRVFERAGIGFSEVHGSHLPPSI 64

Query: 103 KDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESR 161
             Q      +P F+ TG S+++HP NP+VP VH N R    G  +WFGGG DLTP     
Sbjct: 65  LQQRPEAEGHP-FYVTGTSMVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY---- 119

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
            + +  D   FH TLK  C  H    Y  +K+WCD YFYL HRQE RG+GGIFFD++   
Sbjct: 120 -YGFVEDAAHFHATLKAACDAHDPEYYPRFKKWCDEYFYLKHRQEPRGVGGIFFDYVQ-- 176

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
              G  +  F+F  + G+ F+  Y  +V R +   ++E++R  QL RRGRY EFNL++D+
Sbjct: 177 ---GDWEKIFAFAQSCGNAFLPAYLPIVERRHTLPYAERERNFQLYRRGRYVEFNLVWDR 233

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G +ESIL SMPPLV W
Sbjct: 234 GTIFGLQTNGRIESILMSMPPLVRW 258


>gi|258626122|ref|ZP_05720973.1| coproporphyrinogen III oxidase, aerobic [Vibrio mimicus VM603]
 gi|262172820|ref|ZP_06040498.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus MB-451]
 gi|258581648|gb|EEW06546.1| coproporphyrinogen III oxidase, aerobic [Vibrio mimicus VM603]
 gi|261893896|gb|EEY39882.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus MB-451]
          Length = 305

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDQICQQLEAADGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMRDGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D  F+H T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDCQFWHQTAKNLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F++I AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|254491125|ref|ZP_05104306.1| coproporphyrinogen III oxidase, aerobic [Methylophaga thiooxidans
           DMS010]
 gi|224463638|gb|EEF79906.1| coproporphyrinogen III oxidase, aerobic [Methylophaga thiooxydans
           DMS010]
          Length = 302

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E ++ +A           F +  W     Q+ + GGGR   L  G VFE+
Sbjct: 15  TLQDTICNALEAIDGDAK----------FELDEW-----QRAEGGGGRTRVLTNGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V GD  P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  GGVNFSEVSGDNMPPSATASRPELAGRSFKAMGVSLVIHPNNPYIPTSHANVRFFIAEKE 119

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + DVI +H+  K+ C     A Y  +K+WCD YFY
Sbjct: 120 GEEPIWWFGGGYDLTPY-----YGNEDDVIHWHSEAKKACEPFGEAVYPRFKQWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RG+GG+FFD L+      G +  F+F+ +VG+ +IK Y  +V++  + ++ EQ
Sbjct: 175 LKHRDECRGVGGLFFDDLNEW----GFERCFAFLQSVGNSYIKAYTPIVKKRMNEVYGEQ 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 231 ERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVTW 276


>gi|313675592|ref|YP_004053588.1| coproporphyrinogen oxidase [Marivirga tractuosa DSM 4126]
 gi|312942290|gb|ADR21480.1| Coproporphyrinogen oxidase [Marivirga tractuosa DSM 4126]
          Length = 305

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/288 (39%), Positives = 165/288 (57%), Gaps = 28/288 (9%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F+ LQ+ IC +           SA      F +  W  +K      GGG+   L  G + 
Sbjct: 12  FQELQADICDKI----------SATDGKGRFEIDDWRHEKG-----GGGKSRLLQNGNIL 56

Query: 85  EKAAVLVSTVYGDLSPDFKDQIL----GTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           EKA V  S V G  +P+   + L    G T +  F+ATG+S+++HP++P VP +H N+R 
Sbjct: 57  EKAGVNFSAVEGP-APEGLLKTLEIDAGDTDDLSFFATGVSIVMHPFSPMVPIIHMNVRY 115

Query: 141 --IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
             +  G YWFGGGIDLTP +  +  +      +FH  +K++C +H +  Y ++K+W D Y
Sbjct: 116 FELSNGTYWFGGGIDLTPHIIDKSQAQ-----YFHKEIKKVCDKHDMDYYPNFKKWADDY 170

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYLPHR E+RG+GGIFFD L S  E    +  F+F+  +G+ F  +Y  L+  N    F+
Sbjct: 171 FYLPHRNETRGVGGIFFDRL-SENEKHSKEEIFAFVQDIGNLFAPVYSHLMEINKDKSFN 229

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           ++ +Q Q +RRGRY EFNL++D+GT FG +T G  ESIL SMPP   W
Sbjct: 230 DEQKQWQYLRRGRYVEFNLVWDRGTKFGLQTNGRTESILMSMPPQANW 277


>gi|118602507|ref|YP_903722.1| coproporphyrinogen III oxidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567446|gb|ABL02251.1| coproporphyrinogen oxidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 302

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 156/285 (54%), Gaps = 29/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC + E++++ A           F    W     +  + G G    L  G VFE+A
Sbjct: 12  LQFNICEQLEQVDDNAE----------FIKDVW----EKPNNTGNGLTKVLSNGAVFEQA 57

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV----- 142
            V  S ++G+  P     +        F A G+S++VHP NP+VP  H N+R        
Sbjct: 58  GVNFSIIHGNDMPASATVLRPELSGRSFTALGVSLVVHPQNPYVPTSHANVRFFFAEKEG 117

Query: 143 -TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
            T  +WFGGG DLTP      + +D D IF+H + K+ C       Y+ YK+WCD YFYL
Sbjct: 118 ETPIWWFGGGFDLTPY-----YGFDEDAIFWHQSAKQACDPFGKDVYSKYKKWCDDYFYL 172

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E RGIGG+FFD L+     G  D  FSF+ +VGD +I  Y  +V R     +++ +
Sbjct: 173 KHRSEQRGIGGLFFDDLNE----GSFDECFSFMKSVGDGYINAYRPIVERRKDTPYTDHE 228

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 229 RQFQLYRRGRYVEFNLIYDRGTLFGLQTGGRSESILMSLPPLVRW 273


>gi|24371638|ref|NP_715680.1| coproporphyrinogen III oxidase [Shewanella oneidensis MR-1]
 gi|41017197|sp|Q8EKQ2|HEM6_SHEON RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24345397|gb|AAN53125.1|AE015455_6 coproporphyrinogen III oxidase, aerobic [Shewanella oneidensis
           MR-1]
          Length = 302

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+L+ +A           F    W R +      GGG    L  G VFE+
Sbjct: 15  DLQHRICAGLEQLDGQAS----------FAADSWTRAEG-----GGGTSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRFFIAHKD 119

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ DV  +H + K +C       Y  YK+WCD YF+
Sbjct: 120 GAEPVWWFGGGFDLTPY-----YPFEEDVREWHQSAKNLCQPFGDDVYPKYKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R     + E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKDTDYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|34496212|ref|NP_900427.1| coproporphyrinogen III oxidase [Chromobacterium violaceum ATCC
           12472]
 gi|41017116|sp|Q7P012|HEM6_CHRVO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|34102066|gb|AAQ58433.1| coproporphyrinogen oxidase [Chromobacterium violaceum ATCC 12472]
          Length = 302

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ + +A           F    W R+       GGGR   L  G+VFE+
Sbjct: 15  DLQDRICAALEQADGKAQ----------FAEDAWSREAG-----GGGRSRVLTGGEVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+GD  P              F A G+S+++HP NPHVP  H N+R  +    
Sbjct: 60  AGVNFSHVHGDALPPSASAHRPELAGRRFEAMGVSLVIHPSNPHVPTSHANVRFFIAEKD 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +++C+      Y  YK+WCD YF+
Sbjct: 120 GEAPVWWFGGGFDLTPF-----YPQEEDAVHWHTVARDLCAPFGGDVYPRYKKWCDEYFH 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD L+      G D  F+F  AVGD ++  Y  +V R     + ++
Sbjct: 175 LKHRNEARGIGGLFFDDLNEW----GFDKSFAFTRAVGDGYLDAYLPIVARRKEQAWGDR 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|88811390|ref|ZP_01126645.1| coproporphyrinogen III oxidase [Nitrococcus mobilis Nb-231]
 gi|88791279|gb|EAR22391.1| coproporphyrinogen III oxidase [Nitrococcus mobilis Nb-231]
          Length = 307

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 143/250 (57%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D   +E+ GGGR   LC G  FE+A +  S VYG   PD             + A G+S+
Sbjct: 37  DPWSREEGGGGRSRVLCEGVTFEQAGINFSHVYGSALPDTASARRPELAGRCYQAMGVSL 96

Query: 123 IVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           +VHP NP VP  H N+R  +         +WFGGG DLTP      + YD DV+ +H + 
Sbjct: 97  VVHPRNPFVPISHANVRFFLAEKPGEAPVWWFGGGFDLTPC-----YGYDEDVLHWHQSA 151

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           K  C  +    Y  +K WCD YFYLPHR E RG+GG+FFD    +    G +  F F+ +
Sbjct: 152 KAACDPYDERFYPRFKAWCDEYFYLPHRNEPRGVGGLFFDDFTGA----GFEHAFGFMRS 207

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VG+ F++ Y  +VRR     + E++R+ QL RRGRY EFNLL+D+GT FG  +GG  ESI
Sbjct: 208 VGNGFLQAYLPIVRRRKSTDYGERERRFQLYRRGRYVEFNLLFDRGTRFGIHSGGRAESI 267

Query: 297 LASMPPLVAW 306
           L S+PPLV W
Sbjct: 268 LMSLPPLVRW 277


>gi|284037184|ref|YP_003387114.1| coproporphyrinogen oxidase [Spirosoma linguale DSM 74]
 gi|283816477|gb|ADB38315.1| Coproporphyrinogen oxidase [Spirosoma linguale DSM 74]
          Length = 304

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 162/284 (57%), Gaps = 24/284 (8%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F++LQ  IC   E+ +  A           F    W R           R   +  G V 
Sbjct: 17  FKDLQDRICQSLEQADGGAQ----------FREDAWERPGGGGG-----RSRIITNGTVI 61

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM--IV 142
           EK  V  S V+G+ + +   + L  T+   F+ATG+S+++HP++P VP +H N+R   + 
Sbjct: 62  EKGGVGFSAVHGEAT-EATLRTLNLTEPAEFYATGVSIVLHPHSPLVPIIHMNVRYFEMS 120

Query: 143 TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
           TG  WFGGGIDLTP      +  + D  +FH +LK +C +H+ A YT +K W D YFY+P
Sbjct: 121 TGHNWFGGGIDLTP-----HYVVEEDAQWFHQSLKTVCDRHSPAYYTKFKPWADDYFYIP 175

Query: 203 HRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDR 262
           HRQE+RG+GGIFFD+L  + E    D  F F+  VG+ F  +Y   + +N H  + ++++
Sbjct: 176 HRQETRGVGGIFFDYLKPTDEYSKKDI-FDFVQDVGNIFAPIYTHFMHKNRHLPYGDREK 234

Query: 263 QEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             QL+RRGRY EFNL++D+GT FG +T G  ESIL SMPP   W
Sbjct: 235 SWQLLRRGRYVEFNLVWDRGTKFGLETNGRTESILMSMPPQANW 278


>gi|261213221|ref|ZP_05927503.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC341]
 gi|260837495|gb|EEX64198.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC341]
          Length = 305

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDQICQQLEAADGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMRGGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D  F+H+T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDCQFWHHTAKNLCAPFGADIYNQHKVWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|262402040|ref|ZP_06078604.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC586]
 gi|262351686|gb|EEZ00818.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC586]
          Length = 305

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDQICQQLEAADGQAQ----------FIEDAWQRESGEKLG-GGGRTRVMRDGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYIPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D  F+H+T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDCQFWHHTAKNLCAPFGADIYNQHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|78484363|ref|YP_390288.1| coproporphyrinogen III oxidase [Thiomicrospira crunogena XCL-2]
 gi|78362649|gb|ABB40614.1| coproporphyrinogen oxidase [Thiomicrospira crunogena XCL-2]
          Length = 323

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 155/287 (54%), Gaps = 23/287 (8%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR--DKSQKEDLGGGRMATLCAGKVFE 85
           LQ  IC +       A E+ +N     F V  W R  D+      GGGR   L  G++ E
Sbjct: 21  LQDDICQQL------AEEDGSND----FIVDAWDREPDEGVMGLTGGGRSRVLEGGEIIE 70

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG- 144
           K  V  S V G   P              F A G+S+++HP NP+VP  H N+R+ +   
Sbjct: 71  KGGVNFSHVRGKTLPASATAHRPELAGRSFQALGVSLVIHPRNPYVPTSHANVRLFIAEK 130

Query: 145 -----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
                 +WFGGG DLTP      + +D D++ +H T KE C       Y  YKEWCD YF
Sbjct: 131 EGEAPVWWFGGGFDLTPY-----YPFDQDILHWHLTSKEACDPFGTDVYAKYKEWCDEYF 185

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           +L HR E+RG+GG+F+D L+ S      D  F+F+ +VGD FIK Y  +V R  +  + E
Sbjct: 186 FLKHRNETRGVGGLFYDDLNESTFGWDFDKCFAFMQSVGDHFIKAYRPIVARRKNMDYGE 245

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + R  QL RRGRYAEFNL +D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 246 RQRDFQLYRRGRYAEFNLAFDRGTIFGLQTGGRTESILMSMPPLATW 292


>gi|262166820|ref|ZP_06034557.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus VM223]
 gi|262026536|gb|EEY45204.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus VM223]
          Length = 305

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDQICQQLEAADGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMRDGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D  ++H T K +C+  +   Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDCQYWHQTAKNLCAPFSAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|85711000|ref|ZP_01042061.1| Coproporphyrinogen III oxidase [Idiomarina baltica OS145]
 gi|85695404|gb|EAQ33341.1| Coproporphyrinogen III oxidase [Idiomarina baltica OS145]
          Length = 310

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 120/286 (41%), Positives = 152/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E ++                   + +D+ Q+E  GGGR   +  G+ FE+
Sbjct: 16  SLQDSICQQLETVDGGGR---------------FQQDEWQREQGGGGRSRVMKEGETFEQ 60

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S VYG+  P          +   F A G+S+++HP NPHVP VH N+R  +    
Sbjct: 61  AGVGFSHVYGEQLPKSATAHRPELEGRDFNACGVSLVIHPRNPHVPTVHLNVRFFIAEKE 120

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + Y  D I +H   K    +   A Y  YK WCD YFY
Sbjct: 121 GEDPVWWFGGGFDLTPY-----YPYTNDCIEWHKKAKASLDKVDPALYDKYKVWCDDYFY 175

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGGIFFD L+        D  F  I AVGD F + Y  +V R     +SE 
Sbjct: 176 LKHRNEARGIGGIFFDDLNDR----SFDEAFDVIKAVGDAFCEAYVPIVERRKKTEYSEH 231

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 QRQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 277


>gi|294053800|ref|YP_003547458.1| Coproporphyrinogen oxidase [Coraliomargarita akajimensis DSM 45221]
 gi|293613133|gb|ADE53288.1| Coproporphyrinogen oxidase [Coraliomargarita akajimensis DSM 45221]
          Length = 305

 Score =  212 bits (539), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 151/288 (52%), Gaps = 34/288 (11%)

Query: 27  NLQSIICTEFEKLENEA--HENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           +LQ  IC   E  +  A  HE+S            W R +      GGGR   L  G +F
Sbjct: 15  SLQDSICKALEAEDGSATFHEDS------------WERPEG-----GGGRSRVLADGAIF 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EKA +  S V+G   P              F A G+S+++HP NPHVP  H N+R     
Sbjct: 58  EKAGINFSDVHGKGLPPSATAARPQLAGAAFRAMGVSLVIHPQNPHVPTTHMNVRYFEAS 117

Query: 145 ------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP    +      D I +H T K  C       Y  +K+ CD Y
Sbjct: 118 PTEGEPVWWFGGGFDLTPYYGQKA-----DAIHWHQTAKAACDPFGTELYPRFKQTCDDY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYLPHR E+RGIGGIFFD  ++    GG D  F+F+ +VGD F+  Y  +V R     F+
Sbjct: 173 FYLPHRNEARGIGGIFFDDFNA----GGFDQAFAFMQSVGDHFVPAYQPIVARRKEQPFT 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + +RQ QL RRGRY EFNL+YD+GT FG ++ G  ESIL S+PPLV W
Sbjct: 229 DAERQFQLYRRGRYVEFNLVYDRGTIFGLQSKGRTESILMSLPPLVRW 276


>gi|269103769|ref|ZP_06156466.1| coproporphyrinogen III oxidase aerobic [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163667|gb|EEZ42163.1| coproporphyrinogen III oxidase aerobic [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 303

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 109/256 (42%), Positives = 149/256 (58%), Gaps = 15/256 (5%)

Query: 57  VKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFW 116
           V  + +D  Q+E  GGGR   L  G+VFE+A V  S V+G   P              F 
Sbjct: 30  VAQFEQDDWQREQGGGGRTRVLRHGQVFEQAGVNFSHVFGVEMPASATAHRPELAGRRFE 89

Query: 117 ATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVI 170
           A G+S+++HP+NP+VP  H N+R  +         +WFGGG DLTP      + +  D +
Sbjct: 90  AMGVSLVIHPHNPYVPTSHANVRFFIAEKEGEAPVWWFGGGFDLTPF-----YPFAEDCL 144

Query: 171 FFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD 230
            +H    ++C     A Y+ +K WCDRYF+LPHR E+RGIGG+FFD L+        D  
Sbjct: 145 HWHQVAHQLCQPFGDAVYSQHKAWCDRYFFLPHRNETRGIGGLFFDDLNQWE----FDNC 200

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG 290
           F++I AVG  +++ Y  +V +   H F E++RQ QL RRGRY EFNL+YD+GT FG ++G
Sbjct: 201 FAYIQAVGQGYLEAYLPIVEKRKSHCFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSG 260

Query: 291 GNVESILASMPPLVAW 306
           G  ESIL SMPPL  W
Sbjct: 261 GRTESILMSMPPLARW 276


>gi|119773192|ref|YP_925932.1| coproporphyrinogen III oxidase [Shewanella amazonensis SB2B]
 gi|166217815|sp|A1S1K6|HEM6_SHEAM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|119765692|gb|ABL98262.1| Coproporphyrinogen oxidase [Shewanella amazonensis SB2B]
          Length = 304

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 165/305 (54%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +G P+  E +  + Q     LQ+ IC   E+L+ +A           F    W     Q+
Sbjct: 1   MGLPNAEEVKAFLMQ-----LQANICAGLERLDGQAS----------FATDSW-----QR 40

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGG    L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 41  AEGGGGISRVLTDGAVFEQAGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPK 100

Query: 128 NPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ DV  +H + K++C+
Sbjct: 101 NPYIPTTHANVRFFIARKEGADPVWWFGGGFDLTPY-----YPFESDVKEWHQSAKDLCA 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YKEWCD+YF+LPHR E+RG+GG+FFD L+        D  F ++ AVG+ F
Sbjct: 156 PFGNEVYPKYKEWCDKYFFLPHRGETRGVGGLFFDDLNHWE----FDKCFDYMQAVGNGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMP
Sbjct: 212 LTAYAPIVERRKDTAYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|229524956|ref|ZP_04414361.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae bv.
           albensis VL426]
 gi|229338537|gb|EEO03554.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae bv.
           albensis VL426]
          Length = 305

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEAADGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEDPIWWFGGGFDLTPF-----YPFVEDCQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYVQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRAESILMSMPPLARW 281


>gi|209522928|ref|ZP_03271485.1| Coproporphyrinogen oxidase [Arthrospira maxima CS-328]
 gi|209496515|gb|EDZ96813.1| Coproporphyrinogen oxidase [Arthrospira maxima CS-328]
          Length = 348

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 166/326 (50%), Gaps = 46/326 (14%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T  +  P   + R+R+SQ   + +Q  IC   EKL+                 K ++ D 
Sbjct: 10  TATVQSPPPADSRERVSQ-WMKQIQDEICAGLEKLDG---------------AKTFVEDA 53

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVI 123
            ++ + GGGR   +  G VFE+  V  S V+G +L P    Q      N  F+ATG S++
Sbjct: 54  WERPEGGGGRTRVIREGNVFEQGGVNFSEVWGQNLPPSILSQRPEAAGNG-FYATGTSMV 112

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   FH TLKE C +
Sbjct: 113 LHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHKTLKEACDR 167

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL----------------------HS 220
           H    Y  +K WCD YF+L HR E+RGIGGIFFD+                         
Sbjct: 168 HHSEYYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGQETESEAATYSDRMG 227

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
           +PE    +  FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD
Sbjct: 228 APESRDWEGLFSFIQDCGKSFLPSYGPIVERRNSIEYGDRERNFQLYRRGRYVEFNLVYD 287

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 288 RGTIFGLQTKGRTESILMSLPPLVRW 313


>gi|327482965|gb|AEA77372.1| Coproporphyrinogen III oxidase, aerobic [Vibrio cholerae LMA3894-4]
          Length = 305

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F++I AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|86147121|ref|ZP_01065437.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
 gi|85835005|gb|EAQ53147.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
          Length = 305

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ +  A          +F    W R+  ++   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQADGAA----------LFEEDAWEREPGERLG-GGGRTRVMTNGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 64  GGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D   +H T K++C+      Y  +KEWCD+YFY
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFDEDCQSWHQTAKDLCAPFGDDVYQEHKEWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  F+++ AVG+ F   Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNEW----GFDKSFAYMQAVGEGFAAAYLPIVERRKETPYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|75911192|ref|YP_325488.1| coproporphyrinogen III oxidase [Anabaena variabilis ATCC 29413]
 gi|75704917|gb|ABA24593.1| coproporphyrinogen oxidase [Anabaena variabilis ATCC 29413]
          Length = 347

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/318 (38%), Positives = 165/318 (51%), Gaps = 45/318 (14%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D  +R   SQ+  +NLQ  ICT  E+++ +A           F   +W R +      
Sbjct: 27  PKDSRQR---SQQFMQNLQDEICTALEQIDGKAS----------FHQDYWERAEG----- 68

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           G GR   +  G+VFE+  V  S V+G+  P              F+ATG S+++HP NP+
Sbjct: 69  GEGRTRVIREGRVFEQGGVNFSAVWGNSLPASILAQRPEAAGHEFFATGTSMVLHPRNPY 128

Query: 131 VPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           VP VH N R    G  +WFGGG DLTP      ++++ D + FH TLK  C  H    Y 
Sbjct: 129 VPTVHLNYRYFEAGPIWWFGGGADLTPY-----YAFEEDAVHFHQTLKNACDVHNPEYYP 183

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG-GIDAD------------------ 230
            +K WCD YFYL HRQE RGIGGIFFD+  +S ++  G  AD                  
Sbjct: 184 AFKRWCDEYFYLRHRQEQRGIGGIFFDYQDASGKLYIGTQADSPAAIYSQKVGNVTRNWE 243

Query: 231 --FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+F+ + G  F+  Y  +V R     + ++ R  QL RRGRY EFNL+YD+GT FG +
Sbjct: 244 DIFAFVQSCGQAFLPAYLPIVERRQATEYGDRQRNFQLYRRGRYVEFNLVYDRGTVFGLQ 303

Query: 289 TGGNVESILASMPPLVAW 306
           T G  ESIL S+PPL  W
Sbjct: 304 TKGRTESILMSLPPLARW 321


>gi|170767389|ref|ZP_02901842.1| coproporphyrinogen III oxidase, aerobic [Escherichia albertii
           TW07627]
 gi|170123723|gb|EDS92654.1| coproporphyrinogen III oxidase, aerobic [Escherichia albertii
           TW07627]
          Length = 299

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 158/286 (55%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDSICQQLAAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+GD  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPY-----YGFEEDAIHWHRTARDLCQPFGENVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     +SE+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMTYSER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|254225577|ref|ZP_04919186.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V51]
 gi|125621897|gb|EAZ50222.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V51]
          Length = 305

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P             +F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRHFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEDPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|255036131|ref|YP_003086752.1| coproporphyrinogen III oxidase [Dyadobacter fermentans DSM 18053]
 gi|254948887|gb|ACT93587.1| Coproporphyrinogen oxidase [Dyadobacter fermentans DSM 18053]
          Length = 303

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 162/291 (55%), Gaps = 31/291 (10%)

Query: 25  FENLQSIICTEFEKLENEA--HENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGK 82
           F++LQ  IC   E  +  A  HE                 D  Q    GGGR   +  G 
Sbjct: 10  FKDLQDRICQAIETTDGGATFHE-----------------DLWQHHSGGGGRTRLIQNGA 52

Query: 83  VFEKAAVLVSTVYGDLSPDFKDQI-LGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM- 140
           V EK  V  S+V G++ P  + Q+ L    NP F ATG+S+++HP NPHVP +H N+R  
Sbjct: 53  VIEKGGVNFSSVKGEVHPRLRAQMNLAEDANPQFTATGVSIVMHPRNPHVPIIHMNVRYF 112

Query: 141 -IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
            +  G  WFGGGIDLTP      +  + D   FH TLK  C +H  A Y ++K W D YF
Sbjct: 113 ELDNGTCWFGGGIDLTP-----HYVVEEDARAFHQTLKTACDKHHPAFYPNFKTWADDYF 167

Query: 200 YLPHRQESRGIGGIFFDHLH-SSPEMG-GIDAD--FSFISAVGDCFIKLYPSLVRRNYHH 255
           ++ HR E+RG+GGIFFD+L    P  G G+     F F+  VG+ F  +Y +L+R+    
Sbjct: 168 FIQHRNETRGVGGIFFDYLKPGEPGHGQGLSKTELFDFVKEVGENFAPVYTALMRKYADK 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            F+++ +Q Q +RRGRY EFNL++D+GT FG +T G  ESIL S+PP   W
Sbjct: 228 PFTDEQKQWQYLRRGRYVEFNLVWDRGTKFGLETNGRTESILMSLPPQANW 278


>gi|297622470|ref|YP_003703904.1| Coproporphyrinogen oxidase [Truepera radiovictrix DSM 17093]
 gi|297163650|gb|ADI13361.1| Coproporphyrinogen oxidase [Truepera radiovictrix DSM 17093]
          Length = 330

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 166/315 (52%), Gaps = 36/315 (11%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T  +  P     R+R+        Q+ +   FE L+ +A           F    W R  
Sbjct: 6   TSHLAAPATTSRRERVVA-LMRAAQARLTAAFEALDGQA----------TFRPHTWERPG 54

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGD-LSPDFKDQILGTTKNPYFWATGLSVI 123
                 GGG    L  G+V E+  + VS V GD + P       GT   P+F ATGLS++
Sbjct: 55  G-----GGGTAKVLEGGRVLERGGINVSAVCGDAVPPSLAATHPGTEGKPFF-ATGLSMV 108

Query: 124 VHPYNPHVPAVHFNIRM------------IVTGAYWFGGGIDLTPSLESRRHSYDPDVIF 171
           +HP NP+ PA H N R             I    +WFGGG D+TP+     + ++ DVI 
Sbjct: 109 LHPLNPYAPAFHANYRYFEVTEVSSRGHEIAPRVWWFGGGADMTPN-----YPFEEDVIH 163

Query: 172 FHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADF 231
           FH TLK  C +H V +Y   K  CD YF++ HR E RG+GGIFFD L S    G  + DF
Sbjct: 164 FHRTLKAQCDRHDVGDYETLKRACDDYFFIRHRGEMRGVGGIFFDEL-SPIGQGDFERDF 222

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
           +F++   D  ++ Y  L+ R +   + E++R+ QL+RRGRY EFNL+YD+GT FG +TGG
Sbjct: 223 AFVADGLDTILEAYLPLLARRHATPYGERERRWQLLRRGRYVEFNLVYDRGTLFGLQTGG 282

Query: 292 NVESILASMPPLVAW 306
           N+E+IL SMPP   W
Sbjct: 283 NIEAILMSMPPFAHW 297


>gi|269138481|ref|YP_003295181.1| coproporphyrinogen III oxidase [Edwardsiella tarda EIB202]
 gi|267984141|gb|ACY83970.1| coproporphyrinogen III oxidase [Edwardsiella tarda EIB202]
 gi|304558506|gb|ADM41170.1| Coproporphyrinogen III oxidase [Edwardsiella tarda FL6-60]
          Length = 329

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 151/255 (59%), Gaps = 26/255 (10%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-----FWA 117
           D+ Q+   G GR   L  G +FE+A V  S ++GD  P        T K P      F A
Sbjct: 59  DRWQRPQGGAGRTRVLRQGALFEQAGVNFSHIHGDSLP------AATAKRPELVGCPFQA 112

Query: 118 TGLSVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIF 171
            G+S+++HP++P+VP  H N+R  +    GA   +WFGGG DLTP      + +  DVI 
Sbjct: 113 MGVSLVLHPHSPYVPTAHANVRFFIAERPGAAPLWWFGGGFDLTPF-----YPFYDDVIQ 167

Query: 172 FHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADF 231
           +H + +++C       Y  YK WCDRYFYLPHRQE+RG+GG+FFD L++       D  F
Sbjct: 168 WHRSARDLCRPFGEQLYPRYKAWCDRYFYLPHRQEARGVGGLFFDDLNAP----DFDQAF 223

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
           +F  AVG+ F   Y  L  R  H  + E++RQ QL RRGRY EFNL++D+GT FG ++GG
Sbjct: 224 AFTRAVGEGFAPAYLPLAERRRHLSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGG 283

Query: 292 NVESILASMPPLVAW 306
             ESIL SMPPLV W
Sbjct: 284 RSESILMSMPPLVRW 298


>gi|229520240|ref|ZP_04409667.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TM
           11079-80]
 gi|229342834|gb|EEO07825.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TM
           11079-80]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEDPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F++I AVG  + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGKGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|332304415|ref|YP_004432266.1| Coproporphyrinogen oxidase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171744|gb|AEE20998.1| Coproporphyrinogen oxidase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 307

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/300 (39%), Positives = 157/300 (52%), Gaps = 34/300 (11%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           DIE  K+       NLQ  IC   E  + +                 ++ D  Q+E  GG
Sbjct: 8   DIESVKQF----LLNLQDNICQTLEMADGKGC---------------FIEDNWQRELGGG 48

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G V E+  V  S VYG   P              F A G+S+++HP NPHVP
Sbjct: 49  GRTRVLTNGHVIEQGGVNFSHVYGGQLPASATASRPELAGRSFQAMGVSLVIHPKNPHVP 108

Query: 133 AVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R+ +         +WFGGG DLTP      +    DV+ +H T K++C      
Sbjct: 109 TSHANVRIFIAEKEGEEPIWWFGGGFDLTPF-----YPVHEDVLHWHQTAKDLCEPFGDG 163

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y+ YK+WCD YFYL HR E+RG+GG+FFD L+      G +  F F+ AVG+ F+  Y 
Sbjct: 164 VYSKYKKWCDEYFYLKHRDETRGVGGLFFDDLNEW----GFERSFEFMQAVGNGFLDAYV 219

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ +     FSEQ+R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 220 PILEKRKDMSFSEQERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 279


>gi|323493846|ref|ZP_08098964.1| coproporphyrinogen III oxidase [Vibrio brasiliensis LMG 20546]
 gi|323311980|gb|EGA65126.1| coproporphyrinogen III oxidase [Vibrio brasiliensis LMG 20546]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E+ + +A          +F    W R+  +K   GGGR   +  G VFE+
Sbjct: 15  KLQDSICQQLEEADGQA----------VFVEDEWHREPGEKLG-GGGRTRVMKDGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D  ++HNT KE+C+      Y  +K WCDRYFY
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFEEDAQYWHNTAKEVCAPFGSEVYPEHKAWCDRYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     + ++
Sbjct: 179 LPHRDETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYTEAYLPIVERRKETTYGDR 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|239993916|ref|ZP_04714440.1| coproporphyrinogen III oxidase [Alteromonas macleodii ATCC 27126]
          Length = 310

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E  + +                 ++ D  Q+E+ GGGR   L  G V E+
Sbjct: 25  GLQDTICQTLELADGKGQ---------------FVEDSWQREEGGGGRSRVLKNGAVIEQ 69

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV---- 142
             V  S V+G   P              F A G+S+++HP+NP++P  H N+R  +    
Sbjct: 70  GGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYIPTSHANVRFFIAEKE 129

Query: 143 --TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
             T  +WFGGG DLTP      + +  DV+ +H+T K++C       Y  YK+WCD YFY
Sbjct: 130 GETPIWWFGGGFDLTPF-----YPFKDDVLHWHDTAKKLCKPFGDDVYPKYKKWCDDYFY 184

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G +  F+F+ AVG+ FI  Y  +V R     F E+
Sbjct: 185 LKHRNETRGVGGLFFDDLNEW----GFEQSFAFMQAVGNGFIDAYVPIVERRKQTDFGER 240

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 241 ERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|227080292|ref|YP_002808843.1| coproporphyrinogen III oxidase [Vibrio cholerae M66-2]
 gi|298501237|ref|ZP_07011036.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MAK 757]
 gi|254800279|sp|C3LPC8|HEM6_VIBCM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|227008180|gb|ACP04392.1| coproporphyrinogen III oxidase [Vibrio cholerae M66-2]
 gi|297540109|gb|EFH76171.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MAK 757]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDQICQQLEAADGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMRDGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRYFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEDPIWWFGGGFDLTPF-----YPFVEDCQLWHQTAKNLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|229530160|ref|ZP_04419549.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae 12129(1)]
 gi|262191285|ref|ZP_06049479.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae CT 5369-93]
 gi|229332293|gb|EEN97780.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae 12129(1)]
 gi|262032823|gb|EEY51367.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae CT 5369-93]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|254291085|ref|ZP_04961882.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae AM-19226]
 gi|150422930|gb|EDN14880.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae AM-19226]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFIEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|153217572|ref|ZP_01951253.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 1587]
 gi|153802767|ref|ZP_01957353.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-3]
 gi|153830120|ref|ZP_01982787.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 623-39]
 gi|229515907|ref|ZP_04405364.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TMA 21]
 gi|124113484|gb|EAY32304.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 1587]
 gi|124121680|gb|EAY40423.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-3]
 gi|148874384|gb|EDL72519.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 623-39]
 gi|229347007|gb|EEO11969.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TMA 21]
          Length = 305

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K++C+      Y  +K WCDRYFY
Sbjct: 125 GEDPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKQLCAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|109896361|ref|YP_659616.1| coproporphyrinogen III oxidase [Pseudoalteromonas atlantica T6c]
 gi|109698642|gb|ABG38562.1| Coproporphyrinogen oxidase [Pseudoalteromonas atlantica T6c]
          Length = 307

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 145/252 (57%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G+V E+  V  S VYG   P              F A G+
Sbjct: 37  IEDNWQRELGGGGRTRVLTNGQVIEQGGVNFSHVYGGQLPASATASRPELAGRSFQAMGV 96

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S+++HP NPHVP  H N+R+ +         +WFGGG DLTP      +    DV+ +H 
Sbjct: 97  SLVIHPKNPHVPTSHANVRIFIAEKEGEEPIWWFGGGFDLTPF-----YPVHEDVLHWHQ 151

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T K++C       Y+ YK+WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+
Sbjct: 152 TAKDLCEPFGKDVYSKYKKWCDDYFYLKHRDETRGVGGLFFDDLNEW----GFERSFAFM 207

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ F+  Y  ++ +     FSEQ+R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 208 QAVGNGFLDAYVPILEKRKDTSFSEQERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 267

Query: 295 SILASMPPLVAW 306
           SIL SMPPL  W
Sbjct: 268 SILMSMPPLARW 279


>gi|172038114|ref|YP_001804615.1| coproporphyrinogen III oxidase [Cyanothece sp. ATCC 51142]
 gi|171699568|gb|ACB52549.1| coproporphyrinogen III oxidase, aerobic [Cyanothece sp. ATCC 51142]
          Length = 343

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/321 (39%), Positives = 170/321 (52%), Gaps = 50/321 (15%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEA--HENSANRSPKIFTVKHWLRDKSQKE 68
           P+D +  KR+SQ   + LQ  IC   EK + E   HE+S            W     Q+E
Sbjct: 18  PEDAQ--KRVSQF-MKTLQDEICQGLEKADGEGKFHEDS------------W-----QRE 57

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
           + GGGR   L  G + E+  V  S V+G   P    +     +   F+ATG S+++HP N
Sbjct: 58  EGGGGRSRVLRDGNLLEQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTSMVLHPRN 117

Query: 129 PHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           P+VP VH N R    G  +WFGGGIDLTP      + +  D   FH TLKE C +H    
Sbjct: 118 PYVPTVHLNYRYFEAGPVWWFGGGIDLTPY-----YPFAEDAAQFHRTLKETCDKHHREY 172

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS-PEMGGIDAD---------------- 230
           Y  +K WCD YFYL HRQE+RG+GGIFFD+   + P   G  AD                
Sbjct: 173 YPVFKHWCDEYFYLKHRQETRGVGGIFFDYQDGTDPLYRGPHADKAAAKYSNQLPPQDNR 232

Query: 231 -----FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNF 285
                F+F++  G  F+  Y  +V +  +  + +++RQ QL RRGRY EFNL+YD+GT F
Sbjct: 233 SWEDLFAFVNDCGRTFLPAYLPIVEKRRNTEYGDRERQFQLYRRGRYVEFNLVYDRGTIF 292

Query: 286 GFKTGGNVESILASMPPLVAW 306
           G +T G  ESIL S+PPLV W
Sbjct: 293 GLQTNGRTESILMSLPPLVRW 313


>gi|84393449|ref|ZP_00992206.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
 gi|84375965|gb|EAP92855.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
          Length = 305

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ +  A          +F    W R+  ++   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQADGTA----------LFEEDAWEREPGERLG-GGGRTRVMTNGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 64  GGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D   +H T K++C+      Y  +KEWCD+YFY
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFDEDCQSWHQTAKDLCAPFGDDVYQEHKEWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G D  F+++ AVG+ F   Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNEW----GFDKSFAYMQAVGEGFAAAYLPIVERRKETSYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  Q  RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERDFQFYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|209154112|gb|ACI33288.1| Coproporphyrinogen III oxidase, mitochondrial precursor [Salmo
           salar]
 gi|223647570|gb|ACN10543.1| Coproporphyrinogen III oxidase, mitochondrial precursor [Salmo
           salar]
          Length = 433

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 166/307 (54%), Gaps = 37/307 (12%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI----FTVKHWLRDKSQKEDLGGG 73
           K + QRK E     +CT  E L  E          ++    F V  W     ++++ GGG
Sbjct: 120 KVLQQRKEE-----MCTRMEMLIMETQAEFCRALEEVDGGKFKVDRW-----ERKEGGGG 169

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-------ILGTTKNPYFWATGLSVIVHP 126
               L  GKVFEKA V VS V+G+L+ +   Q       + G      F A G+S ++HP
Sbjct: 170 ISCVLQDGKVFEKAGVNVSVVFGNLTEEAAKQMRSRGKVLKGKDGKLPFCAMGVSSVIHP 229

Query: 127 YNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
            NPH+P VHFN R         T  +WFGGG DLTP+  ++      D   FHN+LKE C
Sbjct: 230 TNPHIPTVHFNYRYFEIEEGDGTKQWWFGGGTDLTPTYVNKE-----DGAHFHNSLKEAC 284

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +H    Y  +K+WCDRYFY+PHR E+RGIGGIFFD L S  +    +  FSF+ +    
Sbjct: 285 DKHHPQYYPDFKKWCDRYFYIPHRGETRGIGGIFFDDLDSPSQ----EEAFSFVRSCAQT 340

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILAS 299
            +  Y  +V+++ +  FS +++  Q +RRGRY EFNL+YD+G  FG  T G  +ESIL S
Sbjct: 341 VVPCYLPIVQKHLNDPFSPEEKDWQQVRRGRYVEFNLVYDRGVKFGLATPGSRIESILMS 400

Query: 300 MPPLVAW 306
           +P    W
Sbjct: 401 LPLTAKW 407


>gi|315298253|gb|EFU57513.1| coproporphyrinogen III oxidase [Escherichia coli MS 16-3]
          Length = 299

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   +++                  ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDD----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+++      D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTA----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|291221339|ref|XP_002730678.1| PREDICTED: GK18283-like [Saccoglossus kowalevskii]
          Length = 374

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 166/308 (53%), Gaps = 41/308 (13%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           DD+++R  +       LQ+ IC  FE LE            K F V+ W R +      G
Sbjct: 69  DDMKKRMELY---ILQLQADICRRFENLEQS----------KKFQVERWERKEG-----G 110

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIVH 125
           GG    L  G VFEKA V +S V G+L P+   Q+      +G  K P+F A G+S ++H
Sbjct: 111 GGISCILQDGSVFEKAGVNISVVTGELPPEAVKQMKSRGKNIGEGKLPFF-AAGISSVIH 169

Query: 126 PYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           P NP VP VHFN R            +WFGGG DLTP    +      DV+ FH TLKE 
Sbjct: 170 PRNPMVPTVHFNYRYFEIDEGNGKTTWWFGGGTDLTPYYLDKE-----DVVHFHKTLKEA 224

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C +H   +Y  +K+WCD YF++ HR E RG+GGIFFD L    +    +  F FI + G+
Sbjct: 225 CDKHDKKHYIDFKKWCDDYFFVTHRGERRGVGGIFFDDLDKPSQ----EDCFKFIQSCGN 280

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILA 298
             +  Y  +V ++ +  F  ++R+ QL+RRGRY EFNL+YD+GT FG  T G  +ESIL 
Sbjct: 281 AIMPSYEPIVEKHKNENFGYKERRWQLLRRGRYVEFNLVYDRGTKFGLYTPGARIESILM 340

Query: 299 SMPPLVAW 306
           S+P    W
Sbjct: 341 SLPLTARW 348


>gi|170679650|ref|YP_001744627.1| coproporphyrinogen III oxidase [Escherichia coli SMS-3-5]
 gi|226740882|sp|B1LMN0|HEM6_ECOSM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|170517368|gb|ACB15546.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli SMS-3-5]
          Length = 299

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++              F    WLR+       GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDGAE-----------FVEDSWLREAG-----GGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G++ P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEVMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|294507770|ref|YP_003571828.1| Coproporphyrinogen III oxidase, aerobic [Salinibacter ruber M8]
 gi|294344098|emb|CBH24876.1| Coproporphyrinogen III oxidase, aerobic [Salinibacter ruber M8]
          Length = 327

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 127/316 (40%), Positives = 169/316 (53%), Gaps = 41/316 (12%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
            L T+     DD+    R+ +R  E LQ  +   F+ L+  A           F V  W 
Sbjct: 7   RLETLREDPRDDLPMAHRM-KRFVEALQLRMTRAFDDLDPGAS----------FEVDRWS 55

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           RD+      GGG  A +  G VFEK  V  S V+G L P+   +     + P F+ATGLS
Sbjct: 56  RDEG-----GGGITAVIEGGDVFEKGGVNTSAVHGPL-PERMAREFDVEEAP-FYATGLS 108

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGA-------YWFGGGIDLTP---SLESRRHSYDPDVIF 171
           +++HP +P+VP VH N R    G         WFGGG DLTP    L+  +H        
Sbjct: 109 LVMHPRSPYVPTVHANFRYFALGDDLMNPVDQWFGGGADLTPYYPRLDDTQH-------- 160

Query: 172 FHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADF 231
           FH   KE+C +H  A+Y  +KE CD YFYL HR E+RG+GGIF+D+L   PE  G+   F
Sbjct: 161 FHRVWKEVCDRHEGADYAAFKEKCDDYFYLDHRDEARGVGGIFYDYLREDPE--GL---F 215

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
            F    G  F++ Y  +V+R     + +Q++  Q IRRGRY EFNL+YD+GT FG ++ G
Sbjct: 216 FFTREAGRAFLESYLPIVKRRKDTAYGQQEKAYQRIRRGRYVEFNLVYDRGTKFGLESDG 275

Query: 292 NVESILASMPPLVAWP 307
             ESIL SMPP V WP
Sbjct: 276 RTESILMSMPPQVQWP 291


>gi|261250596|ref|ZP_05943171.1| coproporphyrinogen III oxidase aerobic [Vibrio orientalis CIP
           102891]
 gi|260939165|gb|EEX95152.1| coproporphyrinogen III oxidase aerobic [Vibrio orientalis CIP
           102891]
          Length = 305

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E+ +  A          +F    W R+  +K   GGGR   +  G VFE+
Sbjct: 15  TLQDSICQQLEQADGSA----------VFVEDEWHREPGEKLG-GGGRTRVMKEGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D  ++HNT KE+C+      Y+ +K WCD+YFY
Sbjct: 124 GEEPIWWFGGGFDLTPF-----YPFEEDAQYWHNTAKEVCAPFGNEVYSEHKAWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG  +   Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNHWE----FDKCFEYIKAVGQGYTDAYLPIVERRKETEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|218700902|ref|YP_002408531.1| coproporphyrinogen III oxidase [Escherichia coli IAI39]
 gi|226740877|sp|B7NPX2|HEM6_ECO7I RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218370888|emb|CAR18705.1| coproporphyrinogen III oxidase [Escherichia coli IAI39]
          Length = 299

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+GD  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|218705943|ref|YP_002413462.1| coproporphyrinogen III oxidase [Escherichia coli UMN026]
 gi|293405879|ref|ZP_06649871.1| coproporphyrinogen III oxidase [Escherichia coli FVEC1412]
 gi|298381628|ref|ZP_06991227.1| coproporphyrinogen-III oxidase [Escherichia coli FVEC1302]
 gi|226740880|sp|B7N626|HEM6_ECOLU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218433040|emb|CAR13935.1| coproporphyrinogen III oxidase [Escherichia coli UMN026]
 gi|291428087|gb|EFF01114.1| coproporphyrinogen III oxidase [Escherichia coli FVEC1412]
 gi|298279070|gb|EFI20584.1| coproporphyrinogen-III oxidase [Escherichia coli FVEC1302]
          Length = 299

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGISLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|238756702|ref|ZP_04617979.1| Coproporphyrinogen III oxidase [Yersinia ruckeri ATCC 29473]
 gi|238705078|gb|EEP97518.1| Coproporphyrinogen III oxidase [Yersinia ruckeri ATCC 29473]
          Length = 310

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC +  + + +A           FT + W     ++E+ GGGR   +  G VFE+
Sbjct: 15  SLQDDICAKLAQADGQAS----------FTEQQW-----EREEGGGGRSRVMVNGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLNPYIPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T K +C       Y  YK+WCD YFY
Sbjct: 120 GEQPVWWFGGGFDLTPY-----YGFEDDAVHWHQTAKNLCQPFGDDLYDQYKKWCDEYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HRQE+RGIGG+FFD L++ P+       F+FI AVG  F   Y  +V R     + E+
Sbjct: 175 IKHRQEARGIGGLFFDDLNT-PDFATC---FAFIQAVGKGFSTAYLPIVERRKQLAWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|166363411|ref|YP_001655684.1| coproporphyrinogen III oxidase [Microcystis aeruginosa NIES-843]
 gi|166085784|dbj|BAG00492.1| coproporphyrinogen III oxidase, aerobic [Microcystis aeruginosa
           NIES-843]
          Length = 315

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 167/305 (54%), Gaps = 45/305 (14%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           ++LQ  IC   E+++ +A                ++ D  Q+ + GGGR   L  G +FE
Sbjct: 2   KSLQDEICQGLEEVDGQAK---------------FIEDSWQRPEGGGGRSRVLREGAIFE 46

Query: 86  KAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           +A V  S V+G +L P    Q      +  F+ATG S+++HP+NP++P VH N R    G
Sbjct: 47  QAGVNFSEVWGKELPPSIAKQRPEAAGH-QFYATGTSMVLHPHNPYIPTVHLNYRYFEAG 105

Query: 145 -AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP      ++++ D   FH T K++C QH    Y  +K WCD YFYL H
Sbjct: 106 PVWWFGGGADLTPY-----YAFEEDASHFHRTFKQVCDQHHPEYYPVFKRWCDEYFYLNH 160

Query: 204 RQESRGIGGIFFDH------LHSSP----------------EMGGIDADFSFISAVGDCF 241
           RQE+RGIGGIFFD+      L+  P                +    +  FSFI+  G  F
Sbjct: 161 RQEARGIGGIFFDYQDGLDPLYRGPFAESDAAIYSEKLSPQQPRNWEEIFSFINDCGRAF 220

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V++     + +++RQ QL RRGRY EFNL+YD+GT FG +T G  ESIL S+P
Sbjct: 221 LPAYVPIVQKRRSTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLP 280

Query: 302 PLVAW 306
           PLV W
Sbjct: 281 PLVRW 285


>gi|268316752|ref|YP_003290471.1| Coproporphyrinogen oxidase [Rhodothermus marinus DSM 4252]
 gi|262334286|gb|ACY48083.1| Coproporphyrinogen oxidase [Rhodothermus marinus DSM 4252]
          Length = 327

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 163/302 (53%), Gaps = 36/302 (11%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           DI    R+ QR  E LQ  IC   E ++  A                + RD  +  + GG
Sbjct: 19  DIPMAHRV-QRFVEALQRHICKAIEDVDGAAQ---------------FRRDPWKYREGGG 62

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G    L  G VFEKA V  S ++G L+ +   + +G    P+F ATGLS+++HP +P+VP
Sbjct: 63  GLTCVLENGAVFEKAGVNTSAIWGQLT-ERAARAIGVHPAPFF-ATGLSLVIHPRSPYVP 120

Query: 133 AVHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-A 184
           +VH N R    G         WFGGG DLTP      + +  DV  FH   KE+C +H  
Sbjct: 121 SVHANFRYFALGDDLFHPEDQWFGGGADLTPY-----YPFLEDVQHFHRVWKEVCDRHPG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
           VA+Y  +K  CD YFYLPHR E RG+GGIF+D+L   PE       F F    G  F++ 
Sbjct: 176 VADYARFKAACDAYFYLPHRGEMRGVGGIFYDYLRDDPE-----GAFFFTREAGRAFLRS 230

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V R     + E++R  QL+RRGRY EFNL+YD+GT FG ++ G  ESIL S+PP V
Sbjct: 231 YLPIVERRRDMPYGERERHFQLLRRGRYVEFNLIYDRGTRFGLESNGRTESILMSLPPEV 290

Query: 305 AW 306
            W
Sbjct: 291 RW 292


>gi|331673903|ref|ZP_08374666.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA280]
 gi|331069176|gb|EGI40568.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA280]
          Length = 300

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 119 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 174 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKTMAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|306814478|ref|ZP_07448640.1| coproporphyrinogen III oxidase [Escherichia coli NC101]
 gi|305851872|gb|EFM52324.1| coproporphyrinogen III oxidase [Escherichia coli NC101]
          Length = 300

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 119 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+++      D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 174 LKHRNEQRGIGGLFFDDLNTA----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|311105294|ref|YP_003978147.1| coproporphyrinogen 3 oxidase aerobic [Achromobacter xylosoxidans
           A8]
 gi|310759983|gb|ADP15432.1| coproporphyrinogen 3 oxidase, aerobic [Achromobacter xylosoxidans
           A8]
          Length = 303

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 150/289 (51%), Gaps = 34/289 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ+ I    E  E  A           F    W+R +      GGG    L  G +FE+
Sbjct: 15  GLQARIVGALEAAEGTA-----------FRSDEWVRPEG-----GGGLSRLLEGGSLFER 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
           A VL S V G   P              + A G+S+++HP NPHVP  H N+RM +  A 
Sbjct: 59  AGVLFSHVQGTKLPPSASAHRPELAGRSWEAMGVSMVLHPRNPHVPTTHMNVRMFLAAAR 118

Query: 146 --------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                   +WFGGGIDLTP      + Y+ D   FH T ++  + H    Y  YK WCD 
Sbjct: 119 PGHDEADVFWFGGGIDLTPY-----YPYEEDARHFHATCRDALAGHGADYYPRYKRWCDE 173

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF+L HR E+RGIGGIF+D L++     G DA F+   +VGD F+  Y  +V R     +
Sbjct: 174 YFFLKHRNETRGIGGIFYDDLNAP----GFDASFALTRSVGDAFLPAYMPIVERRRGQTY 229

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 230 GERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|17228852|ref|NP_485400.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
 gi|21542081|sp|Q8YX58|HEM62_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic 2;
           Short=Coprogen oxidase 2; Short=Coproporphyrinogenase 2
 gi|17130704|dbj|BAB73314.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
          Length = 347

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 164/318 (51%), Gaps = 45/318 (14%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D  +R   SQ+  +NLQ  ICT  E+L+ +A           F   HW R +      
Sbjct: 27  PKDSRQR---SQQFMQNLQDEICTALEQLDGKAS----------FHQDHWERAEG----- 68

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           G GR   +  G+VFE+  V  S V+G+  P              F+ATG S+++HP NP+
Sbjct: 69  GEGRTRVIREGRVFEQGGVNFSAVWGNSLPASILAQRPEAAGHEFFATGTSMVLHPRNPY 128

Query: 131 VPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           VP VH N R    G  +WFGGG DLTP      +++  D + FH TLK  C  H    Y 
Sbjct: 129 VPTVHLNYRYFEAGPIWWFGGGADLTPY-----YAFKEDAVHFHQTLKNACDVHNPEYYP 183

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM-----------------GGIDAD-- 230
            +K WCD YFYL HR+E RGIGGIFFD+  +S ++                 G +  +  
Sbjct: 184 TFKRWCDEYFYLRHREEQRGIGGIFFDYQDASGKLYVESQTDSSVAIYSQKVGNVARNWE 243

Query: 231 --FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+F+ + G  F+  Y  +V R     + ++ R  QL RRGRY EFNL+YD+GT FG +
Sbjct: 244 DIFAFVQSCGQAFLPAYLPIVERRQGIEYGDRQRNFQLYRRGRYVEFNLVYDRGTVFGLQ 303

Query: 289 TGGNVESILASMPPLVAW 306
           T G  ESIL S+PPL  W
Sbjct: 304 TKGRTESILMSLPPLARW 321


>gi|332139436|ref|YP_004425174.1| coproporphyrinogen III oxidase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549458|gb|AEA96176.1| coproporphyrinogen III oxidase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 310

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E  + +                 ++ D  Q+E+ GGGR   L  G V E+
Sbjct: 25  GLQDTICQTLELADGKGQ---------------FVEDSWQREEGGGGRSRVLKNGAVIEQ 69

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G   P              F A G+S+++HP+NP++P  H N+R  +    
Sbjct: 70  GGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYIPTSHANVRFFIAEKE 129

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  DV+ +H+T K++C       Y  YK+WCD YFY
Sbjct: 130 GEAPIWWFGGGFDLTPF-----YPFKDDVVHWHDTAKKLCKPFGEDVYPKYKKWCDEYFY 184

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G +  F+F+ AVG+ FI  Y  +V R     + E+
Sbjct: 185 LKHRNETRGVGGLFFDDLNEW----GFEQSFAFMQAVGNGFIDAYVPIVERRKQTDYGER 240

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 241 ERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|312882746|ref|ZP_07742481.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369604|gb|EFP97121.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 305

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 154/285 (54%), Gaps = 26/285 (9%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC + E+++  A           F    W R+  +K   GGGR   L  G +FE+ 
Sbjct: 16  LQDSICQQLERVDGRA----------AFEEDEWHREPGEKLG-GGGRTRVLRNGAIFEQG 64

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA-- 145
            V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  +  
Sbjct: 65  GVNFSHVAGAQMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSHANVRFFIAESEG 124

Query: 146 ----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ D   +HN  KE+C       Y  +KEWCD YF+L
Sbjct: 125 KEPIWWFGGGFDLTPF-----YPFEEDARDWHNIAKELCLPFGEDVYRQHKEWCDDYFFL 179

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
           PHR E+RGIGG+FFD L+  P     +  F +I AVGD + K Y  +V +     F E++
Sbjct: 180 PHRDETRGIGGLFFDDLNHWP----FEKCFDYIKAVGDGYTKAYLPIVEKRKSIEFGERE 235

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 236 RQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|82777830|ref|YP_404179.1| coproporphyrinogen III oxidase [Shigella dysenteriae Sd197]
 gi|309784834|ref|ZP_07679467.1| coproporphyrinogen 3 oxidase, aerobic [Shigella dysenteriae 1617]
 gi|123561966|sp|Q32DB7|HEM6_SHIDS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|81241978|gb|ABB62688.1| coproporphyrinogen III oxidase [Shigella dysenteriae Sd197]
 gi|308927204|gb|EFP72678.1| coproporphyrinogen 3 oxidase, aerobic [Shigella dysenteriae 1617]
          Length = 299

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 158/286 (55%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQRESGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     ++E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYAER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|218710990|ref|YP_002418611.1| coproporphyrinogen III oxidase [Vibrio splendidus LGP32]
 gi|254800280|sp|B7VMW3|HEM6_VIBSL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218324009|emb|CAV20371.1| Coproporphyrinogen III oxidase, aerobic [Vibrio splendidus LGP32]
          Length = 305

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ +  A          +F    W R+  ++   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQADGTA----------LFEEDAWQREPGERLG-GGGRTRVMTNGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 64  GGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  D D   +H T K++C+      Y  +KEWCD+YFY
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPVDEDCQSWHQTAKDLCAPFGDDVYQEHKEWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+++ AVG+ F   Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGEGFAAAYLPIVERRKETPYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|284922390|emb|CBG35477.1| coproporphyrinogen III oxidase [Escherichia coli 042]
          Length = 300

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 119 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ A+G  +   Y  +V R     + E+
Sbjct: 174 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAIGKGYTDAYLPIVERRKAMAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|24113777|ref|NP_708287.1| coproporphyrinogen III oxidase [Shigella flexneri 2a str. 301]
 gi|62510627|sp|Q83QN1|HEM6_SHIFL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24052858|gb|AAN43994.1| coproporphyrinogen III oxidase [Shigella flexneri 2a str. 301]
          Length = 299

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|90019674|ref|YP_525501.1| coproporphyrinogen III oxidase [Saccharophagus degradans 2-40]
 gi|123278083|sp|Q21PU0|HEM6_SACD2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|89949274|gb|ABD79289.1| Coproporphyrinogen oxidase [Saccharophagus degradans 2-40]
          Length = 303

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 141/252 (55%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+ + GGGR   L  G V EK  V  S V+G   P              F A G+
Sbjct: 34  VEDSWQRPEGGGGRSRVLTNGAVIEKGGVNFSHVHGSSMPASATAHRPELAGRSFEAMGV 93

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S+++HP NPHVP  H N+R  +    GA   +WFGGG DLTP      +  D D   +HN
Sbjct: 94  SLVIHPNNPHVPTSHANVRFFIAEKEGAEPVWWFGGGYDLTPY-----YGNDEDCRHWHN 148

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T K  C+      Y  YK+WCD YFYL HR E RG+GG+FFD L+      G D  F+F+
Sbjct: 149 TAKAACAPFGEDKYPRYKKWCDEYFYLKHRDEPRGVGGLFFDDLNEL----GFDQSFAFM 204

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVGD + + Y  +V R     +++  R  QL RRGRY EFNL+YD+GT FG +TGG  E
Sbjct: 205 QAVGDSYTQAYVPIVERRKDEPYNQAQRDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTE 264

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 265 SILMSLPPLVRW 276


>gi|26248812|ref|NP_754852.1| coproporphyrinogen III oxidase [Escherichia coli CFT073]
 gi|91211774|ref|YP_541760.1| coproporphyrinogen III oxidase [Escherichia coli UTI89]
 gi|237704959|ref|ZP_04535440.1| coproporphyrinogen III oxidase [Escherichia sp. 3_2_53FAA]
 gi|26109218|gb|AAN81420.1|AE016764_102 Coproporphyrinogen III oxidase, aerobic [Escherichia coli CFT073]
 gi|91073348|gb|ABE08229.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli UTI89]
 gi|226901325|gb|EEH87584.1| coproporphyrinogen III oxidase [Escherichia sp. 3_2_53FAA]
 gi|307625993|gb|ADN70297.1| coproporphyrinogen III oxidase [Escherichia coli UM146]
 gi|312947029|gb|ADR27856.1| coproporphyrinogen III oxidase [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 300

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 119 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 174 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|293410838|ref|ZP_06654414.1| coproporphyrinogen III oxidase [Escherichia coli B354]
 gi|291471306|gb|EFF13790.1| coproporphyrinogen III oxidase [Escherichia coli B354]
          Length = 299

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|110642617|ref|YP_670347.1| coproporphyrinogen III oxidase [Escherichia coli 536]
 gi|117624641|ref|YP_853554.1| coproporphyrinogen III oxidase [Escherichia coli APEC O1]
 gi|191172900|ref|ZP_03034435.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli F11]
 gi|215487689|ref|YP_002330120.1| coproporphyrinogen III oxidase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218559381|ref|YP_002392294.1| coproporphyrinogen III oxidase [Escherichia coli S88]
 gi|218690571|ref|YP_002398783.1| coproporphyrinogen III oxidase [Escherichia coli ED1a]
 gi|227887481|ref|ZP_04005286.1| coproporphyrinogen III oxidase [Escherichia coli 83972]
 gi|300981733|ref|ZP_07175697.1| coproporphyrinogen III oxidase [Escherichia coli MS 45-1]
 gi|300997839|ref|ZP_07181865.1| coproporphyrinogen III oxidase [Escherichia coli MS 200-1]
 gi|301046325|ref|ZP_07193488.1| coproporphyrinogen III oxidase [Escherichia coli MS 185-1]
 gi|312967723|ref|ZP_07781938.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 2362-75]
 gi|331658591|ref|ZP_08359535.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA206]
 gi|331684093|ref|ZP_08384689.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H299]
 gi|31563153|sp|Q8FFA3|HEM6_ECOL6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123147846|sp|Q0TF33|HEM6_ECOL5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217799|sp|A1ADV0|HEM6_ECOK1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740875|sp|B7MHT7|HEM6_ECO45 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800268|sp|B7UGD5|HEM6_ECO27 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800270|sp|B7MY86|HEM6_ECO81 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110344209|gb|ABG70446.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 536]
 gi|115513765|gb|ABJ01840.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli APEC O1]
 gi|190906764|gb|EDV66368.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli F11]
 gi|215265761|emb|CAS10168.1| coproporphyrinogen III oxidase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218366150|emb|CAR03895.1| coproporphyrinogen III oxidase [Escherichia coli S88]
 gi|218428135|emb|CAR09052.2| coproporphyrinogen III oxidase [Escherichia coli ED1a]
 gi|222034164|emb|CAP76905.1| Coproporphyrinogen 3 oxidase, aerobic [Escherichia coli LF82]
 gi|227835831|gb|EEJ46297.1| coproporphyrinogen III oxidase [Escherichia coli 83972]
 gi|294491890|gb|ADE90646.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli IHE3034]
 gi|300301695|gb|EFJ58080.1| coproporphyrinogen III oxidase [Escherichia coli MS 185-1]
 gi|300304124|gb|EFJ58644.1| coproporphyrinogen III oxidase [Escherichia coli MS 200-1]
 gi|300408918|gb|EFJ92456.1| coproporphyrinogen III oxidase [Escherichia coli MS 45-1]
 gi|307554475|gb|ADN47250.1| coproporphyrinogen III oxidase [Escherichia coli ABU 83972]
 gi|312287920|gb|EFR15825.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 2362-75]
 gi|320196281|gb|EFW70905.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli
           WV_060327]
 gi|323188256|gb|EFZ73549.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli RN587/1]
 gi|323949523|gb|EGB45411.1| coproporphyrinogen III oxidase [Escherichia coli H252]
 gi|323955692|gb|EGB51450.1| coproporphyrinogen III oxidase [Escherichia coli H263]
 gi|324011161|gb|EGB80380.1| coproporphyrinogen III oxidase [Escherichia coli MS 60-1]
 gi|331054256|gb|EGI26283.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA206]
 gi|331079045|gb|EGI50247.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H299]
          Length = 299

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|110806377|ref|YP_689897.1| coproporphyrinogen III oxidase [Shigella flexneri 5 str. 8401]
 gi|123146843|sp|Q0T273|HEM6_SHIF8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110615925|gb|ABF04592.1| coproporphyrinogen III oxidase [Shigella flexneri 5 str. 8401]
 gi|281601851|gb|ADA74835.1| Coproporphyrinogen III oxidase, aerobic [Shigella flexneri 2002017]
 gi|313650893|gb|EFS15293.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri 2a str.
           2457T]
 gi|332755479|gb|EGJ85843.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-671]
 gi|332756295|gb|EGJ86646.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri 2747-71]
 gi|332766245|gb|EGJ96455.1| coproporphyrinogen III oxidase family protein [Shigella flexneri
           2930-71]
 gi|333001767|gb|EGK21333.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-218]
 gi|333016383|gb|EGK35714.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-304]
          Length = 299

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|16130361|ref|NP_416931.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109250|ref|AP_003030.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           W3110]
 gi|157161903|ref|YP_001459221.1| coproporphyrinogen III oxidase [Escherichia coli HS]
 gi|170019282|ref|YP_001724236.1| coproporphyrinogen III oxidase [Escherichia coli ATCC 8739]
 gi|170082045|ref|YP_001731365.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188494062|ref|ZP_03001332.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 53638]
 gi|238901599|ref|YP_002927395.1| coproporphyrinogen III oxidase [Escherichia coli BW2952]
 gi|256021870|ref|ZP_05435735.1| coproporphyrinogen III oxidase [Escherichia sp. 4_1_40B]
 gi|300951863|ref|ZP_07165673.1| coproporphyrinogen III oxidase [Escherichia coli MS 116-1]
 gi|300957210|ref|ZP_07169445.1| coproporphyrinogen III oxidase [Escherichia coli MS 175-1]
 gi|301023792|ref|ZP_07187527.1| coproporphyrinogen III oxidase [Escherichia coli MS 196-1]
 gi|301648092|ref|ZP_07247855.1| coproporphyrinogen III oxidase [Escherichia coli MS 146-1]
 gi|307139078|ref|ZP_07498434.1| coproporphyrinogen III oxidase [Escherichia coli H736]
 gi|312973322|ref|ZP_07787494.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1827-70]
 gi|331643059|ref|ZP_08344194.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H736]
 gi|547614|sp|P36553|HEM6_ECOLI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167008822|sp|A8A2T4|HEM6_ECOHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|189028162|sp|B1IWM6|HEM6_ECOLC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740879|sp|B1XAA7|HEM6_ECODH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|259709754|sp|C4ZX09|HEM6_ECOBW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|453969|emb|CAA53167.1| coproporphyrinogen oxidase [Escherichia coli K-12]
 gi|1788777|gb|AAC75489.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1799866|dbj|BAA16319.1| coproporphyrinogen III oxidase [Escherichia coli str. K12 substr.
           W3110]
 gi|157067583|gb|ABV06838.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli HS]
 gi|169754210|gb|ACA76909.1| Coproporphyrinogen oxidase [Escherichia coli ATCC 8739]
 gi|169889880|gb|ACB03587.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188489261|gb|EDU64364.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 53638]
 gi|238860612|gb|ACR62610.1| coproporphyrinogen III oxidase [Escherichia coli BW2952]
 gi|260448477|gb|ACX38899.1| Coproporphyrinogen oxidase [Escherichia coli DH1]
 gi|299880665|gb|EFI88876.1| coproporphyrinogen III oxidase [Escherichia coli MS 196-1]
 gi|300316054|gb|EFJ65838.1| coproporphyrinogen III oxidase [Escherichia coli MS 175-1]
 gi|300448904|gb|EFK12524.1| coproporphyrinogen III oxidase [Escherichia coli MS 116-1]
 gi|301073815|gb|EFK88621.1| coproporphyrinogen III oxidase [Escherichia coli MS 146-1]
 gi|309702724|emb|CBJ02053.1| coproporphyrinogen III oxidase [Escherichia coli ETEC H10407]
 gi|310331917|gb|EFP99152.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1827-70]
 gi|315137067|dbj|BAJ44226.1| coproporphyrinogen III oxidase [Escherichia coli DH1]
 gi|315615687|gb|EFU96319.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 3431]
 gi|323936336|gb|EGB32626.1| coproporphyrinogen III oxidase [Escherichia coli E1520]
 gi|323941318|gb|EGB37503.1| coproporphyrinogen III oxidase [Escherichia coli E482]
 gi|331039857|gb|EGI12077.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H736]
          Length = 299

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|153826440|ref|ZP_01979107.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-2]
 gi|149739826|gb|EDM54021.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-2]
          Length = 305

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKNICAPFGSEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|324009601|gb|EGB78820.1| coproporphyrinogen III oxidase [Escherichia coli MS 57-2]
          Length = 299

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|297581912|ref|ZP_06943832.1| coproporphyrinogen III oxidase [Vibrio cholerae RC385]
 gi|297533779|gb|EFH72620.1| coproporphyrinogen III oxidase [Vibrio cholerae RC385]
          Length = 305

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDVWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKNICAPFGAEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|254436523|ref|ZP_05050017.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           307]
 gi|198251969|gb|EDY76283.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           307]
          Length = 298

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 160/302 (52%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLG 71
           D+++ K  +   F  L+  I   FEKLE+       +  P   F V    R      D G
Sbjct: 5   DMKQEKSAAAAWFRTLRDEIVQAFEKLEDTQSSGPFSYLPAGRFEVTQTTRTGDAGIDAG 64

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STV+G L    +        + G   +P FWA+G+S++ H
Sbjct: 65  GGLMSVMRGGRVFEKVGVNISTVHGTLGARAQAAMMARKGLDGMADDPRFWASGISLVAH 124

Query: 126 PYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T  A+WFGGG DL P +E     Y  D   FH T K     H 
Sbjct: 125 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YSDDTAHFHATQKTWLDPHG 179

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A+Y   K W D YFY+PHR  +RG+GG+F D   +    G   ADF+    +G  F+  
Sbjct: 180 TAHYPKLKAWADEYFYIPHRNRARGVGGVFMDDYST----GDWPADFALTQDLGRAFLPA 235

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV       +S+ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+ 
Sbjct: 236 YQPLVDARRDTEWSDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPMA 295

Query: 305 AW 306
            W
Sbjct: 296 KW 297


>gi|301022324|ref|ZP_07186216.1| coproporphyrinogen III oxidase [Escherichia coli MS 69-1]
 gi|300397577|gb|EFJ81115.1| coproporphyrinogen III oxidase [Escherichia coli MS 69-1]
          Length = 299

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSTVDG----------------TEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|293395019|ref|ZP_06639306.1| coproporphyrinogen III oxidase [Serratia odorifera DSM 4582]
 gi|291422426|gb|EFE95668.1| coproporphyrinogen III oxidase [Serratia odorifera DSM 4582]
          Length = 305

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 153/285 (53%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC +  + +  A           FT   W R +      GGGR   L  G VFE+A
Sbjct: 16  LQERICQQLAQADGGAE----------FTEDRWTRAEG-----GGGRSRVLTNGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V  S V G + P              F A G+S+++HP NP++P  H N+R  +     
Sbjct: 61  GVNFSHVSGAMLPASATAHRPELAGRSFQAMGVSLVIHPLNPYIPTSHANVRFFIAEKPG 120

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + +  D + +H T +++C+      Y  YK+WCD YF++
Sbjct: 121 EAPVWWFGGGFDLTPY-----YGFKEDAVHWHRTAQQLCAPFGEQVYPQYKKWCDDYFFI 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGG+F+D L++       D  F+F  AVGD F+  Y  +V R     + EQ+
Sbjct: 176 KHRNEARGIGGLFYDDLNTP----DFDHCFAFTRAVGDGFLDAYLPIVARRKSMAWGEQE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|254784310|ref|YP_003071738.1| coproporphyrinogen III oxidase [Teredinibacter turnerae T7901]
 gi|237684189|gb|ACR11453.1| HemF/Oxygen-dependent Coproporphyrinogen III oxidase
           [Teredinibacter turnerae T7901]
          Length = 307

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 155/302 (51%), Gaps = 31/302 (10%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D  ++  + +    +LQ  IC + E ++              F    W     Q+ + 
Sbjct: 4   PSDTPDKAAV-KSYLLDLQQRICNQLEAVDGGGR----------FAADTW-----QRAEG 47

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGG    L  G V EK  V  S V G   P              F A G+S+++HP NP+
Sbjct: 48  GGGESRVLTDGAVIEKGGVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHPSNPY 107

Query: 131 VPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           VP  H N+R  +         +WFGGG DLTP      +  + D   +H T  + C +  
Sbjct: 108 VPTSHANVRFFIAEKPGEAPVWWFGGGYDLTPY-----YGNEEDCRHWHRTAADACEEFG 162

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              YT YK WCD YFYL HRQE RGIGG+FFD L+      G +  F+F+ +VGD + + 
Sbjct: 163 AGVYTEYKRWCDEYFYLKHRQEPRGIGGLFFDDLNHW----GFNRSFAFMQSVGDSYCRA 218

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V R  H  + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV
Sbjct: 219 YLPIVERRKHLPYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLV 278

Query: 305 AW 306
            W
Sbjct: 279 RW 280


>gi|110638317|ref|YP_678526.1| coproporphyrinogen III oxidase [Cytophaga hutchinsonii ATCC 33406]
 gi|110280998|gb|ABG59184.1| coproporphyrinogen oxidase [Cytophaga hutchinsonii ATCC 33406]
          Length = 299

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/287 (39%), Positives = 159/287 (55%), Gaps = 25/287 (8%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           + +F+ +Q  IC   E  + +A           F    W R +      GGG+   +  G
Sbjct: 8   ENEFQKIQQHICRALETADGKA----------TFKTDEWTRPEG-----GGGKSKIITDG 52

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM- 140
              EK  V  S V+G+ +PD     L  +K   F+ATG+S+++H  NP VP +H NIR  
Sbjct: 53  NTLEKGGVNFSAVHGE-TPDNILHALKLSKAE-FYATGVSIVMHTTNPWVPIIHMNIRYF 110

Query: 141 -IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
            +  G +WFGGGIDLTP      +    + + FH +LK++C Q   + YT +KEW D YF
Sbjct: 111 EMSNGIWWFGGGIDLTP-----HYVIKEEAVAFHQSLKDLCDQFHESFYTTFKEWADNYF 165

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           Y+ HR ESRG+GGIFFD   +   +   ++ F F+ A+G  F K+Y  L+  N    F+E
Sbjct: 166 YIKHRGESRGVGGIFFDRQGNDAPVSK-ESLFEFVCALGYLFPKIYTKLIADNNSKTFTE 224

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +R  Q +RRGRY EFNL+YDKGT FG  T G +ESIL S+PP   W
Sbjct: 225 AERNWQKLRRGRYVEFNLVYDKGTKFGLDTNGRIESILMSLPPEANW 271


>gi|254507256|ref|ZP_05119392.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           16]
 gi|219549716|gb|EED26705.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           16]
          Length = 305

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/295 (38%), Positives = 157/295 (53%), Gaps = 26/295 (8%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K+  ++    LQ  IC + E  + +A           F    W R+  +K   GGGR   
Sbjct: 6   KQAVKQFLMELQDSICQKLEAADGQAE----------FVEDAWHREPGEKLG-GGGRTRV 54

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H N
Sbjct: 55  MKEGAVFEQGGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSHAN 114

Query: 138 IRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R  +         +WFGGG DLTP      + ++ D  ++HNT KE+C+      Y+ +
Sbjct: 115 VRFFIAEKEGEEPIWWFGGGFDLTPF-----YPFEEDAQYWHNTAKEVCAPFGSEVYSEH 169

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG  +   Y  +V R
Sbjct: 170 KAWCDKYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFEYIKAVGQGYTDAYLPIVER 225

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 226 RKETEYGERERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|148978489|ref|ZP_01814963.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
 gi|145962396|gb|EDK27676.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
          Length = 305

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ +  A          +F    W R+   +   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQADGSA----------LFKEDAWEREPGDRLG-GGGRTRVMTDGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 64  GGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D   +H T K++C+      Y  +KEWCD+YFY
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFDEDCQSWHQTAKDLCAPFGDNVYQEHKEWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+++ AVG+ +   Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGEGYAAAYLPIVERRKETPYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|331648098|ref|ZP_08349188.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M605]
 gi|331042958|gb|EGI15098.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M605]
          Length = 300

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 59  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 118

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 119 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 174 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|281179507|dbj|BAI55837.1| coproporphyrinogen III oxidase [Escherichia coli SE15]
 gi|330912225|gb|EGH40735.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli AA86]
          Length = 299

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|331663999|ref|ZP_08364909.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA143]
 gi|331059798|gb|EGI31775.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA143]
          Length = 299

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|327404905|ref|YP_004345743.1| Coproporphyrinogen oxidase [Fluviicola taffensis DSM 16823]
 gi|327320413|gb|AEA44905.1| Coproporphyrinogen oxidase [Fluviicola taffensis DSM 16823]
          Length = 296

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 25/291 (8%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K    ++F  LQ  IC E E+++  A           F+   W R +      GGG+  T
Sbjct: 3   KETIGQEFRALQLFICNELERIDGTAK----------FSEDAWDRLEG-----GGGKTRT 47

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G + EK  V  S VYG +S + K Q+       +F+ATG+S+++HP NPHVP +H N
Sbjct: 48  IRNGSLIEKGGVAFSEVYGPVSEEMKTQL--KLDGNHFYATGVSIVLHPNNPHVPIIHMN 105

Query: 138 IRM--IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +R   +  G YWFGGGIDLTP      +      I FH  L+ +C+++  + Y  +KEW 
Sbjct: 106 VRYFELDNGIYWFGGGIDLTP-----HYVIHDQAILFHKQLRTVCNKYDESFYAKFKEWA 160

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF +PHR E+RG+GGIFFDHL++  ++   +  F F   +G+ F  +Y        + 
Sbjct: 161 DEYFSIPHRAETRGVGGIFFDHLNNHFQLNK-EQLFRFCLDLGESFPFIYEEQADLGRNK 219

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           L +  ++Q    RRGRY EFNL++D+GT FG  +GG  ESIL S+PPL  W
Sbjct: 220 LVTAAEKQWMNYRRGRYVEFNLVHDRGTKFGLFSGGRTESILMSLPPLAEW 270


>gi|260598821|ref|YP_003211392.1| coproporphyrinogen III oxidase [Cronobacter turicensis z3032]
 gi|260217998|emb|CBA32667.1| Coproporphyrinogen-III oxidase, aerobic [Cronobacter turicensis
           z3032]
          Length = 301

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 162/286 (56%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC +   ++ +                H++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  DLQDRICQQLAAVDGD----------------HFVEDAWQREGGGGGRSRVLRDGVVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+GD  P              F A G+S++VHP NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPRNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D   +H T +++C+      Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPF-----YGFEEDASHWHRTARDLCAPFGDDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HRQE+RGIGG+FFD L++       D  F+F+ AVGD ++K Y  +V R     + E+
Sbjct: 173 LKHRQEARGIGGLFFDDLNTP----DFDTCFAFMQAVGDGYLKAYLPIVERRKALPWGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 EREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|114321781|ref|YP_743464.1| coproporphyrinogen III oxidase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228175|gb|ABI57974.1| coproporphyrinogen oxidase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 304

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 135/239 (56%), Gaps = 15/239 (6%)

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G +FE+A V  S V+G   PD             F A G+S+++HP NPHVP 
Sbjct: 46  RSRVLKHGNLFEQAGVNFSHVFGKRLPDSATARRPELAGRGFQAMGVSLVLHPENPHVPT 105

Query: 134 VHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  V         +WFGGG DLTP      + Y  D + +H T +  C       
Sbjct: 106 THANVRYFVADKAGSEPVWWFGGGFDLTPY-----YGYQEDAVHWHRTARAACEPFGAEV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYLPHR E+RGIGG+FFD L       G +  F+F+ +VGD F+  Y  
Sbjct: 161 YPRYKQWCDEYFYLPHRGETRGIGGLFFDDLDDW----GFERSFAFMRSVGDHFLPAYRP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  R  H  + E++R  QL RRGRYAEFNLLYD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 217 IAERRRHQPWGERERAFQLYRRGRYAEFNLLYDRGTRFGLQSGGRTESILMSMPPMARW 275


>gi|268593177|ref|ZP_06127398.1| coproporphyrinogen III oxidase [Providencia rettgeri DSM 1131]
 gi|291311223|gb|EFE51676.1| coproporphyrinogen III oxidase [Providencia rettgeri DSM 1131]
          Length = 305

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/300 (37%), Positives = 162/300 (54%), Gaps = 34/300 (11%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           DIE  K   Q    +LQ  IC +  +L+ +          + F  + W R +      GG
Sbjct: 5   DIERVKTYLQ----SLQEAICQKITELDGK----------ETFLEQTWERSEG-----GG 45

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G +FE+A V  S + G+  P              + A G+S+++HP NP++P
Sbjct: 46  GRSRVLTKGALFEQAGVNFSHIKGEKLPASASAHRPELAGRSYQAMGVSLVIHPLNPYIP 105

Query: 133 AVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R  +         +WFGGG DLTP      + +  DVI +H   +++C  +   
Sbjct: 106 TTHANVRFFIAEKEGCEPVWWFGGGFDLTPF-----YGFHEDVIHWHTVARDLCRPYGTD 160

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YF+L HR E RG+GG+F+D L+     GG ++ F+F  AVG+ F+  Y 
Sbjct: 161 VYPKYKNWCDEYFFLKHRNEPRGVGGLFYDDLNQ----GGFESCFNFTQAVGNGFLDAYV 216

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +V +   H + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 217 PIVEKRKDHSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|260775022|ref|ZP_05883922.1| coproporphyrinogen III oxidase aerobic [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609112|gb|EEX35271.1| coproporphyrinogen III oxidase aerobic [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 305

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 158/295 (53%), Gaps = 26/295 (8%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K+  ++    LQ  IC + E+ +  A           F    W R+  ++   GGGR   
Sbjct: 6   KQAVKQFLMELQDSICQQLEQADGHAE----------FIEDAWSREPGERLG-GGGRTRV 54

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H N
Sbjct: 55  MKEGAVFEQGGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPKNPYIPTSHAN 114

Query: 138 IRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R  +         +WFGGG DLTP      + ++ D  ++HNT KE+C+      Y  +
Sbjct: 115 VRFFIAEKDGEAPIWWFGGGFDLTPF-----YPFEEDAQYWHNTAKEVCAPFGSEVYPEH 169

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R
Sbjct: 170 KAWCDKYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIVER 225

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 226 RKATEYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|156972718|ref|YP_001443625.1| coproporphyrinogen III oxidase [Vibrio harveyi ATCC BAA-1116]
 gi|166217821|sp|A7N128|HEM6_VIBHB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|156524312|gb|ABU69398.1| hypothetical protein VIBHAR_00383 [Vibrio harveyi ATCC BAA-1116]
          Length = 305

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 158/286 (55%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + +A          +F    W R+K ++   GGGR   L  G +FE+
Sbjct: 15  SLQDSICQQLEQEDGKA----------VFVEDAWQREKGERLG-GGGRTRVLRDGHIFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKD 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFDEDCQSWHDTAKQLCAPFGDEVYPEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     F E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIVSRRKDIEFGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|149190427|ref|ZP_01868698.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
 gi|148835681|gb|EDL52647.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
          Length = 301

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E      HE+        F    WLR++      GGGR   L  G VFE+
Sbjct: 15  QLQDDICQKLE------HEDGG----ATFQQDEWLREQG-----GGGRSRVLKDGVVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+GD  P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  GGVNFSHVFGDKMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSHANVRFFIAEKE 119

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H   K++C+      Y  +K+WCD YF+
Sbjct: 120 GEAPIWWFGGGFDLTPF-----YPFEEDCQHWHQVAKDICAPFGEQVYNEHKKWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F+++ AVG  +   Y  +V++  H  F E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNQW----GFERSFAYMKAVGSSYTDAYLPIVQKRKHTEFGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 231 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|323977383|gb|EGB72469.1| coproporphyrinogen III oxidase [Escherichia coli TW10509]
          Length = 299

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMEYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|318606637|emb|CBY28135.1| coproporphyrinogen III oxidase, aerobic [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 313

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 158/290 (54%), Gaps = 33/290 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC    + +  A           FT ++W+R     E+ GGGR   +  G VFE+
Sbjct: 15  DLQDKICAALAQADGSAK----------FTEENWVR-----EEGGGGRSRVMVKGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYLPTSHANVRFFIAEKP 119

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H T   +C       YT YK+WCD YFY
Sbjct: 120 DEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQPFGEQLYTRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHS----SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
           + HR E+RGIGG+FFD L+S    SP+    D  F+F  AVGD F+  Y  +V R     
Sbjct: 175 IKHRNEARGIGGLFFDDLNSDDLNSPD---FDTCFNFTQAVGDGFLDAYMPIVARRKALC 231

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 WGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 281


>gi|156384958|ref|XP_001633399.1| predicted protein [Nematostella vectensis]
 gi|156220468|gb|EDO41336.1| predicted protein [Nematostella vectensis]
          Length = 321

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 157/282 (55%), Gaps = 28/282 (9%)

Query: 38  KLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGD 97
           K + E     ++   K F V  W R +      GGG    +  GKVFEKA V VS VYG 
Sbjct: 28  KAQGEICRKLSDLDGKKFQVDRWERQQG-----GGGMTCVIQDGKVFEKAGVNVSVVYGT 82

Query: 98  LSPDFKDQILGTTKN------PYFWATGLSVIVHPYNPHVPAVHFNIRMI----VTGA-- 145
           L+     Q+    K       P+F A G+S ++HP NP+VP VHFN R      + G   
Sbjct: 83  LAAKAAQQMKSRGKGFKGEDLPFF-ACGISSVIHPRNPYVPTVHFNYRYFEVTDIDGQKH 141

Query: 146 YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQ 205
            WFGGG DLTP      +  + DV+ FH  LK +C +H  + Y  +K WCD+YF++PHR 
Sbjct: 142 AWFGGGTDLTPY-----YLNEQDVMHFHGVLKRVCDKHDASYYQRFKSWCDKYFFIPHRG 196

Query: 206 ESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQ 265
           E RG+GGIFFD L    E    +  F+F+ +  +  I  Y  +V ++ +  +SE+DR+ Q
Sbjct: 197 ECRGVGGIFFDDLEDPTE----EKLFNFLESCAEAVIPAYAPIVEKHMNDPYSEEDRKWQ 252

Query: 266 LIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           L+RRGRY EFNL+YD+GT FG  T G  +ESIL S+P    W
Sbjct: 253 LLRRGRYVEFNLVYDRGTKFGLYTPGSRIESILMSLPLEARW 294


>gi|260845076|ref|YP_003222854.1| coproporphyrinogen III oxidase [Escherichia coli O103:H2 str.
           12009]
 gi|257760223|dbj|BAI31720.1| coproporphyrinogen III oxidase [Escherichia coli O103:H2 str.
           12009]
          Length = 299

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKL 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|74312971|ref|YP_311390.1| coproporphyrinogen III oxidase [Shigella sonnei Ss046]
 gi|82544895|ref|YP_408842.1| coproporphyrinogen III oxidase [Shigella boydii Sb227]
 gi|157156271|ref|YP_001463765.1| coproporphyrinogen III oxidase [Escherichia coli E24377A]
 gi|191168977|ref|ZP_03030744.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B7A]
 gi|193064771|ref|ZP_03045849.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E22]
 gi|193068400|ref|ZP_03049363.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|193071214|ref|ZP_03052136.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|194427271|ref|ZP_03059821.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B171]
 gi|194432098|ref|ZP_03064387.1| coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae 1012]
 gi|218554968|ref|YP_002387881.1| coproporphyrinogen III oxidase [Escherichia coli IAI1]
 gi|256017414|ref|ZP_05431279.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|260856537|ref|YP_003230428.1| coproporphyrinogen III oxidase [Escherichia coli O26:H11 str.
           11368]
 gi|260869132|ref|YP_003235534.1| coproporphyrinogen III oxidase [Escherichia coli O111:H- str.
           11128]
 gi|293446797|ref|ZP_06663219.1| coproporphyrinogen III oxidase [Escherichia coli B088]
 gi|300817325|ref|ZP_07097542.1| coproporphyrinogen III oxidase [Escherichia coli MS 107-1]
 gi|300820896|ref|ZP_07101046.1| coproporphyrinogen III oxidase [Escherichia coli MS 119-7]
 gi|300903449|ref|ZP_07121374.1| coproporphyrinogen III oxidase [Escherichia coli MS 84-1]
 gi|300922145|ref|ZP_07138282.1| coproporphyrinogen III oxidase [Escherichia coli MS 182-1]
 gi|301306343|ref|ZP_07212413.1| coproporphyrinogen III oxidase [Escherichia coli MS 124-1]
 gi|301328940|ref|ZP_07221971.1| coproporphyrinogen III oxidase [Escherichia coli MS 78-1]
 gi|307312565|ref|ZP_07592198.1| Coproporphyrinogen oxidase [Escherichia coli W]
 gi|309794518|ref|ZP_07688941.1| coproporphyrinogen III oxidase [Escherichia coli MS 145-7]
 gi|331669178|ref|ZP_08370026.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA271]
 gi|331678424|ref|ZP_08379099.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H591]
 gi|332278413|ref|ZP_08390826.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|123559053|sp|Q31Y44|HEM6_SHIBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123616573|sp|Q3YZA7|HEM6_SHISS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167008821|sp|A7ZPN6|HEM6_ECO24 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740878|sp|B7M6U5|HEM6_ECO8A RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|73856448|gb|AAZ89155.1| coproporphyrinogen III oxidase [Shigella sonnei Ss046]
 gi|81246306|gb|ABB67014.1| coproporphyrinogen III oxidase [Shigella boydii Sb227]
 gi|157078301|gb|ABV18009.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E24377A]
 gi|190900984|gb|EDV60766.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B7A]
 gi|192927654|gb|EDV82270.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E22]
 gi|192955485|gb|EDV85966.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|192958352|gb|EDV88792.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|194414592|gb|EDX30864.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B171]
 gi|194419627|gb|EDX35707.1| coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae 1012]
 gi|218361736|emb|CAQ99333.1| coproporphyrinogen III oxidase [Escherichia coli IAI1]
 gi|257755186|dbj|BAI26688.1| coproporphyrinogen III oxidase [Escherichia coli O26:H11 str.
           11368]
 gi|257765488|dbj|BAI36983.1| coproporphyrinogen III oxidase [Escherichia coli O111:H- str.
           11128]
 gi|291323627|gb|EFE63055.1| coproporphyrinogen III oxidase [Escherichia coli B088]
 gi|300404481|gb|EFJ88019.1| coproporphyrinogen III oxidase [Escherichia coli MS 84-1]
 gi|300421460|gb|EFK04771.1| coproporphyrinogen III oxidase [Escherichia coli MS 182-1]
 gi|300526649|gb|EFK47718.1| coproporphyrinogen III oxidase [Escherichia coli MS 119-7]
 gi|300529951|gb|EFK51013.1| coproporphyrinogen III oxidase [Escherichia coli MS 107-1]
 gi|300838398|gb|EFK66158.1| coproporphyrinogen III oxidase [Escherichia coli MS 124-1]
 gi|300844682|gb|EFK72442.1| coproporphyrinogen III oxidase [Escherichia coli MS 78-1]
 gi|306907488|gb|EFN37992.1| Coproporphyrinogen oxidase [Escherichia coli W]
 gi|308121974|gb|EFO59236.1| coproporphyrinogen III oxidase [Escherichia coli MS 145-7]
 gi|315061760|gb|ADT76087.1| coproporphyrinogen III oxidase [Escherichia coli W]
 gi|315256455|gb|EFU36423.1| coproporphyrinogen III oxidase [Escherichia coli MS 85-1]
 gi|320173836|gb|EFW49016.1| Coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae CDC
           74-1112]
 gi|323156342|gb|EFZ42500.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli EPECa14]
 gi|323159414|gb|EFZ45398.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli E128010]
 gi|323170301|gb|EFZ55954.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli LT-68]
 gi|323177438|gb|EFZ63026.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1180]
 gi|323184260|gb|EFZ69636.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1357]
 gi|323377659|gb|ADX49927.1| Coproporphyrinogen oxidase [Escherichia coli KO11]
 gi|323944659|gb|EGB40726.1| coproporphyrinogen III oxidase [Escherichia coli H120]
 gi|324118100|gb|EGC11998.1| coproporphyrinogen III oxidase [Escherichia coli E1167]
 gi|331064372|gb|EGI36283.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA271]
 gi|331074884|gb|EGI46204.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H591]
 gi|332093022|gb|EGI98088.1| coproporphyrinogen 3 oxidase, aerobic [Shigella boydii 3594-74]
 gi|332100765|gb|EGJ04111.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|332344263|gb|AEE57597.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli UMNK88]
 gi|333002234|gb|EGK21798.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-272]
          Length = 299

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|300921370|ref|ZP_07137731.1| coproporphyrinogen III oxidase [Escherichia coli MS 115-1]
 gi|300411682|gb|EFJ94992.1| coproporphyrinogen III oxidase [Escherichia coli MS 115-1]
          Length = 299

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|293415707|ref|ZP_06658350.1| coproporphyrinogen III oxidase [Escherichia coli B185]
 gi|291433355|gb|EFF06334.1| coproporphyrinogen III oxidase [Escherichia coli B185]
          Length = 299

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------TEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|194437711|ref|ZP_03069807.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 101-1]
 gi|253772665|ref|YP_003035496.1| coproporphyrinogen III oxidase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162419|ref|YP_003045527.1| coproporphyrinogen III oxidase [Escherichia coli B str. REL606]
 gi|297520352|ref|ZP_06938738.1| coproporphyrinogen III oxidase [Escherichia coli OP50]
 gi|300928597|ref|ZP_07144120.1| coproporphyrinogen III oxidase [Escherichia coli MS 187-1]
 gi|194423517|gb|EDX39508.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 101-1]
 gi|242378044|emb|CAQ32815.1| coproporphyrinogen III oxidase [Escherichia coli BL21(DE3)]
 gi|253323709|gb|ACT28311.1| Coproporphyrinogen oxidase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974320|gb|ACT39991.1| coproporphyrinogen III oxidase [Escherichia coli B str. REL606]
 gi|253978487|gb|ACT44157.1| coproporphyrinogen III oxidase [Escherichia coli BL21(DE3)]
 gi|300463397|gb|EFK26890.1| coproporphyrinogen III oxidase [Escherichia coli MS 187-1]
 gi|323961237|gb|EGB56849.1| coproporphyrinogen III oxidase [Escherichia coli H489]
 gi|323970874|gb|EGB66125.1| coproporphyrinogen III oxidase [Escherichia coli TA007]
          Length = 299

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|325272503|ref|ZP_08138881.1| coproporphyrinogen III oxidase [Pseudomonas sp. TJI-51]
 gi|324102364|gb|EGB99832.1| coproporphyrinogen III oxidase [Pseudomonas sp. TJI-51]
          Length = 303

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  GK+ EK
Sbjct: 14  DLQDRICSALENEDGGAR----------FVEDAWVREAG-----GGGRTRVIGEGKLIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HPYNPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+      G D  F+FI A+GD ++  Y  +V+R  H  ++ Q
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEW----GFDTCFAFIRAIGDAYVDAYLPIVQRRKHTPYTPQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|315288130|gb|EFU47530.1| coproporphyrinogen III oxidase [Escherichia coli MS 110-3]
          Length = 299

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 155/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRPESILMSMPPLVRW 274


>gi|317403474|gb|EFV83982.1| coproporphyrinogen 3 oxidase [Achromobacter xylosoxidans C54]
          Length = 303

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 151/291 (51%), Gaps = 34/291 (11%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F  LQ+ I    E  E              F    W+R +      GGG    L  G++F
Sbjct: 13  FTGLQARIVGALEAAEGGP-----------FRTDEWIRPEG-----GGGVSRLLEGGQLF 56

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV-- 142
           E+A VL S V G   P              + A G+S+++HP NP+VP  H N+RM V  
Sbjct: 57  ERAGVLFSHVQGSKLPPSASAHRPELAGRSWQAMGVSMVLHPRNPYVPTTHMNVRMFVAT 116

Query: 143 -------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                  T  +WFGGGIDLTP      + ++ D   FH   ++  + H    Y  YK WC
Sbjct: 117 ARPGHDETDVFWFGGGIDLTPY-----YPFEEDARHFHAVCRDALAGHGADYYPRYKRWC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+L HR E+RGIGGIFFD L++     G DA F+   +VGD F+  Y  +V R  H 
Sbjct: 172 DEYFFLKHRNETRGIGGIFFDDLNAP----GFDASFALTRSVGDAFLDSYLPIVDRRRHT 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 228 PYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|157135753|ref|XP_001663577.1| coproporphyrinogen iii oxidase [Aedes aegypti]
 gi|108870125|gb|EAT34350.1| coproporphyrinogen iii oxidase [Aedes aegypti]
          Length = 381

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 166/312 (53%), Gaps = 40/312 (12%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +   DD+  +  +   K   +Q+  C   E  EN           K FTV  W R +   
Sbjct: 65  VANADDMRTKMELMIMK---IQADFCQSLENEENFG---------KKFTVDRWERKEG-- 110

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN------PYFWATGLS 121
              GGG    L  G VFEKA V +S V+G L      Q+    K       P+F A G+S
Sbjct: 111 ---GGGITCVLQDGDVFEKAGVNISVVHGVLPKGAIQQMRSRGKQLADGELPFF-AAGVS 166

Query: 122 VIVHPYNPHVPAVHFNIRMI-VTGA-----YWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
            ++HP NP VP +HFN R   VT +     +WFGGG DLTP     +     D + FH T
Sbjct: 167 AVIHPRNPMVPTIHFNYRYFEVTDSKGNKQWWFGGGTDLTPYYLDEK-----DAVHFHQT 221

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
           LKE C +H  + Y  +KEWCD+YFY+PHR E RG+GGIFFD + +  +    ++ F+FI+
Sbjct: 222 LKEACDEHDESYYPKFKEWCDKYFYIPHRNECRGVGGIFFDDIDTPDQ----ESAFNFIT 277

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVE 294
                 I  Y  LVR++ +  + +++RQ QL+RRGRY EFNL+YD+GT FG  T G   E
Sbjct: 278 TCAHSVIPSYLPLVRKHKNDAYGDRERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYE 337

Query: 295 SILASMPPLVAW 306
           SIL S+P    W
Sbjct: 338 SILMSLPLTAKW 349


>gi|218246003|ref|YP_002371374.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 8801]
 gi|257059054|ref|YP_003136942.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 8802]
 gi|218166481|gb|ACK65218.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 8801]
 gi|256589220|gb|ACV00107.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 8802]
          Length = 346

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 174/328 (53%), Gaps = 47/328 (14%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           L + ++  P   + +KR+SQ   ++LQ  IC   E+L+ ++                +  
Sbjct: 9   LTSPKVSLPPQ-DAQKRVSQ-FMKDLQDEICANLEELDGKSK---------------FRE 51

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLS 121
           D  Q+E+ GGGR   L  G V E+  V  S V+G +L P    Q      +  F+ATG S
Sbjct: 52  DSWQREEGGGGRSRVLRDGGVLEQGGVNFSEVWGKELPPSILKQRPEAAGH-GFYATGTS 110

Query: 122 VIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP NP++P VH N R    G  +WFGGGIDLTP      + +  D   FH TLK+ C
Sbjct: 111 MVLHPRNPYIPTVHLNYRYFEAGPVWWFGGGIDLTPY-----YPFAEDAAHFHRTLKDTC 165

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSP------------ 222
            QH    Y+ +K WCD YFYL HRQE RG+GGIFFD+      L+  P            
Sbjct: 166 DQHHPEYYSVFKPWCDEYFYLNHRQEMRGVGGIFFDYQDGVDPLYRGPHPDKAAAIYSNE 225

Query: 223 ----EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
               E    +  F+F++  G  FI  Y  +  +  +  + +++RQ QL RRGRY EFNL+
Sbjct: 226 LPPLEPRNWEDLFAFVNDCGRAFIPAYIPIAEKRRNTEYGDRERQFQLYRRGRYVEFNLV 285

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 286 YDRGTIFGLQTNGRTESILMSLPPLVRW 313


>gi|189234654|ref|XP_968506.2| PREDICTED: similar to coproporphirynogen oxidase [Tribolium
           castaneum]
          Length = 472

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 169/307 (55%), Gaps = 37/307 (12%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           PDD++ R  +   +   +Q+  C   E+      E++ N+    F V  W R   +    
Sbjct: 155 PDDMKTRMELMVLR---VQAEACRALEE------EDNCNK----FLVDKWERHDGR---- 197

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-----NPYFWATGLSVIVH 125
           GGG    L  GKVFEKA V +S + G+L+P    Q+    K     +P F   G+S ++H
Sbjct: 198 GGGITCVLQEGKVFEKAGVNISVISGNLTPGIVAQMRARGKKLKRDSPPFAVIGISAVIH 257

Query: 126 PYNPHVPAVHFNIRMIVTG-----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           P NP VP VHFN R           +WFGGG DLTP   ++      D I FH+ LK+ C
Sbjct: 258 PKNPMVPTVHFNYRYFEIQDEDQVVWWFGGGSDLTPYYLNK-----ADAIHFHSALKDAC 312

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +H  + Y  +K+WCD YF + HR+E RGIGGIFFD L  +P+    ++ F F +   D 
Sbjct: 313 DKHDKSYYPKFKKWCDEYFTIKHRKERRGIGGIFFDDL-DTPDR---ESCFKFATDCADA 368

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILAS 299
           FI  Y  LV+R+ H +++E +R  QL+RRGRY EFNL++D+GT FGF T     ESIL S
Sbjct: 369 FIPSYIPLVQRHKHAMYTETERNWQLLRRGRYVEFNLVWDRGTKFGFNTPDARFESILMS 428

Query: 300 MPPLVAW 306
           +P L  W
Sbjct: 429 LPLLARW 435


>gi|323967870|gb|EGB63282.1| coproporphyrinogen III oxidase [Escherichia coli M863]
 gi|327252091|gb|EGE63763.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli STEC_7v]
          Length = 299

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGHGYTDAYLPIVERRKAMEYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|270001613|gb|EEZ98060.1| hypothetical protein TcasGA2_TC000466 [Tribolium castaneum]
          Length = 382

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 169/307 (55%), Gaps = 37/307 (12%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           PDD++ R  +   +   +Q+  C   E+      E++ N+    F V  W R   +    
Sbjct: 65  PDDMKTRMELMVLR---VQAEACRALEE------EDNCNK----FLVDKWERHDGR---- 107

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-----NPYFWATGLSVIVH 125
           GGG    L  GKVFEKA V +S + G+L+P    Q+    K     +P F   G+S ++H
Sbjct: 108 GGGITCVLQEGKVFEKAGVNISVISGNLTPGIVAQMRARGKKLKRDSPPFAVIGISAVIH 167

Query: 126 PYNPHVPAVHFNIRMIVTG-----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           P NP VP VHFN R           +WFGGG DLTP   ++      D I FH+ LK+ C
Sbjct: 168 PKNPMVPTVHFNYRYFEIQDEDQVVWWFGGGSDLTPYYLNK-----ADAIHFHSALKDAC 222

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +H  + Y  +K+WCD YF + HR+E RGIGGIFFD L  +P+    ++ F F +   D 
Sbjct: 223 DKHDKSYYPKFKKWCDEYFTIKHRKERRGIGGIFFDDL-DTPDR---ESCFKFATDCADA 278

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILAS 299
           FI  Y  LV+R+ H +++E +R  QL+RRGRY EFNL++D+GT FGF T     ESIL S
Sbjct: 279 FIPSYIPLVQRHKHAMYTETERNWQLLRRGRYVEFNLVWDRGTKFGFNTPDARFESILMS 338

Query: 300 MPPLVAW 306
           +P L  W
Sbjct: 339 LPLLARW 345


>gi|159030185|emb|CAO91077.1| hemF [Microcystis aeruginosa PCC 7806]
          Length = 340

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 171/316 (54%), Gaps = 46/316 (14%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + R R+S+   ++LQ  IC   E+++ +A                ++ D  Q+ + G GR
Sbjct: 17  DSRSRVSE-FMKSLQDEICRGLEEVDGKAK---------------FIEDSWQRPEGGCGR 60

Query: 75  MATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              L  G +FE+A V  S V+G +L P    Q      +  F+ATG S+++HP NP++P 
Sbjct: 61  SRVLREGAIFEQAGVNFSEVWGKELPPSIAKQRPEAAGH-QFYATGTSMVLHPRNPYIPT 119

Query: 134 VHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           VH N R    G  +WFGGG DLTP      ++++ D   FH T K++C QH    Y  +K
Sbjct: 120 VHLNYRYFEAGPVWWFGGGADLTPY-----YAFEEDASHFHRTFKQVCDQHHPEYYPVFK 174

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDH------LHSSP----------------EMGGIDAD 230
            WCD YFYL HRQE+RGIGGIFFD+      L+  P                +    +  
Sbjct: 175 RWCDEYFYLNHRQEARGIGGIFFDYQDGLDPLYRGPFAESDAAIYSEKLSPQQPRNWEEI 234

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG 290
           FSFI+  G  F+  Y  +V++     + +++RQ QL RRGRY EFNL+YD+GT FG +T 
Sbjct: 235 FSFINDCGRAFLPAYVPIVQKRRSTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTN 294

Query: 291 GNVESILASMPPLVAW 306
           G  ESIL S+PPLV W
Sbjct: 295 GRTESILMSLPPLVRW 310


>gi|323496968|ref|ZP_08101996.1| coproporphyrinogen III oxidase [Vibrio sinaloensis DSM 21326]
 gi|323318042|gb|EGA71025.1| coproporphyrinogen III oxidase [Vibrio sinaloensis DSM 21326]
          Length = 305

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E+ + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 15  ELQDSICQQLEQADGKAE----------FIEDAWHREPGEKLG-GGGRTRVMRDGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP+NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D  ++HNT KE+C+      Y  +K WCD+YFY
Sbjct: 124 GEEPIWWFGGGFDLTPF-----YPFEEDAQYWHNTAKEVCAPFGSEVYAEHKVWCDKYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG  + + Y  +V R     + E+
Sbjct: 179 LPHRDETRGVGGLFFDDLNHWQ----FDKCFDYIKAVGQGYCQAYLPIVERRKETEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 QRQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|119475273|ref|ZP_01615626.1| Coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2143]
 gi|119451476|gb|EAW32709.1| Coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2143]
          Length = 302

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ+ IC + E+ +  A           F    WLR +      GGGR   L  G V EK
Sbjct: 15  NLQNTICDQLEQEDGGA----------TFLQDEWLRPEG-----GGGRSRVLTDGAVIEK 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P    Q         F A G+S+++HP NP+VP  H N+R+ +    
Sbjct: 60  GGVNFSHVFGKGLPPSATQARPELAGRSFQAMGVSLVIHPKNPYVPTSHANVRLFIAEKE 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      ++ + D I +H T KE C       Y  YK+WCD YF+
Sbjct: 120 GEDPVWWFGGGYDLTPY-----YADEDDCIAWHRTAKEACEPFGEKVYQDYKQWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E RGIGG+FFD L+     GG +  F  + A+G+ +++ Y  ++ +     F  +
Sbjct: 175 LPHRNEPRGIGGLFFDDLNE----GGFERCFGLMQAIGNSYVEAYRPIMAKKKEMPFGAR 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+ D+GT FG ++ G  ESIL S+PPLV+W
Sbjct: 231 ERDFQLYRRGRYVEFNLVQDRGTIFGLQSNGRTESILMSLPPLVSW 276


>gi|27364488|ref|NP_760016.1| coproporphyrinogen III oxidase [Vibrio vulnificus CMCP6]
 gi|320154892|ref|YP_004187271.1| coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus
           MO6-24/O]
 gi|31340169|sp|Q8DDD5|HEM6_VIBVU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|27360607|gb|AAO09543.1| Coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus CMCP6]
 gi|319930204|gb|ADV85068.1| coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus
           MO6-24/O]
          Length = 305

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 153/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E+ + +A           F    W R+   +   GGGR   +  G VFE+
Sbjct: 15  QLQDQICQRLEQEDGKA----------TFIEDAWYREPGDRLG-GGGRTRVMRDGNVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G+  P              F A G+S+++HP+NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVQGNAMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D  F+HNT KE+C+      Y  +K WCD YFY
Sbjct: 124 GEAPIWWFGGGFDLTPF-----YPFEEDCQFWHNTAKEVCAPFGADVYAQHKAWCDDYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+        D  F +I AVG+ +   Y  +V R     + E+
Sbjct: 179 LPHRGETRGIGGLFFDDLNQWE----FDKCFDYIKAVGEGYCDAYLPIVERRKVTEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|269962636|ref|ZP_06176981.1| coproporphyrinogen III oxidase, aerobic [Vibrio harveyi 1DA3]
 gi|269832559|gb|EEZ86673.1| coproporphyrinogen III oxidase, aerobic [Vibrio harveyi 1DA3]
          Length = 305

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 158/286 (55%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + +A          +F    W R+K ++   GGGR   L  G +FE+
Sbjct: 15  SLQDSICQQLEQEDGKA----------VFVEDAWQREKGERLG-GGGRTRVLRDGHIFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKD 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKQLCAPFGEDVYAEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     F E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIVSRRKDIEFGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|332162548|ref|YP_004299125.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666778|gb|ADZ43422.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 313

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 158/290 (54%), Gaps = 33/290 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC    + +  A           FT ++W+R     E+ GGGR   +  G VFE+
Sbjct: 15  DLQDKICAALAQADGSAK----------FTEENWVR-----EEGGGGRSRVMVKGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYLPTSHANVRFFIAEKP 119

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H T   +C       YT YK+WCD YFY
Sbjct: 120 DEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQPFDEQLYTRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHS----SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
           + HR E+RGIGG+FFD L+S    SP+    D  F+F  AVGD F+  Y  +V R     
Sbjct: 175 IKHRNEARGIGGLFFDDLNSDDLNSPD---FDTCFNFTQAVGDGFLDAYMPIVARRKALC 231

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 WGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 281


>gi|254421563|ref|ZP_05035281.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. PCC
           7335]
 gi|196189052|gb|EDX84016.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. PCC
           7335]
          Length = 351

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 158/315 (50%), Gaps = 47/315 (14%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           R R+S    + LQ  IC + E L+              F    W R +      GGGR  
Sbjct: 29  RDRVST-ALKGLQDRICQKLEALDGGGK----------FQEDAWDRPEG-----GGGRSR 72

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            + AG VFE+  V  S V+GD  P          +   F+ATG S+++HP NP+VP VH 
Sbjct: 73  VMKAGNVFEQGGVGFSEVWGDSLPPAILVKRPEAEGHQFYATGTSMVLHPRNPYVPTVHL 132

Query: 137 NIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           N R    G  +WFGGGIDLTP   ++      DV+ FH TLK  C QH    Y  +K WC
Sbjct: 133 NYRYFEAGPVWWFGGGIDLTPYYANQE-----DVVHFHKTLKAACDQHNPQYYPTFKRWC 187

Query: 196 DRYFYLPHRQESRGIGGIFFDHLH------------------------SSPEMGGIDADF 231
           D YFYL HR E RG+GGIFFD+ +                        S+P+    +  F
Sbjct: 188 DEYFYLKHRNEPRGVGGIFFDYQNGQRGELYRGHNQDGPAALYSQKTGSAPKRS-WEELF 246

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
            F    GD F+  Y  +V +     + +++R  QL RRGRY EFNL+YD+GT FG +T G
Sbjct: 247 QFAMGCGDAFLPAYVPIVEKRADTAYGDRERNFQLYRRGRYVEFNLVYDRGTLFGLQTNG 306

Query: 292 NVESILASMPPLVAW 306
             ESIL S+PPLV W
Sbjct: 307 RTESILMSLPPLVRW 321


>gi|218548124|ref|YP_002381915.1| coproporphyrinogen III oxidase [Escherichia fergusonii ATCC 35469]
 gi|226740884|sp|B7LKJ9|HEM6_ESCF3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218355665|emb|CAQ88277.1| coproporphyrinogen III oxidase [Escherichia fergusonii ATCC 35469]
 gi|325496510|gb|EGC94369.1| coproporphyrinogen III oxidase [Escherichia fergusonii ECD227]
          Length = 299

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E 
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMEYGEH 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|115377854|ref|ZP_01465041.1| coproporphyrinogen III oxidase, aerobic [Stigmatella aurantiaca
           DW4/3-1]
 gi|310818421|ref|YP_003950779.1| coproporphyrinogen III oxidase, aerobic [Stigmatella aurantiaca
           DW4/3-1]
 gi|115365123|gb|EAU64171.1| coproporphyrinogen III oxidase, aerobic [Stigmatella aurantiaca
           DW4/3-1]
 gi|309391493|gb|ADO68952.1| Coproporphyrinogen III oxidase, aerobic [Stigmatella aurantiaca
           DW4/3-1]
          Length = 307

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 156/298 (52%), Gaps = 30/298 (10%)

Query: 13  DIEERKRISQRKFE---NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
           D+E+ +R+  R  E    LQ  IC   E L+ +            F    W R       
Sbjct: 4   DVEKVERLKVRMAEFIRQLQDEICAGLETLDGKGR----------FREDAWERAGGGGG- 52

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
               R   L  G V EKA V  S VYG L   F  ++ G  +  YFWA GLS+++HP NP
Sbjct: 53  ----RSRVLEGGSVLEKAGVNTSVVYGQLEEAFAHKLQGEGR--YFWAGGLSLVLHPRNP 106

Query: 130 HVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           HVP VH N R I  G   WFGGG DLTP      + YD D + FH TLK +C ++  + Y
Sbjct: 107 HVPTVHANFRFIHQGPKAWFGGGADLTPY-----YLYDEDAVHFHRTLKAVCDRYDPSYY 161

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K  CD+YFYL HR+E RG+GG+FF+ L        ++ + +F+   G  F+  Y  +
Sbjct: 162 PRFKSTCDKYFYLRHREECRGVGGLFFEDLGGQ----DLERELAFVMDAGRAFLPAYLPI 217

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             R      +E  R  Q +RRGRY EFNL+YD+GT FG +T G  ESIL S+PP V W
Sbjct: 218 AERRKDVASTEPQRFWQEVRRGRYVEFNLVYDRGTVFGLETKGRTESILMSLPPQVRW 275


>gi|300940320|ref|ZP_07154916.1| coproporphyrinogen III oxidase [Escherichia coli MS 21-1]
 gi|300454884|gb|EFK18377.1| coproporphyrinogen III oxidase [Escherichia coli MS 21-1]
          Length = 299

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLCAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVNGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|224823560|ref|ZP_03696669.1| Coproporphyrinogen oxidase [Lutiella nitroferrum 2002]
 gi|224604015|gb|EEG10189.1| Coproporphyrinogen oxidase [Lutiella nitroferrum 2002]
          Length = 302

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/252 (41%), Positives = 145/252 (57%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G VFE+A V  S V GD  P              + A G+
Sbjct: 34  VEDSWQREQGGGGRSRVLTGGAVFEQAGVNFSHVTGDTLPPSATAHRPELAGRRWEAMGV 93

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +         +WFGGG DLTP      + ++ D + +H 
Sbjct: 94  SLVVHPENPYVPTSHANVRFFIAEKDGEAPVWWFGGGFDLTPF-----YGFEEDAVHWHR 148

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
              ++C       Y  YK+WCD YF+L HR E+RG+GG+FFD L++     G +  F+F+
Sbjct: 149 VAHDLCQPFGAEVYPRYKQWCDEYFFLKHRHEARGVGGLFFDDLNAW----GFEQSFAFL 204

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ ++  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG ++GG  E
Sbjct: 205 QAVGNGYLDAYLPIVARRKDTPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTE 264

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 265 SILMSMPPLVRW 276


>gi|54310610|ref|YP_131630.1| coproporphyrinogen III oxidase [Photobacterium profundum SS9]
 gi|62510616|sp|Q6LLK0|HEM6_PHOPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|46915053|emb|CAG21828.1| Putative coproporphyrinogen III oxidase, aerobic [Photobacterium
           profundum SS9]
          Length = 301

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 147/251 (58%), Gaps = 15/251 (5%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           +D+ Q+E  GGGR   L  G VFE+A V  S V+G   P              F A G+S
Sbjct: 35  QDEWQREQGGGGRSRVLRQGSVFEQAGVNFSHVFGTKMPASATAHRPELAGRSFEAMGVS 94

Query: 122 VIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
           +++HP NP++P  H N+R  +         +WFGGG DLTP      + ++ D   +HNT
Sbjct: 95  LVIHPNNPYIPTSHANVRFFIAEKEGEAPVWWFGGGFDLTPF-----YPFEEDCQHWHNT 149

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
            K +C+      Y  +K WCD+YF+LPHR E+RG+GG+FFD L+      G +  F++  
Sbjct: 150 AKYLCAPFGDDIYEQHKVWCDKYFFLPHRNETRGVGGLFFDDLNEW----GFEKSFAYTQ 205

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           AVG+ FI  Y  +V+R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ES
Sbjct: 206 AVGNGFIDGYLPIVQRRQDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTES 265

Query: 296 ILASMPPLVAW 306
           IL SMPPL  W
Sbjct: 266 ILMSMPPLARW 276


>gi|332184107|gb|AEE26361.1| Coproporphyrinogen III oxidase, aerobic [Francisella cf. novicida
           3523]
          Length = 308

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 162/294 (55%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+ E  A +  ++R         W +  + ++ L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQYETNAAKFISDR---------WQKPDTPEQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+GD  P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGDQLPSSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTPY-----YPFEEDAIHWHQTAKNICDKHDKTYYPRFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V++ 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVKQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIQYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|83816565|ref|YP_445860.1| coproporphyrinogen III oxidase [Salinibacter ruber DSM 13855]
 gi|83757959|gb|ABC46072.1| coproporphyrinogen III oxidase, aerobic [Salinibacter ruber DSM
           13855]
          Length = 307

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 161/296 (54%), Gaps = 40/296 (13%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           +R  E LQ  +   F+ L+  A           F V  W RD+      GGG  A +  G
Sbjct: 6   KRFVEALQLRMTRAFDDLDPGAS----------FEVDRWSRDEG-----GGGITAVIEGG 50

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            VFEK  V  S V+G L P+   +     + P F+ATGLS+++HP +P+VP VH N R  
Sbjct: 51  DVFEKGGVNTSAVHGPL-PERMAREFDVEEAP-FYATGLSLVMHPRSPYVPTVHANFRYF 108

Query: 142 VTGA-------YWFGGGIDLTP---SLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
             G         WFGGG DLTP    L+  +H        FH   KE+C +H  A+Y  +
Sbjct: 109 ALGDDLMNPVDQWFGGGADLTPYYPRLDDTQH--------FHRVWKEVCDRHEGADYAAF 160

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+ CD YFYL HR E+RG+GGIF+D+L   PE  G+   F F    G  F++ Y  +V+R
Sbjct: 161 KDKCDDYFYLDHRDEARGVGGIFYDYLREDPE--GL---FFFTREAGRAFLESYLPIVKR 215

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                + +Q++  Q IRRGRY EFNL+YD+GT FG ++ G  ESIL SMPP V WP
Sbjct: 216 RKDTAYGQQEKAYQRIRRGRYVEFNLVYDRGTKFGLESDGRTESILMSMPPQVQWP 271


>gi|324112950|gb|EGC06926.1| coproporphyrinogen III oxidase [Escherichia fergusonii B253]
          Length = 299

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEALPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E 
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMEYGEH 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|121604635|ref|YP_981964.1| coproporphyrinogen III oxidase [Polaromonas naphthalenivorans CJ2]
 gi|166217803|sp|A1VN15|HEM6_POLNA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|120593604|gb|ABM37043.1| Coproporphyrinogen oxidase [Polaromonas naphthalenivorans CJ2]
          Length = 307

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 142/260 (54%), Gaps = 18/260 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F   HW ++  +    G G    L  G+VFE+A    S V G   P    Q         
Sbjct: 32  FMTDHWQKEPGETLQ-GNGITKILEQGRVFERAGCGFSHVRGPRLPPSATQHRPELAGAA 90

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTGAY--------WFGGGIDLTPSLESRRHSYD 166
           F A G+S++ HP NP+VP VH N+RM+             WFGGG+DLTP      + +D
Sbjct: 91  FEAMGVSLVFHPRNPYVPTVHMNVRMLAATPVGENCEPVCWFGGGMDLTPF-----YGFD 145

Query: 167 PDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG 226
            D + FH   K+         Y  +K+WCD YFYL HRQE RGIGG+FFD         G
Sbjct: 146 EDAVHFHQVCKDSLKPFGDDKYPRFKQWCDEYFYLKHRQEQRGIGGVFFDDFQEL----G 201

Query: 227 IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
           +   F+ + +VGD F++ Y  +V R    LF E++R  QL RRGRY EFNL++D+GT+FG
Sbjct: 202 LAQSFAMMQSVGDSFLQAYLPIVERRKDSLFGERERDFQLYRRGRYVEFNLVWDRGTHFG 261

Query: 287 FKTGGNVESILASMPPLVAW 306
            ++GG  ESIL SMPPL +W
Sbjct: 262 LQSGGRTESILMSMPPLASW 281


>gi|170039661|ref|XP_001847646.1| coproporphyrinogen III oxidase [Culex quinquefasciatus]
 gi|167863270|gb|EDS26653.1| coproporphyrinogen III oxidase [Culex quinquefasciatus]
          Length = 363

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 158/293 (53%), Gaps = 37/293 (12%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            +Q+  C   E  EN           K FTV  W R +      GGG    L  G VFEK
Sbjct: 63  KIQADFCNALEGEENFG---------KKFTVDRWERSEG-----GGGITCVLQDGDVFEK 108

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKN------PYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           A V +S V+G+L      Q+    K       P+F A G+S ++HP NP VP +HFN R 
Sbjct: 109 AGVNISVVHGNLPKGAIQQMRSRGKQLADGELPFF-AAGVSAVIHPRNPMVPTIHFNYRY 167

Query: 141 IV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
                   T  +WFGGG DLTP      +  + D I FH TLKE C +H  + Y  +K W
Sbjct: 168 FEVTDSQGTKQWWFGGGTDLTPY-----YLNEEDAIHFHRTLKEACDEHDSSYYPKFKAW 222

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD+YF++PHR E RG+GGIFFD L    +    ++ F+F+S+     I  Y  LV+++ +
Sbjct: 223 CDKYFFIPHRNECRGVGGIFFDDLDEPDQ----ESAFNFVSSCAHSVIPSYLPLVKKHKN 278

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
             + +++RQ QL+RRGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 279 EAYGDRERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLTAKW 331


>gi|198427295|ref|XP_002131844.1| PREDICTED: similar to GJ17558 [Ciona intestinalis]
          Length = 387

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 161/294 (54%), Gaps = 39/294 (13%)

Query: 29  QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAA 88
           QS +C   E LE E  +         F V  W    +++   GGG    L  GKVFEKA 
Sbjct: 91  QSKVCKAIESLEAEGQK---------FEVDKW----NKESGTGGGVTCVLQDGKVFEKAG 137

Query: 89  VLVSTVYGDLSPDFKDQILGTTKN---------PYFWATGLSVIVHPYNPHVPAVHFNIR 139
           V VS V+G L+   + Q+    ++         P F A G+S ++HP NPHVP +HFN R
Sbjct: 138 VNVSVVHGSLTEGAEKQMRARGRDFKRFDDGSLP-FIAMGVSSVIHPTNPHVPTIHFNFR 196

Query: 140 MI-VTGA-----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
              VTGA     +WFGGG DLTP    +      DV  FH  LK+ C +H V  Y  +K+
Sbjct: 197 YFEVTGADKKKTWWFGGGTDLTPMYLDQN-----DVKHFHTELKKACDKHDVQYYPKFKK 251

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF +P R E RG+GGIFFD +    E    ++  +F+++  +  I  Y  +V +N 
Sbjct: 252 WCDEYFTIPIRGERRGVGGIFFDDIEGPDE----ESALAFVTSCAEAIIPCYVPIVVKNK 307

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           +  F+ + +Q Q +RRGRY EFNL+YD+GT FGF+T G  +ESIL S+P    W
Sbjct: 308 NKSFTSEQKQWQQLRRGRYVEFNLIYDRGTKFGFQTPGARIESILMSLPLTARW 361


>gi|190576372|ref|YP_001974217.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia K279a]
 gi|226740906|sp|B2FND0|HEM6_STRMK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|190014294|emb|CAQ47941.1| putative coproporphyrinogen III oxidase, aerobic [Stenotrophomonas
           maltophilia K279a]
          Length = 298

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 154/286 (53%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E ++  A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAIEAVDGRAR----------FQEDLW-----QRAEGGGGRTRVLRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + ATG+S++ HP NP+VP  H N+R       
Sbjct: 58  AGIGFSDVSGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANVRFFQAQRD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      + +D DV  +H   +++C+      Y  +K WCD YF+
Sbjct: 118 GEVVASWFGGGFDLTPF-----YPFDEDVQHWHQVARDLCAPFGDERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD LH     G  + DF+++ AVGD F+  Y  +V++    ++ E+
Sbjct: 173 LRHRNETRGVGGLFFDDLH-----GDFERDFAYLRAVGDGFLDAYLPIVQQRKDAIYGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|37681400|ref|NP_936009.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
 gi|41017097|sp|Q7MGL4|HEM6_VIBVY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|37200152|dbj|BAC95980.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
          Length = 305

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 153/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E+ + +A           F    W R+   +   GGGR   +  G VFE+
Sbjct: 15  QLQDQICQRLEQEDGKA----------TFIEDAWHREPGDRLG-GGGRTRVMRNGNVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G+  P              F A G+S+++HP+NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVQGNAMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D  F+HNT KE+C+      Y  +K WCD YFY
Sbjct: 124 GEAPIWWFGGGFDLTPF-----YPFEEDCQFWHNTAKEVCAPFGADVYAQHKAWCDDYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+        D  F +I AVG+ +   Y  +V R     + E+
Sbjct: 179 LPHRGETRGIGGLFFDDLNQWE----FDKCFDYIKAVGEGYCDAYLPIVERRKVTEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|284052971|ref|ZP_06383181.1| coproporphyrinogen III oxidase [Arthrospira platensis str. Paraca]
          Length = 347

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 165/326 (50%), Gaps = 46/326 (14%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T  +  P   + R+R+S    + +Q  IC   E L+                 K ++ D 
Sbjct: 9   TAIVQSPPPADSRERVSH-WMKQIQDEICAGLEGLDG---------------AKTFVEDA 52

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVI 123
            ++ + GGGR   L  G VFE+  V  S V+G +L P    Q     +   F+ATG S++
Sbjct: 53  WERPEGGGGRTRVLREGNVFEQGGVNFSEVWGQNLPPSILSQ-RPEVEGHGFYATGTSMV 111

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   FH TLKE C +
Sbjct: 112 LHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHKTLKEACDR 166

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL----------------------HS 220
           H    Y  +K WCD YF+L HR E+RGIGGIFFD+                         
Sbjct: 167 HHSEYYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGPYTESEAAIYSDRMG 226

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
           +PE    +A FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD
Sbjct: 227 APESRDWEALFSFIQDCGKSFLPSYGPIVERRNSMEYGDRERNFQLYRRGRYVEFNLVYD 286

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 287 RGTIFGLQTKGRTESILMSLPPLVRW 312


>gi|296104096|ref|YP_003614242.1| coproporphyrinogen III oxidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058555|gb|ADF63293.1| coproporphyrinogen III oxidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 299

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 146/250 (58%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  Q+E  GGGR   L  G +FE+A V  S VYG+  P              F A G+S+
Sbjct: 34  DNWQREAGGGGRSRVLRNGGIFEQAGVNFSHVYGEAMPASATAHRPELAGRSFQAMGVSL 93

Query: 123 IVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           +VHP+NP VP  H N+R  +    GA   +WFGGG D+TP      + ++ D + +H T 
Sbjct: 94  VVHPHNPFVPTSHANVRFFIAEKPGADPVWWFGGGFDMTPY-----YGFEEDAVHWHTTA 148

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           +++C       Y  YK+WCD YFYL HR E RGIGG+FFD L++       D  FSF+ A
Sbjct: 149 RDLCLPFGEDVYPKYKKWCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFDTAFSFMRA 204

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VG+ +   Y  +V R  +  +  ++R+ QL RRGRY EFNL++D+GT FG +TGG  ESI
Sbjct: 205 VGEGYTDAYLPIVERRKNSDYGVREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESI 264

Query: 297 LASMPPLVAW 306
           L SMPPLV W
Sbjct: 265 LMSMPPLVRW 274


>gi|261345327|ref|ZP_05972971.1| coproporphyrinogen III oxidase [Providencia rustigianii DSM 4541]
 gi|282566661|gb|EFB72196.1| coproporphyrinogen III oxidase [Providencia rustigianii DSM 4541]
          Length = 305

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 158/288 (54%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ  IC +  +L+ +          + F  + W R +      GGGR   L  G +F
Sbjct: 13  LQSLQDTICQKITELDGK----------ETFLEQTWERAEG-----GGGRSRVLTQGALF 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S + GD  P              + A G+S+++HP NP++P  H N+R  +  
Sbjct: 58  EQAGVNFSHIKGDKLPASASAHRPELAGRSYQAMGVSLVIHPLNPYIPTTHANVRFFIAE 117

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D I +H   +++C  +    Y  YK+WCD Y
Sbjct: 118 KEGTEPVWWFGGGFDLTPY-----YGFEEDAIHWHTVARDLCMPYGDDVYPKYKKWCDEY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+F+D L+     GG ++ F+F   VG  F++ Y  +V R  +  + 
Sbjct: 173 FYLKHRNEPRGIGGLFYDDLNQ----GGFESCFNFTQDVGHGFLQAYAPIVERRRYLSWG 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 229 ERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|156339051|ref|XP_001620068.1| hypothetical protein NEMVEDRAFT_v1g149268 [Nematostella vectensis]
 gi|156204390|gb|EDO27968.1| predicted protein [Nematostella vectensis]
          Length = 296

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 145/251 (57%), Gaps = 15/251 (5%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           +D+ Q+++ GGGR   +  G VFEKA V  S V+GD  P              F A G+S
Sbjct: 35  QDEWQRKEGGGGRSRVIQDGAVFEKAGVNFSHVFGDGLPASATATRPALAGRGFEAMGVS 94

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
            +VHP NP+VP  HFN+R+ +         +WFGGG DLTP      + ++ D + FH  
Sbjct: 95  CVVHPRNPYVPTSHFNVRLFIANKEGEDPIWWFGGGFDLTPY-----YPFEEDCVHFHQQ 149

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
            K  CS      Y  YK+W D YFYL HRQE+RG+GG+FFD L+     GG D  F+F+ 
Sbjct: 150 AKNACSPFGHELYPKYKKWADEYFYLKHRQEARGVGGLFFDDLNE----GGFDHCFNFMR 205

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           +VGD F+  Y  ++ +   H++ E++   Q  RRGRY EFNL++D+GT FG  TGG  ES
Sbjct: 206 SVGDHFMSAYQPIIAKRKDHVYGERELDFQYYRRGRYVEFNLVFDRGTVFGLHTGGRTES 265

Query: 296 ILASMPPLVAW 306
           IL S+P  V W
Sbjct: 266 ILMSLPMHVTW 276


>gi|254237734|ref|ZP_04931057.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           C3719]
 gi|126169665|gb|EAZ55176.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           C3719]
          Length = 305

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 150/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W R        GGGR   +  G + EK
Sbjct: 14  DLQDRICAALEAEDGKAR----------FAEDAWERPAG-----GGGRTRVIGDGALIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+GD  P              F A G+S+++HP NPHVP  H N+R       
Sbjct: 59  GGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      ++++ D + +H   ++ C+      Y HYKEWCDRYF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADVYPHYKEWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R  H  F E+
Sbjct: 174 LKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKHTPFDER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|254483332|ref|ZP_05096563.1| coproporphyrinogen III oxidase, aerobic [marine gamma
           proteobacterium HTCC2148]
 gi|214036427|gb|EEB77103.1| coproporphyrinogen III oxidase, aerobic [marine gamma
           proteobacterium HTCC2148]
          Length = 302

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+   + +  A           F    W     Q+ + GGGR   L  G VFEK
Sbjct: 12  SLQDSICSALAQEDGSA----------AFITDEW-----QRSEGGGGRSRVLAEGAVFEK 56

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G+  P              + A G+S++VHP NP+VP  H N+R+ V    
Sbjct: 57  AGVNFSHVMGENLPPSASASRPELAGRSYQAMGVSLVVHPNNPYVPTSHANVRLFVAEKE 116

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP   +R      D I +H    E C+      Y  YK WCD YFY
Sbjct: 117 GAEPVWWFGGGYDLTPYYGNRE-----DCIAWHQVASEACAPFGGELYPRYKAWCDEYFY 171

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HRQE RG+GG+FFD L+        D  F F+ +VG+ F++ Y  +V R  +  F ++
Sbjct: 172 LKHRQEPRGVGGLFFDDLNEW----DFDTSFGFMQSVGNSFLRAYRPIVSRRKNTPFGDR 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPLV W
Sbjct: 228 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSDGRTEAILMSLPPLVRW 273


>gi|317491256|ref|ZP_07949692.1| coproporphyrinogen III oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920803|gb|EFV42126.1| coproporphyrinogen III oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 305

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  +C +    + ++           F   +W     Q+E  GGGR   L  G VFE+
Sbjct: 15  NLQDSLCQQIAAADGQS----------TFREDNW-----QREAGGGGRSRVLTQGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 60  AGVNFSHVTGGQLPASATAHRPELAGRSFEAMGVSLVIHPQNPYVPTSHANVRFFIAEKE 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  DV+ +H T + +C       Y  YK+WCD YFY
Sbjct: 120 GEEPVWWFGGGFDLTPF-----YPFKDDVLHWHRTARNLCLPFGEDVYPRYKKWCDEYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HRQESRG+GG+FFD L++       D  F+F+ AVG  F   Y  +V +     FS++
Sbjct: 175 IKHRQESRGVGGLFFDDLNTP----DFDHCFAFMQAVGAGFSDAYLPIVAKRKDMPFSDR 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|123441508|ref|YP_001005494.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166217822|sp|A1JL37|HEM6_YERE8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122088469|emb|CAL11261.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 308

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 157/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC    + +  A           FT ++W+R     E+ GGGR   +  G VFE+
Sbjct: 15  DLQDKICAALAQADGSAK----------FTEENWVR-----EEGGGGRSRVMVKGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYLPTSHANVRFFIAEKP 119

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H T   +C       Y+ YK+WCD YFY
Sbjct: 120 DEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQPFGEQLYSRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L+S P+    D  F+F  AVGD F+  Y  +V R     + E+
Sbjct: 175 IKHRNEARGIGGLFFDDLNS-PD---FDTCFNFTQAVGDGFLDAYMPIVARRKALCWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 EREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|254262194|emb|CAZ90522.1| Coproporphyrinogen-III oxidase, aerobic hemF [Enterobacter
           turicensis]
          Length = 299

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 154/285 (54%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC +   ++  A           F    W RD       GGGR   L  G VFE+A
Sbjct: 15  LQDDICRQLSAVDGTA-----------FIEDSWQRDAG-----GGGRSRVLRDGAVFEQA 58

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---G 144
            V  S VYGD  P              F A G+S+++HP NP+VP  H N+R  +    G
Sbjct: 59  GVNFSHVYGDAMPASATAHRPELAGRSFEAMGVSLVIHPLNPYVPTSHANVRFFIAEKPG 118

Query: 145 A---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           A   +WFGGG D+TP      + ++ D + +H T +++C       Y  YK+WCD YFYL
Sbjct: 119 ADPVWWFGGGFDMTPF-----YGFEEDAVHWHRTARDLCLPFGEDVYPRYKKWCDDYFYL 173

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E RGIGG+FFD L++       +  F+F+ AVG+ F + Y  +V R     + E++
Sbjct: 174 RHRNEQRGIGGLFFDDLNTP----DFEHCFAFMQAVGNGFTEAYLPIVERRKALAWGERE 229

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 RAFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|315293457|gb|EFU52809.1| coproporphyrinogen III oxidase [Escherichia coli MS 153-1]
          Length = 299

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLSAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++V+P+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVNPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|289209439|ref|YP_003461505.1| coproporphyrinogen oxidase [Thioalkalivibrio sp. K90mix]
 gi|288945070|gb|ADC72769.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. K90mix]
          Length = 309

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 153/288 (53%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ  IC   E L+ +A           F    W R        GGGR   +  G+VF
Sbjct: 15  LQGLQDRICQGLEGLDGQAR----------FQEDAWERPAG-----GGGRTRVMHEGRVF 59

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V GD  P              F ATG+S+++HP+NP+VP  H N+R  +  
Sbjct: 60  EQAGVNFSHVMGDNLPASATAHRPEMAGRSFQATGVSLVIHPHNPYVPTSHANVRFFIAE 119

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + +D D I +H T +  C       Y  +K+WCD Y
Sbjct: 120 KPGEEPIWWFGGGFDLTPY-----YGFDEDCIHWHRTAEAACRPFGEHLYPAHKQWCDEY 174

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F+L HR E RG+GG+FFD        GG +  F ++ +VG+ ++  Y  +V R +   + 
Sbjct: 175 FHLKHRDEPRGVGGLFFDDFSE----GGFEHAFGYMQSVGNAYLDAYGPIVERRHATEYG 230

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 231 ERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 278


>gi|207857864|ref|YP_002244515.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|226740895|sp|B5R4G0|HEM6_SALEP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|206709667|emb|CAR34017.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 299

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 152/252 (60%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG+DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGLDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDNVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|329894847|ref|ZP_08270647.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC3088]
 gi|328922741|gb|EGG30075.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC3088]
          Length = 298

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 148/286 (51%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC E   L+              F    W R +      GGGR   L  G + EK
Sbjct: 12  GLQEAICHELSDLDGAE-----------FASDAWERPEG-----GGGRSRVLSEGALIEK 55

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+RM V    
Sbjct: 56  GGVNFSHVQGASMPGSATAHRPELAGRSFQAMGVSLVIHPRNPYVPTSHANVRMFVAEKE 115

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T K  C     A Y  YK WCD YFY
Sbjct: 116 GEEPIWWFGGGYDLTPY-----YGFEEDCVEWHRTAKSACEPFGEALYPKYKRWCDDYFY 170

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHRQE RG+GG+F+D L+     GG +  F F+ +VGD +++ Y  +V R     + E+
Sbjct: 171 LPHRQEPRGVGGLFYDDLNE----GGFERCFDFMRSVGDSYLRAYRPIVERRRDIAYGER 226

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG ++ G  ESIL S+PPLV W
Sbjct: 227 ERNWQLYRRGRYVEFNLVFDRGTLFGLQSNGRTESILMSLPPLVRW 272


>gi|237732430|ref|ZP_04562911.1| coproporphyrinogen oxidase [Citrobacter sp. 30_2]
 gi|226907969|gb|EEH93887.1| coproporphyrinogen oxidase [Citrobacter sp. 30_2]
          Length = 299

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 146/252 (57%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDNWQREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP++P  H N+R  +    GA   +WFGGG DLTP      + +D D + +H 
Sbjct: 92  SLVVHPQNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFDEDAVNWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG  + + Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGQGYTEAYLPIVERRKMMSWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|83642947|ref|YP_431382.1| coproporphyrinogen III oxidase [Hahella chejuensis KCTC 2396]
 gi|83630990|gb|ABC26957.1| Coproporphyrinogen III oxidase [Hahella chejuensis KCTC 2396]
          Length = 301

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 140/252 (55%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D   +E+ GGGR   L  G VFEKA V  S V G   P              F A G+
Sbjct: 33  VEDAWSREEGGGGRTRVLSEGGVFEKAGVNFSHVSGARLPASASAARPELAGRSFQAMGV 92

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+ P  H N+R  V         +WFGGG DLTP      + +D D   +H 
Sbjct: 93  SLVVHPRNPYTPTSHANVRFFVAEKEGEDPVWWFGGGYDLTPY-----YGFDEDCAHWHR 147

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T  + C       Y  YK+WCD YFYL HR E+RG+GG+FFD L++     G +  F F+
Sbjct: 148 TAAQACEPFGAEIYPKYKKWCDDYFYLKHRDEARGVGGLFFDDLNAW----GFERSFEFM 203

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ ++  Y  +V R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  E
Sbjct: 204 RAVGNSYLPAYSPIVERRKDMTYGERERSFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTE 263

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 264 SILMSLPPLVRW 275


>gi|90413786|ref|ZP_01221774.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
 gi|90325255|gb|EAS41752.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
          Length = 301

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  +  A          +F    W     Q+E  GGGR   L  G VFE+
Sbjct: 15  SLQDQICQSLENQDKGA----------VFEQDEW-----QREQGGGGRSRVLRQGSVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V+G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVFGTKMPASATAHRPELAGRSFEAMGVSLVIHPNSPYIPTSHANVRFFIAEKE 119

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +HNT K +C+      Y  +K WCD+YF+
Sbjct: 120 GEAPVWWFGGGFDLTPF-----YPFEEDCQHWHNTAKHLCAPFGDDIYDQHKAWCDKYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F++  AVG+ FI  Y  +V+R     + E+
Sbjct: 175 LPHRNETRGVGGLFFDDLNEW----GFEQSFAYTQAVGNGFIDGYLPIVQRRQDIPYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 231 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|320185130|gb|EFW59910.1| Coproporphyrinogen III oxidase, aerobic [Shigella flexneri CDC
           796-83]
          Length = 299

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WC+ YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCNDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|332372951|gb|AEE61617.1| unknown [Dendroctonus ponderosae]
          Length = 383

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 166/308 (53%), Gaps = 41/308 (13%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           PDD++ R  +   K   +QS  C   EK      E++       F V  W     ++++ 
Sbjct: 64  PDDMKTRMELMIMK---VQSDFCKALEK------EDAVK-----FKVDRW-----ERQEG 104

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIV 124
           GGG    L  G VFEKA V VS VYG+L P    Q+      L   K P+F A GLS ++
Sbjct: 105 GGGVTCVLQNGSVFEKAGVNVSVVYGELPPAAAAQMRSRGKKLKEGKLPFF-AAGLSAVI 163

Query: 125 HPYNPHVPAVHFNIRMIVTGA-----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           HP NP +P VHFN R     +     +WFGGG DLTP      +    D I FH+TLKE 
Sbjct: 164 HPVNPMIPTVHFNYRYFEVQSEEERHWWFGGGTDLTPY-----YLNSADCIHFHSTLKEA 218

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C +H  + Y  +K+WCD YF++ HR E RGIGGIFFD L +       +  F F+S   +
Sbjct: 219 CDKHDKSYYPKFKKWCDDYFHIVHRGERRGIGGIFFDDLDTP----NSEDCFQFVSECAN 274

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILA 298
             I  Y  LV+R+    +++ +R+ QL+RRGRY EFNL+YD+GT FG  T G   ESIL 
Sbjct: 275 AVIPSYIPLVKRHKLASYTKVEREWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILM 334

Query: 299 SMPPLVAW 306
           S+P    W
Sbjct: 335 SLPLYAKW 342


>gi|282901464|ref|ZP_06309389.1| Coproporphyrinogen III oxidase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193743|gb|EFA68715.1| Coproporphyrinogen III oxidase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 349

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 162/319 (50%), Gaps = 46/319 (14%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D + R   + +  + LQ  I TE E L+  +           FT   W R +      
Sbjct: 20  PPDSQTR---ASQFMKQLQDKITTELELLDGGSK----------FTEDSWERIEG----- 61

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGGR   L  G VFE+A V  S V+GD  P              F+ATG S+++HP NP+
Sbjct: 62  GGGRSRVLREGAVFEQAGVNFSQVWGDQLPPSILVQRPEAAGHGFYATGTSLVLHPRNPY 121

Query: 131 VPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           +P VH N R    G  +WFGGG DLTP      + +  D I FH TLK  C +H V  Y 
Sbjct: 122 IPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDPIHFHQTLKNACDKHHVDYYP 176

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD------------- 230
            +K WCD YFYL HR E+RG+GGIF D+      ++  P+  G  A+             
Sbjct: 177 VFKRWCDEYFYLKHRGETRGVGGIFLDYQDGQGDIYRGPDSQGEAANYSRNLTPLPRRTW 236

Query: 231 ---FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGF 287
              FS I   G  FI  Y  +V+R  +  + ++ R  QL RRGRY EFNL+YD+GT FG 
Sbjct: 237 EQVFSLIQDCGQAFIPAYAPIVQRRRNTEYGDRQRSFQLYRRGRYVEFNLVYDRGTIFGL 296

Query: 288 KTGGNVESILASMPPLVAW 306
           +T G  ESIL S+PPLV W
Sbjct: 297 QTNGRTESILMSLPPLVRW 315


>gi|157144630|ref|YP_001451949.1| coproporphyrinogen III oxidase [Citrobacter koseri ATCC BAA-895]
 gi|166217798|sp|A8ADF0|HEM6_CITK8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157081835|gb|ABV11513.1| hypothetical protein CKO_00350 [Citrobacter koseri ATCC BAA-895]
          Length = 299

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 148/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q++  GGGR   L  G VFE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWQRDAGGGGRSRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP++P  H N+R  +    GA   +WFGGG DLTP      ++++ D I +H 
Sbjct: 92  SLVVHPLNPYIPTSHANVRFFIAEKPGAEPVWWFGGGFDLTPY-----YAFEEDAIHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C  +    Y  YK+WCD YF+L HR E RGIGG+FFD L++       D+ F F+
Sbjct: 147 TARDLCQPYGEDVYPRYKKWCDDYFFLKHRDEQRGIGGLFFDDLNTP----DFDSCFRFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG  +   +  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGKGYTDAFLPIVERRKAMVWGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|291567257|dbj|BAI89529.1| coproporphyrinogen III oxidase, aerobic [Arthrospira platensis
           NIES-39]
          Length = 347

 Score =  205 bits (522), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 162/325 (49%), Gaps = 44/325 (13%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T  +  P   + R+R+S    + +Q  IC   E L+                 K ++ D 
Sbjct: 9   TAIVQSPPPADSRERVSH-WMKQIQDEICAGLEGLDG---------------AKTFVEDA 52

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
            ++ + GGGR   +  G VFE+  V  S V+G   P          +   F+ATG S+++
Sbjct: 53  WERPEGGGGRTRVIREGNVFEQGGVNFSEVWGQKLPPSILSQRPEAEGHGFYATGTSMVL 112

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   FH TLKE C +H
Sbjct: 113 HPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHKTLKEACDRH 167

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL----------------------HSS 221
               Y  +K WCD YF+L HR E+RGIGGIFFD+                         +
Sbjct: 168 HSEYYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGPYTESEAAIYSDRMGA 227

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
           PE    +A FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+
Sbjct: 228 PESRDWEALFSFIQDCGKSFLPSYGPIVERRNSMEYGDRERNFQLYRRGRYVEFNLVYDR 287

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 288 GTIFGLQTKGRTESILMSLPPLVRW 312


>gi|15640087|ref|NP_229714.1| coproporphyrinogen III oxidase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121587246|ref|ZP_01677019.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 2740-80]
 gi|121727881|ref|ZP_01680940.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V52]
 gi|147674221|ref|YP_001218358.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|153817569|ref|ZP_01970236.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae NCTC 8457]
 gi|153821927|ref|ZP_01974594.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae B33]
 gi|229508339|ref|ZP_04397843.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae BX 330286]
 gi|229508822|ref|ZP_04398313.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae B33]
 gi|229517093|ref|ZP_04406539.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC9]
 gi|229606614|ref|YP_002877262.1| coproporphyrinogen III oxidase [Vibrio cholerae MJ-1236]
 gi|254851619|ref|ZP_05240969.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|255746764|ref|ZP_05420710.1| coproporphyrinogen III oxidase aerobic [Vibrio cholera CIRS 101]
 gi|262155845|ref|ZP_06028967.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae INDRE 91/1]
 gi|262166888|ref|ZP_06034609.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC27]
 gi|13431551|sp|Q9KVT4|HEM6_VIBCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|172047504|sp|A5F4C4|HEM6_VIBC3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|9654449|gb|AAF93233.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121548492|gb|EAX58548.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 2740-80]
 gi|121629825|gb|EAX62240.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V52]
 gi|126511837|gb|EAZ74431.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae NCTC 8457]
 gi|126520547|gb|EAZ77770.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae B33]
 gi|146316104|gb|ABQ20643.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae O395]
 gi|227011942|gb|ACP08152.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|229346156|gb|EEO11128.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC9]
 gi|229354097|gb|EEO19029.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae B33]
 gi|229354612|gb|EEO19534.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae BX 330286]
 gi|229369269|gb|ACQ59692.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae MJ-1236]
 gi|254847324|gb|EET25738.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|255735521|gb|EET90920.1| coproporphyrinogen III oxidase aerobic [Vibrio cholera CIRS 101]
 gi|262024659|gb|EEY43339.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC27]
 gi|262030297|gb|EEY48939.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae INDRE 91/1]
          Length = 305

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E  + +A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 16  QLQDKICQQLEATDGQAQ----------FIEDAWQREPGEKLG-GGGRTRVMREGAVFEQ 64

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 65  GGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHANVRFFIAEKE 124

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D   +H T K +C+      Y  +K WCDRYFY
Sbjct: 125 GEAPIWWFGGGFDLTPF-----YPFVEDGQHWHQTAKNICAPFGSEIYNEHKAWCDRYFY 179

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RGIGG+FFD L+        +  F+++ AVG+ + + Y  +V +  +  F+E+
Sbjct: 180 LPHRNETRGIGGLFFDDLNEW----SFEQCFAYMQAVGEGYTQAYVPIVEKRKNTPFTER 235

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 236 ERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|22125348|ref|NP_668771.1| coproporphyrinogen III oxidase [Yersinia pestis KIM 10]
 gi|45442431|ref|NP_993970.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51597070|ref|YP_071261.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           32953]
 gi|108808214|ref|YP_652130.1| coproporphyrinogen III oxidase [Yersinia pestis Antiqua]
 gi|108811516|ref|YP_647283.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|145599411|ref|YP_001163487.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides F]
 gi|149365107|ref|ZP_01887142.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           CA88-4125]
 gi|162419132|ref|YP_001607174.1| coproporphyrinogen III oxidase [Yersinia pestis Angola]
 gi|165926908|ref|ZP_02222740.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165935964|ref|ZP_02224534.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011267|ref|ZP_02232165.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212569|ref|ZP_02238604.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398417|ref|ZP_02303941.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422685|ref|ZP_02314438.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424551|ref|ZP_02316304.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170023635|ref|YP_001720140.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis YPIII]
 gi|186896158|ref|YP_001873270.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis PB1/+]
 gi|218930077|ref|YP_002347952.1| coproporphyrinogen III oxidase [Yersinia pestis CO92]
 gi|229838627|ref|ZP_04458786.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895693|ref|ZP_04510864.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides A]
 gi|229899193|ref|ZP_04514336.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901781|ref|ZP_04516903.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|270489971|ref|ZP_06207045.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis KIM D27]
 gi|294504781|ref|YP_003568843.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|21362586|sp|Q8ZCF9|HEM6_YERPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|62510607|sp|Q668I6|HEM6_YERPS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122383096|sp|Q1C5T7|HEM6_YERPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122384927|sp|Q1CJZ7|HEM6_YERPN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217823|sp|A4TMK2|HEM6_YERPP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740910|sp|B2K962|HEM6_YERPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740911|sp|A9QZK6|HEM6_YERPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740912|sp|B1JSJ6|HEM6_YERPY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|21958229|gb|AAM85022.1|AE013748_4 coproporphyrinogen III oxidase [Yersinia pestis KIM 10]
 gi|45437296|gb|AAS62847.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51590352|emb|CAH21992.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775164|gb|ABG17683.1| coproporphyrinogen oxidase [Yersinia pestis Nepal516]
 gi|108780127|gb|ABG14185.1| coproporphyrinogen oxidase [Yersinia pestis Antiqua]
 gi|115348688|emb|CAL21634.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis CO92]
 gi|145211107|gb|ABP40514.1| coproporphyrinogen oxidase [Yersinia pestis Pestoides F]
 gi|149291520|gb|EDM41594.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           CA88-4125]
 gi|162351947|gb|ABX85895.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis Angola]
 gi|165916109|gb|EDR34716.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921259|gb|EDR38483.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989945|gb|EDR42246.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206500|gb|EDR50980.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958392|gb|EDR55413.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050921|gb|EDR62329.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056433|gb|EDR66202.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750169|gb|ACA67687.1| Coproporphyrinogen oxidase [Yersinia pseudotuberculosis YPIII]
 gi|186699184|gb|ACC89813.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis PB1/+]
 gi|229681710|gb|EEO77804.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|229687595|gb|EEO79668.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694993|gb|EEO85040.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701499|gb|EEO89527.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides A]
 gi|262362843|gb|ACY59564.1| coproporphyrinogen III oxidase [Yersinia pestis D106004]
 gi|262366767|gb|ACY63324.1| coproporphyrinogen III oxidase [Yersinia pestis D182038]
 gi|270338475|gb|EFA49252.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis KIM D27]
 gi|294355240|gb|ADE65581.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|320014410|gb|ADV97981.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 309

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC    + +  A           FT + W+R     E+ GGGR   L  G VFE+
Sbjct: 15  TLQDNICAALAQADGHAE----------FTEECWVR-----EEGGGGRSRVLVNGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G + P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAMLPASATAHRPELAGRSFQALGVSLVIHPLNPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H     +C       Y  YK+WCD YFY
Sbjct: 120 GEDAVWWFGGGFDLTPY-----YGFEEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HRQE+RGIGG+FFD L+S   M      F+F  AVGD F+  Y  +V R     + ++
Sbjct: 175 IKHRQEARGIGGLFFDDLNSPDFM----TCFNFTQAVGDGFLAAYMPIVARRKALGWGDR 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|227356205|ref|ZP_03840594.1| coproporphyrinogen III oxidase, aerobic [Proteus mirabilis ATCC
           29906]
 gi|227163669|gb|EEI48585.1| coproporphyrinogen III oxidase, aerobic [Proteus mirabilis ATCC
           29906]
          Length = 302

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 155/289 (53%), Gaps = 30/289 (10%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           Q  F +LQ  IC   E ++ +A           F   +W     Q+E  GGGR   L  G
Sbjct: 10  QSFFLSLQDSICHAIENIDQKA----------TFQQDNW-----QREAGGGGRTRVLTQG 54

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            +FE+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R  
Sbjct: 55  AIFEQAGVNFSHVYGDALPASATAHRPELSGRRFQAMGVSLVIHPLNPYIPTSHANVRFF 114

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG DLTP      + ++ DVI +H   K +C   +   Y  YK+WC
Sbjct: 115 IAEKEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCDPFSQNYYARYKKWC 169

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +    
Sbjct: 170 DDYFYLKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGQGYLDAYLPIVEKRKSI 225

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
            + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV
Sbjct: 226 PWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLV 274


>gi|282898283|ref|ZP_06306274.1| Coproporphyrinogen III oxidase [Raphidiopsis brookii D9]
 gi|281196814|gb|EFA71719.1| Coproporphyrinogen III oxidase [Raphidiopsis brookii D9]
          Length = 348

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/320 (39%), Positives = 165/320 (51%), Gaps = 48/320 (15%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D + R   + +  + LQ  I TE E L+  +           FT   W R +      
Sbjct: 20  PPDSQTR---ASQFMKQLQDKITTELELLDGGSK----------FTEDSWERIEG----- 61

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGD-LSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
           GGGR   L  G VFE+A V  S V+GD L P    Q    T +  F+ATG S+++HP NP
Sbjct: 62  GGGRSRVLREGAVFEQAGVNFSQVWGDQLPPSILVQRPEATGHG-FYATGTSLVLHPRNP 120

Query: 130 HVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           ++P VH N R    G  +WFGGG DLTP      + +  D I FH TLK  C +H    Y
Sbjct: 121 YIPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAIHFHQTLKNACDKHHGDYY 175

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD------------ 230
             +K WCD YFYL HR E+RG+GGIF D+      ++  P+  G  A+            
Sbjct: 176 PVFKRWCDEYFYLKHRGETRGVGGIFLDYQDGQGDIYRGPDSQGEAANYNRNLTPLPRRT 235

Query: 231 ----FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
               FS I   G  FI  Y  +V+R  +  + ++ R  QL RRGRY EFNL+YD+GT FG
Sbjct: 236 WEQVFSLIQDCGQAFIPAYAPIVQRRRNMEYGDRQRSFQLYRRGRYVEFNLVYDRGTIFG 295

Query: 287 FKTGGNVESILASMPPLVAW 306
            +T G  ESIL S+PPLV W
Sbjct: 296 LQTNGRTESILMSLPPLVRW 315


>gi|194760322|ref|XP_001962390.1| GF15439 [Drosophila ananassae]
 gi|190616087|gb|EDV31611.1| GF15439 [Drosophila ananassae]
          Length = 390

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 155/292 (53%), Gaps = 36/292 (12%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           +Q+ +C   E     A EN   R    F V  W R +      GGG    L  G VFEKA
Sbjct: 96  IQAEVCRALE-----AEENCGQR----FEVDRWERAEG-----GGGITCVLQDGDVFEKA 141

Query: 88  AVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            V +S V G L P   +Q+      L + K   F+A+G+S ++HP NPHVP +HFN R  
Sbjct: 142 GVNISVVTGWLPPAAVEQMRARGKKLNSGKKLPFYASGVSAVIHPRNPHVPTIHFNYRYF 201

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +WFGGG DLTP      +  + D   FH TLK  C +H    Y  +K+WC
Sbjct: 202 EVETAKGEKQWWFGGGTDLTPY-----YLCEKDANHFHQTLKSACDEHDATYYPRFKKWC 256

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF + HR ESRGIGGIFFD + +  +    ++ F F+S+     I  Y  LVR+N + 
Sbjct: 257 DDYFRIKHRNESRGIGGIFFDDVDTPNQ----ESAFKFVSSCAKAVIPSYMPLVRKNKNR 312

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
            +   +RQ QL+RRGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 313 EYGSNERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARW 364


>gi|197285694|ref|YP_002151566.1| coproporphyrinogen III oxidase [Proteus mirabilis HI4320]
 gi|226740887|sp|B4EZS7|HEM6_PROMH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194683181|emb|CAR43816.1| Coproporphyrinogen III oxidase, aerobic [Proteus mirabilis HI4320]
          Length = 302

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 155/289 (53%), Gaps = 30/289 (10%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           Q  F +LQ  IC   E ++ +A           F   +W     Q+E  GGGR   L  G
Sbjct: 10  QSFFLSLQDSICHAIENIDQKA----------TFQQDNW-----QREAGGGGRTRMLTQG 54

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            +FE+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R  
Sbjct: 55  AIFEQAGVNFSHVYGDALPASATAHRPELSGRRFQAMGVSLVIHPLNPYIPTSHANVRFF 114

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG DLTP      + ++ DVI +H   K +C   +   Y  YK+WC
Sbjct: 115 IAEKEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCDPFSQDYYARYKKWC 169

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +    
Sbjct: 170 DDYFYLKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGQGYLDAYLPIVEKRKSI 225

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
            + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV
Sbjct: 226 PWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLV 274


>gi|322613807|gb|EFY10746.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619449|gb|EFY16325.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624954|gb|EFY21783.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629603|gb|EFY26379.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633967|gb|EFY30704.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635596|gb|EFY32307.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639959|gb|EFY36632.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644351|gb|EFY40892.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652123|gb|EFY48485.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655286|gb|EFY51595.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658332|gb|EFY54598.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664332|gb|EFY60529.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668437|gb|EFY64593.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673227|gb|EFY69333.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676619|gb|EFY72687.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683369|gb|EFY79383.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685745|gb|EFY81738.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192577|gb|EFZ77806.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196860|gb|EFZ82003.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202116|gb|EFZ87174.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208049|gb|EFZ92994.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212825|gb|EFZ97634.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217094|gb|EGA01816.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323226754|gb|EGA10947.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229217|gb|EGA13341.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235468|gb|EGA19552.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237346|gb|EGA21409.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245101|gb|EGA29102.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248993|gb|EGA32916.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253091|gb|EGA36923.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255890|gb|EGA39635.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261787|gb|EGA45355.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266429|gb|EGA49917.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269741|gb|EGA53191.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 299

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTQAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|308187708|ref|YP_003931839.1| Coproporphyrinogen III oxidase [Pantoea vagans C9-1]
 gi|308058218|gb|ADO10390.1| Coproporphyrinogen III oxidase [Pantoea vagans C9-1]
          Length = 304

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 144/250 (57%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  Q+   GGG+   L  G VFE+A V  S V+GD  P              F A G+S+
Sbjct: 34  DSWQRPGGGGGQSRVLRNGTVFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSL 93

Query: 123 IVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H T 
Sbjct: 94  VIHPNNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDALHWHQTA 148

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
             +C       Y  YK+WCD YFYL HR E RGIGG+FFD L++       +  FSF+ A
Sbjct: 149 ASLCQPFGEDVYPRYKKWCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFEQSFSFMQA 204

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VG  F+  Y  +V R   H + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESI
Sbjct: 205 VGRGFMDAYRPIVSRRKDHPWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESI 264

Query: 297 LASMPPLVAW 306
           L SMPPLV W
Sbjct: 265 LMSMPPLVRW 274


>gi|261340769|ref|ZP_05968627.1| coproporphyrinogen III oxidase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317192|gb|EFC56130.1| coproporphyrinogen III oxidase [Enterobacter cancerogenus ATCC
           35316]
          Length = 299

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 153/275 (55%), Gaps = 20/275 (7%)

Query: 38  KLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGD 97
           +L++E  +  A      F    W RD       GGGR   L  G VFE+A V  S V+GD
Sbjct: 14  QLQDEICQKLAAEDGGEFQEDSWQRDAG-----GGGRSRVLRNGGVFEQAGVNFSHVHGD 68

Query: 98  LSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGG 151
             P              F A G+S++VHP+NP VP  H N+R  +    GA   +WFGGG
Sbjct: 69  AMPASATAHRPELAGRSFEAMGVSLVVHPHNPFVPTSHANVRFFIAEKPGADPVWWFGGG 128

Query: 152 IDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIG 211
            DLTP      + ++ D + +H T +++C       Y  YK+WCD YFYL HR E RGIG
Sbjct: 129 FDLTPY-----YGFEEDAVHWHTTARDLCLPFGEDVYPTYKKWCDDYFYLKHRDEQRGIG 183

Query: 212 GIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGR 271
           G+FFD L ++P+    D  F F+ AVG  F   Y  +V R  +  +  ++R+ QL RRGR
Sbjct: 184 GLFFDDL-NTPD---FDTAFRFMQAVGQGFTDAYLPIVERRKNTDYGVREREFQLYRRGR 239

Query: 272 YAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           Y EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 240 YVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|213421057|ref|ZP_03354123.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 296

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|194862748|ref|XP_001970103.1| GG10448 [Drosophila erecta]
 gi|190661970|gb|EDV59162.1| GG10448 [Drosophila erecta]
          Length = 390

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 150/279 (53%), Gaps = 33/279 (11%)

Query: 42  EAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPD 101
           EA EN   +    F V  W R +      GGG    L  G VFEKA V +S V G L P 
Sbjct: 105 EAEENCGQK----FKVDRWERPEG-----GGGITCVLQDGDVFEKAGVNISVVTGSLPPA 155

Query: 102 FKDQILGTTKN-------PYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWF 148
              Q+    KN       P+F A+G+S ++HP NPHVP +HFN R            +WF
Sbjct: 156 AVQQMRARGKNLKEGASLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVETAKGEKQWWF 214

Query: 149 GGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESR 208
           GGG DLTP      +  + D   FH TLK  C +H    Y  +K+WCD YF + HR ESR
Sbjct: 215 GGGTDLTPY-----YLCEKDACHFHQTLKSACDEHDATYYPRFKKWCDDYFRIKHRNESR 269

Query: 209 GIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIR 268
           GIGGIFFD + S  +    +A F+F+S+     I  Y  LVR++ +  +   +RQ QL+R
Sbjct: 270 GIGGIFFDDIDSPNQ----EAAFNFVSSCAKAVIPSYMPLVRKHKNQEYGNNERQWQLLR 325

Query: 269 RGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           RGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 326 RGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARW 364


>gi|16761369|ref|NP_456986.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29140934|ref|NP_804276.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213027732|ref|ZP_03342179.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213424311|ref|ZP_03357143.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213647109|ref|ZP_03377162.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213857596|ref|ZP_03384567.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289829709|ref|ZP_06547246.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|21362584|sp|Q8Z4U8|HEM6_SALTI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|25284542|pir||AH0812 coproporphyrinogen oxidase (EC 1.3.3.3) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503668|emb|CAD07682.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136559|gb|AAO68125.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 299

 Score =  205 bits (521), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|289620201|emb|CBI53059.1| unnamed protein product [Sordaria macrospora]
          Length = 409

 Score =  205 bits (521), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 148/262 (56%), Gaps = 25/262 (9%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-------- 114
           D+ Q+++ GGG    L  GKVFEKA V VS VYG L      ++    KN          
Sbjct: 129 DEWQRKEGGGGITCVLQDGKVFEKAGVGVSVVYGTLPKPAIIKMRANHKNLAQDDNIPDS 188

Query: 115 --FWATGLSVIVHPYNPHVPAVHFNIRMIVT-------GAYWFGGGIDLTPSLESRRHSY 165
             F+A GLS+IVHP NP  P VH N R   T       GA+WFGGG DLTPS     + +
Sbjct: 189 LEFFAAGLSLIVHPKNPMAPTVHLNYRYFETANPDGSSGAWWFGGGSDLTPS-----YLF 243

Query: 166 DPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG 225
           D D I FH TLKE+C  H    Y  +K+WCD YFY  HR ESRGIGGIFFD L  +  + 
Sbjct: 244 DEDAIHFHKTLKEVCDAHDKEYYPRFKKWCDEYFYNKHRGESRGIGGIFFDDLDET--VS 301

Query: 226 GIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNF 285
             +  F+F+      F   Y S++ +     F+E++++ Q IRRG+Y EFNL++D+GT F
Sbjct: 302 DKENTFAFVQDALKSFAPNYISIINKRKDMPFTEKEKEWQQIRRGKYVEFNLVHDRGTAF 361

Query: 286 GFKT-GGNVESILASMPPLVAW 306
           G  T G  VESIL S+P    W
Sbjct: 362 GLNTPGARVESILMSLPLTARW 383


>gi|163857413|ref|YP_001631711.1| coproporphyrinogen III oxidase [Bordetella petrii DSM 12804]
 gi|226740641|sp|A9ITM7|HEM6_BORPD RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|163261141|emb|CAP43443.1| hemF [Bordetella petrii]
          Length = 303

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 142/253 (56%), Gaps = 18/253 (7%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  Q+ + GGG    +  G++ E+A VL S V+G   P              + A G+S+
Sbjct: 35  DTWQRPEGGGGVSRLIEGGQLLERAGVLFSHVHGTRLPPSASAHRPELAGRSWQAMGVSL 94

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA---------YWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           ++HP NP+VP  H N+RM V  A         +WFGGG+DLTP      ++++ D   FH
Sbjct: 95  VLHPRNPYVPTTHMNVRMFVAAARPGHDENDVFWFGGGLDLTPY-----YAFEDDARHFH 149

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
              +     H  A Y  YK WCD YFYL HRQE RG+GG+FFD L+      G DA F+ 
Sbjct: 150 QVCRAALDPHGAAYYPQYKRWCDEYFYLKHRQEMRGVGGVFFDDLNEP----GFDASFAL 205

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + +VGD F+  Y  +V+R     +++  R  Q  RRGRY EFNL++D+GT FG ++GG  
Sbjct: 206 LRSVGDAFLPAYLPIVQRRRDTPYTQAQRDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRT 265

Query: 294 ESILASMPPLVAW 306
           ESIL SMPP+  W
Sbjct: 266 ESILLSMPPMAQW 278


>gi|156933010|ref|YP_001436926.1| coproporphyrinogen III oxidase [Cronobacter sakazakii ATCC BAA-894]
 gi|166217800|sp|A7MKX5|HEM6_ENTS8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|156531264|gb|ABU76090.1| hypothetical protein ESA_00813 [Cronobacter sakazakii ATCC BAA-894]
          Length = 301

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 161/286 (56%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC +   ++ +                 ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  DLQDRICQQLSAVDGD----------------DFVEDAWQREGGGGGRSRVLRDGVVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+GD  P              F A G+S++VHP NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPRNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D + +H T +++C+      Y  YK+WCD YFY
Sbjct: 118 GADPVWWFGGGFDLTPF-----YGFEEDAVHWHRTARDLCAPFGDDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HRQE+RGIGG+FFD L++       D  F+F+ AVGD ++  Y  +V R     + E+
Sbjct: 173 LKHRQEARGIGGLFFDDLNTP----DFDTCFAFMQAVGDGYLNAYLPIVERRKTLPWGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 EREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|292493438|ref|YP_003528877.1| coproporphyrinogen oxidase [Nitrosococcus halophilus Nc4]
 gi|291582033|gb|ADE16490.1| Coproporphyrinogen oxidase [Nitrosococcus halophilus Nc4]
          Length = 312

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E+ +  A                ++ D  Q+   GGGR   L  G VFE+
Sbjct: 19  DLQDRICSTLEQEDGAAS---------------FMEDNWQRAAGGGGRSRVLSEGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP+NP+VP  H NIR  +    
Sbjct: 64  GGVNFSHVFGEGLPAAATAQRPELAGRRFQALGVSLVIHPHNPYVPTSHANIRFFLATKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H+T +E C       Y  YK+WCD YFY
Sbjct: 124 GEAPIWWFGGGFDLTPY-----YPFEEDAIHWHHTAREACIPFGEEVYPRYKKWCDEYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD L+      G    F F+ +VG+ +I  Y  +V+R     + E+
Sbjct: 179 LKHRGETRGIGGLFFDDLNEW----GFPRCFDFMQSVGNHYILAYLPIVQRRKTLSYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 235 ERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLPPLVKW 280


>gi|293604472|ref|ZP_06686877.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
 gi|292817053|gb|EFF76129.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
          Length = 303

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 144/261 (55%), Gaps = 23/261 (8%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W+R +      GGG    L  GK+FE+A VL S V G   P              
Sbjct: 32  FRADEWVRPEG-----GGGLSRLLEGGKLFERAGVLFSHVKGTKLPPSASAHRPELAGRA 86

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTGA---------YWFGGGIDLTPSLESRRHSY 165
           + A G+S+++HP NP+VP  H N+RM V  A         +WFGGGIDLTP      + +
Sbjct: 87  WEAMGVSMVLHPRNPYVPTTHMNVRMFVAAARPGHDEADIFWFGGGIDLTPY-----YPF 141

Query: 166 DPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG 225
           + D   FH   ++  + H    Y  YK WCD YF+L HR E+RGIGG+FFD L++     
Sbjct: 142 EEDARHFHTVCRDALASHGPEYYPRYKRWCDEYFFLKHRNETRGIGGVFFDDLNAP---- 197

Query: 226 GIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNF 285
           G DA F+   +VGD F+  Y  +V R     ++E++R  Q  RRGRY EFNL++D+GT F
Sbjct: 198 GFDASFALTRSVGDAFLDSYLPIVERRRGLAYTERERDFQAYRRGRYVEFNLVFDRGTLF 257

Query: 286 GFKTGGNVESILASMPPLVAW 306
           G ++GG  ESIL SMPP+  W
Sbjct: 258 GLQSGGRTESILLSMPPMAQW 278


>gi|56412663|ref|YP_149738.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361598|ref|YP_002141234.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|62510576|sp|Q5PI28|HEM6_SALPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740899|sp|B5BB50|HEM6_SALPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|56126920|gb|AAV76426.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093074|emb|CAR58513.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 308

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|149199270|ref|ZP_01876308.1| Coproporphyrinogen III oxidase [Lentisphaera araneosa HTCC2155]
 gi|149137695|gb|EDM26110.1| Coproporphyrinogen III oxidase [Lentisphaera araneosa HTCC2155]
          Length = 304

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 151/287 (52%), Gaps = 26/287 (9%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATLCAGKV 83
            + LQ  IC   E  + E          K F    W  DKS +  L G G  A +  G V
Sbjct: 13  LQALQKSICKGIEDFDGE----------KSFEFDRW--DKSGQTGLNGFGISAVIKDGAV 60

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           FEK  V  S V G   P       G   N  F A G+S+++HP NP++P  H N+R    
Sbjct: 61  FEKGGVNFSCVEGAKLPGSASAHRGEIANKPFKAAGVSLVLHPRNPYMPTTHANVRFFSA 120

Query: 144 G----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
           G     +WFGGG DLTP      ++++ D   +H   K+ C       Y  YK+WCD YF
Sbjct: 121 GEENPTWWFGGGYDLTPY-----YAFEEDCRHWHQVAKDACKPFGEDVYPRYKKWCDDYF 175

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           YL HR E RG+GG+FFD L+      G D  F F+ A+G+ F+  Y  +  +   H + E
Sbjct: 176 YLKHRDEQRGVGGLFFDDLNEW----GFDKSFEFMQAIGNSFLDAYLPIAEKRKSHPYGE 231

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           ++R  Q+ RRGRY EFNL+YD+GT FG ++GG  E+IL SMPPL +W
Sbjct: 232 RERNFQVQRRGRYVEFNLVYDRGTLFGLQSGGRTEAILMSMPPLASW 278


>gi|218696071|ref|YP_002403738.1| coproporphyrinogen III oxidase [Escherichia coli 55989]
 gi|254800269|sp|B7LCI0|HEM6_ECO55 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218352803|emb|CAU98591.1| coproporphyrinogen III oxidase [Escherichia coli 55989]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+F D L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFVDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|62181020|ref|YP_217437.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224583014|ref|YP_002636812.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75481828|sp|Q57LQ6|HEM6_SALCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800276|sp|C0PZ88|HEM6_SALPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|62128653|gb|AAX66356.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224467541|gb|ACN45371.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322715502|gb|EFZ07073.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 150/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFDFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|198242264|ref|YP_002216521.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205353557|ref|YP_002227358.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226740894|sp|B5FQE4|HEM6_SALDC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740896|sp|B5RCS3|HEM6_SALG2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|197936780|gb|ACH74113.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273338|emb|CAR38309.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326624275|gb|EGE30620.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628653|gb|EGE34996.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|110832996|ref|YP_691855.1| coproporphyrinogen III oxidase [Alcanivorax borkumensis SK2]
 gi|123345891|sp|Q0VTD7|HEM6_ALCBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110646107|emb|CAL15583.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax borkumensis
           SK2]
          Length = 302

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 141/250 (56%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  ++E  GGGR   L  G V EK  V  S V+G+  P    +         F A G+S+
Sbjct: 36  DSWEREQGGGGRSRVLENGAVIEKGGVNFSHVFGEQLPPSATEARPELAGRSFQAMGVSL 95

Query: 123 IVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+VP  H N+R  V         +WFGGG DLTP      + ++ DV+ +H T 
Sbjct: 96  VIHPKNPYVPTSHANVRFFVAEKEGEAPVWWFGGGFDLTPY-----YGFEEDVVHWHQTA 150

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           K  C       Y  +K WCD YFYL HR E RG+GG+FFD L+        D  F+ + +
Sbjct: 151 KVACQPFGKEIYPEFKTWCDDYFYLKHRNEPRGVGGLFFDDLNRF----DFDTSFALMRS 206

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           +GD ++  Y  ++ R   H F +++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESI
Sbjct: 207 IGDAYVPAYQPILARRKDHEFGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQSGGRTESI 266

Query: 297 LASMPPLVAW 306
           L S+PPLV W
Sbjct: 267 LMSLPPLVRW 276


>gi|161612804|ref|YP_001586769.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|189028105|sp|A9N336|HEM6_SALPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|161362168|gb|ABX65936.1| hypothetical protein SPAB_00503 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 150/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFDFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|168231994|ref|ZP_02657052.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168817802|ref|ZP_02829802.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194468954|ref|ZP_03074938.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194455318|gb|EDX44157.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333631|gb|EDZ20395.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205344876|gb|EDZ31640.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320086941|emb|CBY96711.1| Coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 150/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDYCFDFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|200386561|ref|ZP_03213173.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199603659|gb|EDZ02204.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDYCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|153949579|ref|YP_001400260.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           31758]
 gi|167008826|sp|A7FG82|HEM6_YERP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|152961074|gb|ABS48535.1| coproporphyrinogen III oxidase, aerobic [Yersinia
           pseudotuberculosis IP 31758]
          Length = 309

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC    + +  A           FT + W+R     E+ GGGR   L  G VFE+
Sbjct: 15  TLQDNICGALAQADGHAE----------FTEECWVR-----EEGGGGRSRVLVNGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G + P              F A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAMLPASATAHRPELAGRSFQALGVSLVIHPLNPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H     +C       Y  YK+WCD YFY
Sbjct: 120 GEDAVWWFGGGFDLTPY-----YGFEEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HRQE+RGIGG+FFD L+S   M      F+F  AVGD F+  Y  +V R     + ++
Sbjct: 175 IKHRQEARGIGGLFFDDLNSPDFM----TCFNFTQAVGDGFLAAYMPIVARRKALGWGDR 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|168238244|ref|ZP_02663302.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194737732|ref|YP_002115518.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|226740900|sp|B4TR28|HEM6_SALSV RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194713234|gb|ACF92455.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197288914|gb|EDY28287.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RG+GG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTQAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|168466808|ref|ZP_02700662.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194442975|ref|YP_002041712.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|197247962|ref|YP_002147405.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|226740893|sp|B5F0I0|HEM6_SALA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740898|sp|B4T0I0|HEM6_SALNS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194401638|gb|ACF61860.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|195630742|gb|EDX49334.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211665|gb|ACH49062.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|212211772|ref|YP_002302708.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuG_Q212]
 gi|212010182|gb|ACJ17563.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuG_Q212]
          Length = 316

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 153/288 (53%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 22  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 66

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 67  EQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 126

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y+ +K  CD Y
Sbjct: 127 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYSRFKAACDDY 181

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 182 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 237

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 238 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 285


>gi|304398331|ref|ZP_07380205.1| Coproporphyrinogen oxidase [Pantoea sp. aB]
 gi|304354197|gb|EFM18570.1| Coproporphyrinogen oxidase [Pantoea sp. aB]
          Length = 304

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 144/250 (57%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  Q+   GGG+   L  G VFE+A V  S V+GD  P              F A G+S+
Sbjct: 34  DSWQRPGGGGGQSRVLRNGAVFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSL 93

Query: 123 IVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H T 
Sbjct: 94  VIHPKNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDALHWHQTA 148

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
             +C       Y  YK+WCD YFYL HR E RGIGG+FFD L++       +  FSF+ +
Sbjct: 149 ANICQPFGEDVYPRYKKWCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFEQSFSFMQS 204

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VG  FI  Y  +V R   H + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESI
Sbjct: 205 VGRGFIDAYRPIVARRKDHPWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESI 264

Query: 297 LASMPPLVAW 306
           L SMPPLV W
Sbjct: 265 LMSMPPLVRW 274


>gi|238895905|ref|YP_002920641.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae NTUH-K2044]
 gi|238548223|dbj|BAH64574.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 149/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G+VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     +SE++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKATPYSERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|187731800|ref|YP_001881234.1| coproporphyrinogen III oxidase [Shigella boydii CDC 3083-94]
 gi|226740903|sp|B2TX24|HEM6_SHIB3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|187428792|gb|ACD08066.1| coproporphyrinogen III oxidase, aerobic [Shigella boydii CDC
           3083-94]
          Length = 299

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L    VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREAGGGGRSRVLRNDGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|283786069|ref|YP_003365934.1| coproporphyrinogen III oxidase [Citrobacter rodentium ICC168]
 gi|282949523|emb|CBG89138.1| coproporphyrinogen III oxidase [Citrobacter rodentium ICC168]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 146/252 (57%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G VFE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWQREAGGGGRSRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP++P  H N+R  +    GA   +WFGGG DLTP      + +  D + +H 
Sbjct: 92  SLVVHPLNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFAEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEEVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG  + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGKGYTEAYLPIVERRKAMIWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|303286049|ref|XP_003062314.1| coproporphyrinogen III oxidase chloroplast precursor [Micromonas
           pusilla CCMP1545]
 gi|226455831|gb|EEH53133.1| coproporphyrinogen III oxidase chloroplast precursor [Micromonas
           pusilla CCMP1545]
          Length = 380

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 164/320 (51%), Gaps = 42/320 (13%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           L  +  G  DD    +   ++     Q+ IC+  E+L+ +  +  A           W R
Sbjct: 60  LTLLREGGGDDAGSMRAKFEKMIRAAQNEICSAVEELDGQKFQEDA-----------WTR 108

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDF-----KDQILGTTKNPYFWA 117
                   GGG    L  G VFEKA V VS VYG + P+       +Q  G    P+F A
Sbjct: 109 PGG-----GGGISRVLQGGNVFEKAGVNVSVVYGQMPPEAYRAATGEQGSGKEMIPFF-A 162

Query: 118 TGLSVIVHPYNPHVPAVHFNIRMIVTGA----------YWFGGGIDLTPSLESRRHSYDP 167
            G+S ++HP+NP  P VHFN R   T A          +WFGGG DLTPS     + +  
Sbjct: 163 AGISSVMHPHNPMAPTVHFNYRYFETDAPEGAEAAPRAWWFGGGTDLTPS-----YVFPE 217

Query: 168 DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHR-QESRGIGGIFFDHLHSSPEMGG 226
           D   FH TLK+ C +H  A Y  +KEW D YF + HR  E RGIGG+FFD ++  P+   
Sbjct: 218 DAAHFHGTLKDACDKHDEAFYPRFKEWADDYFIIKHRMNERRGIGGVFFDDMNDRPQ--- 274

Query: 227 IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
            +   +F + +    +  Y  LV ++    F+EQ R+ Q +RRGRY EFNL+YD+GT FG
Sbjct: 275 -EELLAFATDMAAAVVPAYVPLVAKHKDDEFTEQQREWQQMRRGRYVEFNLVYDRGTTFG 333

Query: 287 FKTGGNVESILASMPPLVAW 306
            +TGG +ESIL S+P    W
Sbjct: 334 LRTGGRIESILMSLPLTARW 353


>gi|158333806|ref|YP_001514978.1| coproporphyrinogen III oxidase [Acaryochloris marina MBIC11017]
 gi|158304047|gb|ABW25664.1| coproporphyrinogen III oxidase, aerobic [Acaryochloris marina
           MBIC11017]
          Length = 341

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 160/320 (50%), Gaps = 43/320 (13%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
            P    + K    +    LQ  IC + + L+ ++           F    W R +     
Sbjct: 14  APPPPSDSKEQVGKFLRGLQDSICDKLQTLDGKS----------TFQEDSWDRPEG---- 59

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGGR   L  G + E+  V  S V+GD  P    +         F+ATG S+++HP +P
Sbjct: 60  -GGGRSRVLREGGLLEQGGVNYSEVWGDHLPPSILKQRPEAAGHRFYATGTSMVLHPRSP 118

Query: 130 HVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           +VP VH N R    G  +WFGGGIDLTP      + +  DV+ FH T+K  C +H    Y
Sbjct: 119 YVPTVHLNYRYFEAGPVWWFGGGIDLTPY-----YPFKEDVVHFHQTMKAACDRHHPEYY 173

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGI--------------- 227
           + +K WCD YFYL HRQE RG+GGIFFD+      L+  P   GI               
Sbjct: 174 STFKPWCDEYFYLKHRQEMRGVGGIFFDYQDGIGALYRGPHAEGIAAHHSDQLGSLPQRS 233

Query: 228 -DADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
            D  F+F    G+ F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG
Sbjct: 234 WDEIFAFAQDCGNAFLPAYVPIVERRRDTEYGDRERNFQLYRRGRYVEFNLVYDRGTIFG 293

Query: 287 FKTGGNVESILASMPPLVAW 306
            +T G  ESIL S+PPLV W
Sbjct: 294 LQTNGRTESILMSLPPLVRW 313


>gi|330824920|ref|YP_004388223.1| Coproporphyrinogen-III oxidase [Alicycliphilus denitrificans K601]
 gi|329310292|gb|AEB84707.1| Coproporphyrinogen-III oxidase, aerobic [Alicycliphilus
           denitrificans K601]
          Length = 308

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 148/283 (52%), Gaps = 19/283 (6%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            E LQ+ I    E++E E            F    W R+       G G    L  G+VF
Sbjct: 18  LEGLQARITGALEEVEGEGGAR--------FRSDAWRREAGSPLQ-GDGITRILEGGRVF 68

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+RMI  G
Sbjct: 69  ERAGCGFSHVSGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRMIAAG 128

Query: 145 -AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            A WFGGG+DLTP      + ++ D + FH   ++  +      Y  +K WCD YF+L H
Sbjct: 129 DACWFGGGMDLTPY-----YGFEEDAVHFHRACRDALAPFGEGQYPRFKTWCDEYFFLKH 183

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R E RG+GGIFFD         G +   +   +VGD F+  Y  +V+R     + E++R 
Sbjct: 184 RGEQRGVGGIFFDDFSEL----GFEQSLAMTQSVGDAFLGAYLPIVQRRMDMPWGERERD 239

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL AW
Sbjct: 240 FQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLAAW 282


>gi|297183544|gb|ADI19673.1| coproporphyrinogen III oxidase [uncultured Alteromonadales
           bacterium HF4000_16C08]
          Length = 310

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 156/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +            F    W+R     E+ GGGR   +  G V E+
Sbjct: 25  SLQDNICQTLELADGKGQ----------FVEDSWIR-----EEGGGGRSRVIKNGAVIEQ 69

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G   P              F A G+S+++HP+NP+VP  H N+R  +    
Sbjct: 70  GGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYVPTSHANVRFFIAEKE 129

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  DV+ +H+T K++C+      Y  YK+WCD+YFY
Sbjct: 130 GEAPIWWFGGGFDLTPF-----YPFKEDVVHWHDTAKKLCAPFGEEVYQTYKDWCDKYFY 184

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G +  F+++ AVG+ ++  Y  +V +   + +S +
Sbjct: 185 LKHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGNGYLDAYIPIVEKRKENQYSAR 240

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 241 ERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|204929614|ref|ZP_03220688.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321333|gb|EDZ06533.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RG+GG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|238912866|ref|ZP_04656703.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 151/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RG+GG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGNDVYPRYKKWCDDYFFLKHRNEQRGVGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|238792064|ref|ZP_04635700.1| Coproporphyrinogen III oxidase [Yersinia intermedia ATCC 29909]
 gi|238728695|gb|EEQ20213.1| Coproporphyrinogen III oxidase [Yersinia intermedia ATCC 29909]
          Length = 308

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 152/285 (53%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC      +  A           FT + W R     E+ GGGR   L  G VFE+A
Sbjct: 16  LQDKICAALTHADGRA----------TFTEETWTR-----EEGGGGRSRVLVNGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V  S V G   P              F A G+S+++HP +P++P  H N+R  +     
Sbjct: 61  GVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKPG 120

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ D I +H T  ++C       Y  YK+WCD YFY+
Sbjct: 121 EDPVWWFGGGFDLTPY-----YGFEEDAIHWHQTAHQLCQPFGKEVYPRYKKWCDDYFYI 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGG+F+D L +SP+    D  F F  AVGD F+  Y  +V R     + EQ+
Sbjct: 176 KHRNEARGIGGLFYDDL-NSPDF---DTCFRFTQAVGDGFLDAYMPIVARRKALSWGEQE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|307175814|gb|EFN65629.1| Coproporphyrinogen III oxidase [Camponotus floridanus]
          Length = 395

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/290 (41%), Positives = 155/290 (53%), Gaps = 36/290 (12%)

Query: 29  QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAA 88
           Q+  C   E LEN       NRS   F V  W R +      GGG    L  G+VFEKA 
Sbjct: 94  QADFCKALELLEN-------NRSS--FKVDRWFRKEG-----GGGITCVLQDGQVFEKAG 139

Query: 89  VLVSTVYGDLSPDFKDQILGTTKN-----PYFWATGLSVIVHPYNPHVPAVHFNIRMIV- 142
           V VS V G L P+   Q+    K      P+F A G+S ++HP NP +P +HFN R    
Sbjct: 140 VNVSVVTGILPPNAIQQMRARGKKMEDSVPFF-AAGVSAVIHPRNPMIPTIHFNYRYFEV 198

Query: 143 -----TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                T  +WFGGG DLTP     +     DV  FH+TLK  C +H    Y  +K+WCD 
Sbjct: 199 ENPDGTTQWWFGGGTDLTPYYLDEK-----DVKHFHDTLKVACDKHDPTYYAKFKKWCDD 253

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFY+ HR+E RG+GGIFFD L S  +    D  F F+++  +  I  Y  LV+++    +
Sbjct: 254 YFYIVHREERRGVGGIFFDDLDSPSQ----DEAFQFVTSCAEAVIPSYIPLVKKHKDDGY 309

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
              +RQ QL+RRGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 310 GYHERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLNAKW 359


>gi|16765771|ref|NP_461386.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167991749|ref|ZP_02572848.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168243221|ref|ZP_02668153.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447386|ref|YP_002046516.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197264323|ref|ZP_03164397.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|462259|sp|P33771|HEM6_SALTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740897|sp|B4TCI1|HEM6_SALHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|310642|gb|AAA27139.1| oxygen-dependent coproporphyrinogen III oxidase [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|16420991|gb|AAL21345.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194405690|gb|ACF65909.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197242578|gb|EDY25198.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205329849|gb|EDZ16613.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337576|gb|EDZ24340.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261247651|emb|CBG25478.1| Coprogen oxidase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994556|gb|ACY89441.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159003|emb|CBW18516.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913439|dbj|BAJ37413.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222848|gb|EFX47919.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323130781|gb|ADX18211.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989379|gb|AEF08362.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 150/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RG+GG+FFD L ++P+    D  F F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLFFDDL-NTPD---FDHCFDFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|254429328|ref|ZP_05043035.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax sp. DG881]
 gi|196195497|gb|EDX90456.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax sp. DG881]
          Length = 302

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 140/250 (56%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  ++E  GGGR   L  G V EK  V  S V+GD  P              F A G+S+
Sbjct: 36  DSWEREQGGGGRSRVLENGAVIEKGGVNFSHVFGDQLPPSATAARPELAGRSFQAMGVSL 95

Query: 123 IVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+ P  H N+R  V         +WFGGG DLTP      + ++ DV+ +H T 
Sbjct: 96  VIHPKNPYAPTSHANVRFFVAEKDGEDPVWWFGGGFDLTPY-----YGFEEDVVHWHQTA 150

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           ++ C       Y  +K WCD YFYL HR E RG+GG+FFD L+        D  F+ + +
Sbjct: 151 RDACEPFGNEIYPEFKTWCDDYFYLKHRDEPRGVGGLFFDDLNRF----DFDTSFALMRS 206

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VGD ++  Y  ++ R   H + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESI
Sbjct: 207 VGDAYVPAYQPILARRKDHDYGERERQFQLYRRGRYVEFNLVYDRGTIFGLQSGGRTESI 266

Query: 297 LASMPPLVAW 306
           L S+PPLV W
Sbjct: 267 LMSLPPLVRW 276


>gi|167549538|ref|ZP_02343297.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325482|gb|EDZ13321.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 149/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +         +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPDADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|194367710|ref|YP_002030320.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia
           R551-3]
 gi|226740905|sp|B4SNL7|HEM6_STRM5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194350514|gb|ACF53637.1| Coproporphyrinogen oxidase [Stenotrophomonas maltophilia R551-3]
          Length = 298

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 152/286 (53%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAIEAADGQAR----------FQEDLW-----QRAEGGGGRTRVLRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + ATG+S++ HP NP+VP  H N+R       
Sbjct: 58  AGIGFSDVAGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANVRFFQAQRD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      + +D DV  +H   +++C+      Y  +K WCD YF+
Sbjct: 118 GEVVASWFGGGFDLTPF-----YPFDEDVQHWHRVARDLCAPFGDERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD LH     G  + DF ++ AVGD F+  Y  +V++     + E+
Sbjct: 173 LRHRNETRGVGGLFFDDLH-----GDFERDFDYLRAVGDGFLDAYLPIVQQRKDTAYGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|195471609|ref|XP_002088095.1| GE14253 [Drosophila yakuba]
 gi|194174196|gb|EDW87807.1| GE14253 [Drosophila yakuba]
          Length = 390

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 150/279 (53%), Gaps = 33/279 (11%)

Query: 42  EAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPD 101
           EA EN   +    F V  W R +      GGG    L  G VFEKA V +S V G L P 
Sbjct: 105 EAEENCGQK----FKVDRWERPEG-----GGGITCVLQDGDVFEKAGVNISVVTGSLPPA 155

Query: 102 FKDQILGTTKN-------PYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWF 148
              Q+    KN       P+F A+G+S ++HP NPHVP +HFN R            +WF
Sbjct: 156 AVQQMRARGKNLKEGASLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVETAKGEKQWWF 214

Query: 149 GGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESR 208
           GGG DLTP      +  + D   FH TLK  C +H    Y  +K+WCD YF + HR ESR
Sbjct: 215 GGGTDLTPY-----YLCEKDASHFHQTLKSACDEHDATYYPRFKKWCDDYFRIKHRNESR 269

Query: 209 GIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIR 268
           GIGGIFFD + S  +    +A F+F+S+     I  Y  LVR++ +  +   +RQ QL+R
Sbjct: 270 GIGGIFFDDIDSPNQ----EAAFNFVSSCAKAVIPSYVPLVRKHKNREYGNNERQWQLLR 325

Query: 269 RGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           RGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 326 RGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARW 364


>gi|238759434|ref|ZP_04620598.1| Coproporphyrinogen III oxidase [Yersinia aldovae ATCC 35236]
 gi|238702331|gb|EEP94884.1| Coproporphyrinogen III oxidase [Yersinia aldovae ATCC 35236]
          Length = 308

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 154/285 (54%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC    + +  A           FT + W R     E+ GGGR   L  G VFE+A
Sbjct: 16  LQDKICAALAQADGHA----------AFTEESWTR-----EEGGGGRSRVLVNGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V  S V G   P              F A G+S+++HP +P++P  H N+R  +     
Sbjct: 61  GVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKAG 120

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ D I +H T  ++C       Y  YK+WCD YFY+
Sbjct: 121 EDPVWWFGGGFDLTPY-----YGFEEDAIHWHQTAHQLCQPFGDEVYPRYKKWCDDYFYI 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGG+F+D L +SP+ G     F+F  AVGD F+  Y  +V R     + E++
Sbjct: 176 KHRDEARGIGGLFYDDL-NSPDFGTC---FNFTQAVGDGFLAAYMPIVARRKALSWGERE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|195577185|ref|XP_002078453.1| GD23442 [Drosophila simulans]
 gi|194190462|gb|EDX04038.1| GD23442 [Drosophila simulans]
          Length = 390

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 150/279 (53%), Gaps = 33/279 (11%)

Query: 42  EAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPD 101
           EA EN   +    F V  W R +      GGG    L  G VFEKA V +S V G L P 
Sbjct: 105 EAEENCGQK----FKVDRWERPEG-----GGGITCVLQDGDVFEKAGVNISVVTGSLPPA 155

Query: 102 FKDQILGTTKN-------PYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWF 148
              Q+    KN       P+F A+G+S ++HP NPHVP +HFN R            +WF
Sbjct: 156 AVQQMRARGKNLKEGASLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVETAKGEKQWWF 214

Query: 149 GGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESR 208
           GGG DLTP      +  + D   FH TLK  C +H    Y  +K+WCD YF + HR ESR
Sbjct: 215 GGGTDLTPY-----YLCEKDASHFHQTLKSACDEHDATYYPRFKKWCDDYFRIKHRNESR 269

Query: 209 GIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIR 268
           GIGGIFFD + S  +    +A F+F+S+     I  Y  LVR++ +  +   +RQ QL+R
Sbjct: 270 GIGGIFFDDIDSPNQ----EAAFNFVSSCARAVIPSYVPLVRKHKNREYGNNERQWQLLR 325

Query: 269 RGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           RGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 326 RGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARW 364


>gi|311278640|ref|YP_003940871.1| Coproporphyrinogen oxidase [Enterobacter cloacae SCF1]
 gi|308747835|gb|ADO47587.1| Coproporphyrinogen oxidase [Enterobacter cloacae SCF1]
          Length = 299

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 154/285 (54%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC +   ++ +            F+  +W RD          R   L  G VFE+A
Sbjct: 15  LQDSICQQLAAVDGQT-----------FSEDNWQRDGGGGG-----RSRVLRNGGVFEQA 58

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---G 144
            V  S V+GD  P              F A G+S++VHP+NP+VP  H N+R  +    G
Sbjct: 59  GVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKPG 118

Query: 145 A---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           A   +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+WCD YFYL
Sbjct: 119 ADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEDVYPRYKKWCDDYFYL 173

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  +V R     F E++
Sbjct: 174 RHRQEQRGIGGLFFDDLNTP----DFDRCFAFMQAVGNGYTDAYLPIVERRKAMAFGERE 229

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 230 RDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|215919240|ref|NP_820710.2| coproporphyrinogen III oxidase [Coxiella burnetii RSA 493]
 gi|206584124|gb|AAO91224.2| coproporphyrinogen III oxidase [Coxiella burnetii RSA 493]
          Length = 316

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 152/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 22  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 66

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 67  EQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 126

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 127 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 181

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 182 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 237

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 238 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 285


>gi|254281629|ref|ZP_04956597.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR51-B]
 gi|219677832|gb|EED34181.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR51-B]
          Length = 305

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 154/288 (53%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
             +LQ  IC    +++            K FT + W R +      GGG    +  G VF
Sbjct: 10  LRDLQGRICDGLAEIDGA----------KTFTEESWDRPEG-----GGGTTRVIADGNVF 54

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           EK  V  S V G   P    +         F A G+S+++HP NP+VP  H N+RM V  
Sbjct: 55  EKGGVNFSHVTGTNLPPSATESRPELAGRSFRAMGVSLVIHPKNPYVPTSHANVRMFVAE 114

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +W GGG DLTP      +    D + +H T +E C       Y  +K+WCD Y
Sbjct: 115 KPGEEPVWWMGGGFDLTPY-----YGDADDAVSWHRTAQEACEPFGDDVYPRFKKWCDDY 169

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HRQE+RG+GG+F+D L+      G D  F+F+ +VGD +++ Y  +VR++    + 
Sbjct: 170 FYLKHRQEARGVGGLFYDDLNEW----GFDRTFAFMRSVGDAYLEAYAPIVRKHKDDAYG 225

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E++RQ QL RRGRY EFNL+YD+GT FG ++ G  E+IL S+PPLV W
Sbjct: 226 ERERQWQLYRRGRYVEFNLVYDRGTLFGLQSNGRTEAILMSLPPLVRW 273


>gi|241668609|ref|ZP_04756187.1| coproporphyrinogen III oxidase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877143|ref|ZP_05249853.1| coproporphyrinogen III oxidase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843164|gb|EET21578.1| coproporphyrinogen III oxidase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 308

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 161/296 (54%), Gaps = 21/296 (7%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           +++I+Q  FEN       + ++      E S   S K  + K    D  +++  G G   
Sbjct: 2   QEKITQ--FENF----LAQLQQKITSTLEQSETSSAKFISDKWQKPDTPEQKLKGYGNSM 55

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G++FEK  V  S V+GD  P              F ATG+S+++HP NP VP  H 
Sbjct: 56  IIEGGEIFEKGVVAFSRVHGDALPPSATAKRQELAGKSFIATGVSLVIHPRNPFVPTSHA 115

Query: 137 NIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N R+ V GA      +WFGGG DLTP      + ++ D I +H T K +C +H  + Y  
Sbjct: 116 NFRIFVAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDTSYYPS 170

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K+WCD YFYL HR E RG+GG+FFD L+        D  F F++   + ++  Y  +V 
Sbjct: 171 FKKWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFKFVTDCANSYLDAYIPIVE 226

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 227 KRKNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|238799202|ref|ZP_04642652.1| Coproporphyrinogen III oxidase [Yersinia mollaretii ATCC 43969]
 gi|238716960|gb|EEQ08826.1| Coproporphyrinogen III oxidase [Yersinia mollaretii ATCC 43969]
          Length = 308

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC      +  A           F  ++W R     E+ GGGR   L  G VFE+
Sbjct: 15  DLQDKICVALAAADGSA----------TFAEENWTR-----EEGGGGRSRVLINGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P           +  F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELADRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+WCD YFY
Sbjct: 120 GEDPVWWFGGGFDLTPF-----YGFEEDAVHWHKTAYQLCQPFGEQIYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L+S       D  FSF  AVGD F+  Y  +V R     + E+
Sbjct: 175 IKHRHEARGIGGLFFDDLNSP----DFDTCFSFTQAVGDGFLDAYLPIVARRKTLSWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|107099017|ref|ZP_01362935.1| hypothetical protein PaerPA_01000025 [Pseudomonas aeruginosa PACS2]
          Length = 308

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W R        GGGR   +  G + EK
Sbjct: 17  DLQDRICAALEAEDGKAR----------FAEDAWERPAG-----GGGRTRVIGDGALIEK 61

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+GD  P              F A G+S+++HP NPHVP  H N+R       
Sbjct: 62  GGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAEKE 121

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      ++++ D + +H   ++ C+      Y  YKEWCDRYF+
Sbjct: 122 GEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFH 176

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R  H  F E+
Sbjct: 177 LKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKHTPFDER 232

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 233 QREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 278


>gi|187923296|ref|YP_001894938.1| coproporphyrinogen III oxidase [Burkholderia phytofirmans PsJN]
 gi|226740648|sp|B2T2A3|HEM6_BURPP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|187714490|gb|ACD15714.1| Coproporphyrinogen oxidase [Burkholderia phytofirmans PsJN]
          Length = 307

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 145/258 (56%), Gaps = 16/258 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W R   +K   GGG    L  GK FE+A +  S V GD  P              
Sbjct: 34  FATDAWQRAPGEKLR-GGGYTRILEGGKFFERAGIGFSDVAGDALPGSASAARPQLAGRG 92

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S+++HP+NPH P VH N+R+++         +WFGGG+DLTP      + Y+ D
Sbjct: 93  FEAMGVSLVLHPHNPHCPTVHMNVRLLIATKPGEEPVFWFGGGMDLTPY-----YGYEED 147

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
              FH T ++    +    Y  +K WCD YF+L HR E+RGIGGIFFD   S+P   G D
Sbjct: 148 ARHFHRTCRDALQPYGADLYPSFKRWCDEYFFLKHRNEARGIGGIFFDDF-SAP---GFD 203

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+ + +VGD F+K Y  +V +  +  + + +R  Q  RRGRY EFNL++D+GT FG +
Sbjct: 204 QSFAMLKSVGDAFLKAYLPIVEKRRNIPYGQAERDFQAYRRGRYVEFNLVFDRGTLFGLQ 263

Query: 289 TGGNVESILASMPPLVAW 306
           +GG  ESIL SMPP+V W
Sbjct: 264 SGGRTESILMSMPPVVNW 281


>gi|15595222|ref|NP_248714.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAO1]
 gi|116053744|ref|YP_788179.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296386498|ref|ZP_06875997.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAb1]
 gi|313111453|ref|ZP_07797255.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           39016]
 gi|1170220|sp|P43898|HEM6_PSEAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122262121|sp|Q02V57|HEM6_PSEAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|9945844|gb|AAG03414.1|AE004442_1 coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           PAO1]
 gi|695693|emb|CAA59376.1| oxygen-dependent coproporphyrinogen III oxidase [Pseudomonas
           aeruginosa PAO1]
 gi|115588965|gb|ABJ14980.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310883757|gb|EFQ42351.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           39016]
          Length = 305

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W R        GGGR   +  G + EK
Sbjct: 14  DLQDRICAALEAEDGKAR----------FAEDAWERPAG-----GGGRTRVIGDGALIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+GD  P              F A G+S+++HP NPHVP  H N+R       
Sbjct: 59  GGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      ++++ D + +H   ++ C+      Y  YKEWCDRYF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R  H  F E+
Sbjct: 174 LKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKHTPFDER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|332991535|gb|AEF01590.1| coproporphyrinogen III oxidase [Alteromonas sp. SN2]
          Length = 314

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +            F    W+R     E+ GGGR   +  G V E+
Sbjct: 29  SLQDNICQTLELADGKGQ----------FKEDSWVR-----EEGGGGRSRVIKNGAVIEQ 73

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G   P              F A G+S+++HP+NP++P  H N+R  +    
Sbjct: 74  GGVNFSHVFGSQMPASATAHRPELAGRNFQAMGVSLVIHPHNPYIPTSHANVRFFIAEKE 133

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  DV+ +HNT K++C+      Y  YK+WCD YF+
Sbjct: 134 GEAPIWWFGGGFDLTPF-----YPFKDDVVHWHNTAKKLCAPFGEDVYGKYKKWCDDYFF 188

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+  Y  +V +     + E+
Sbjct: 189 LKHRNETRGVGGLFFDDLNDW----GFETSFNFMQAVGNGFVDAYVPIVEKRKSTSYGER 244

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 245 ERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 290


>gi|126655680|ref|ZP_01727119.1| coproporphyrinogen III oxidase [Cyanothece sp. CCY0110]
 gi|126623159|gb|EAZ93864.1| coproporphyrinogen III oxidase [Cyanothece sp. CCY0110]
          Length = 315

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 160/306 (52%), Gaps = 47/306 (15%)

Query: 26  ENLQSIICTEFEKLENEA--HENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           + LQ  IC   EK +     HE+S            W     Q+E+ GGGR   L  G +
Sbjct: 2   KTLQDEICQGLEKADGSGKFHEDS------------W-----QREEGGGGRSRVLRDGNL 44

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
            E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P VH N R    
Sbjct: 45  LEQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTSMVLHPRNPYIPTVHLNYRYFEA 104

Query: 144 G-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
           G  +WFGGGIDLTP      + +  D   FH TLKE C +H    Y  +K WCD YFYL 
Sbjct: 105 GPVWWFGGGIDLTPY-----YPFAEDASQFHRTLKETCDKHHCEYYPVFKSWCDEYFYLK 159

Query: 203 HRQESRGIGGIFFDHLHSS-PEMGGIDAD---------------------FSFISAVGDC 240
           HRQE+RG+GGIFFD+   + P   G  AD                     F+F++  G  
Sbjct: 160 HRQETRGVGGIFFDYQDGTDPLYRGPHADKAAANYSNQLSDLKPRNWEELFAFVNDCGRT 219

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  +V +  +  + +++RQ QL RRGRY EFNL+YD+GT FG +T G  ESIL S+
Sbjct: 220 FLPAYLPIVEKRRNTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSL 279

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 280 PPLVRW 285


>gi|113474939|ref|YP_721000.1| coproporphyrinogen III oxidase [Trichodesmium erythraeum IMS101]
 gi|110165987|gb|ABG50527.1| coproporphyrinogen oxidase [Trichodesmium erythraeum IMS101]
          Length = 343

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 164/316 (51%), Gaps = 46/316 (14%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + ++R+SQ   + LQ  IC   E+L+                V  +  D  ++   GGG+
Sbjct: 18  DTKERVSQF-MQTLQDEICQGLEELDG---------------VSKFKEDSWKRPGGGGGK 61

Query: 75  MATLCAGKVFEKAAVLVSTVYGD-LSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              +  G VFE+  V  S V+GD L P    Q      N  F+ATG S+++HP NP+VP 
Sbjct: 62  SRVIRDGGVFEQGGVNFSEVWGDKLPPSVLKQRPEAAGNS-FYATGTSMVLHPKNPYVPT 120

Query: 134 VHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           VH N R    G+ +WFGGG+DLTP      + Y  D   FH T+K  C +     Y  +K
Sbjct: 121 VHLNYRYFEAGSVWWFGGGVDLTPY-----YPYAEDAAHFHQTIKAACDKSHKEYYPIFK 175

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD---------------- 230
            WCD YFYL HRQE+RG+GGIFFD+      L+  P+  G  A                 
Sbjct: 176 RWCDEYFYLKHRQETRGVGGIFFDYQDGQGELYKGPDNQGPAATYSKDLGILESRSWESL 235

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG 290
           F+F+   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T 
Sbjct: 236 FTFVQNCGVSFLPAYKIIVERRQPMKYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQTN 295

Query: 291 GNVESILASMPPLVAW 306
           G  ESIL S+PPLV W
Sbjct: 296 GRTESILMSLPPLVRW 311


>gi|168261517|ref|ZP_02683490.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205349335|gb|EDZ35966.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 299

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 150/252 (59%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  ++E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  VEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP+NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPHNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F F+
Sbjct: 147 TARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDYCFVFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ + + Y  +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|329119394|ref|ZP_08248080.1| coproporphyrinogen III oxidase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464539|gb|EGF10838.1| coproporphyrinogen III oxidase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 302

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
              LQ+ IC   E  E    EN A     +F  +HW      +  LG G    L  G VF
Sbjct: 10  LRTLQNHICAALEAEE----ENGA-----VFLGEHW------QSRLGTGESRVLKQGAVF 54

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S V G + P              F A G+S+++HP NP+VP  H N+R     
Sbjct: 55  EQAGVNFSHVKGGVMPASATAGRPELAGAAFEAAGVSLVIHPRNPYVPTSHANVRFFCAR 114

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + +D D++ +H T K++C + +   Y  YK+WCD Y
Sbjct: 115 PQGEEPVWWFGGGFDLTPF-----YPFDEDILHWHQTAKKLCDRFSDGLYAEYKKWCDEY 169

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYLPHR E+RG+GG+FFD L+       +D    FI   G+ +   Y  +V R  H    
Sbjct: 170 FYLPHRGETRGVGGLFFDDLNRWDFATCLD----FIRQTGEAYTAAYRPIVARRKHTPHG 225

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           E++RQ QL RRGRY EFNL++D+GT+FG ++GG  ESIL S+PPLV
Sbjct: 226 ERERQFQLYRRGRYVEFNLVFDRGTHFGLQSGGRTESILMSLPPLV 271


>gi|254453431|ref|ZP_05066868.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           238]
 gi|198267837|gb|EDY92107.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           238]
          Length = 293

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 161/301 (53%), Gaps = 17/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK-IFTVKHWLRDKSQKEDLGG 72
           +++ K  +   F  L+  I   FE LE+       +  P   F V    R     ED GG
Sbjct: 1   MKQEKAAASVWFRTLRDEIVQSFENLEDTQAVGPFSGLPAGRFEVTQTTRTGDAGEDAGG 60

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL------GTTKNPYFWATGLSVIVHP 126
           G M+ +  G+VFEK  V +STV+G L P  +  ++      G   +P FWA+G+S++ H 
Sbjct: 61  GVMSVMRGGRVFEKVGVNISTVHGTLGPRAQAAMMARKGFDGMADDPRFWASGISLVAHM 120

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH P+VH N RM  T  A+WFGGG DL P +E     Y  D   FH T +     H  
Sbjct: 121 QNPHTPSVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YSDDTAHFHATQQTWLDPHGE 175

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y   K W D YFY+PHR  +RG+GG+F D   +    G   ADF+    +G  F+  Y
Sbjct: 176 AHYPKLKAWADEYFYIPHRNRARGVGGVFMDDYST----GDWAADFALTQDLGRAFLPAY 231

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV    +  +++ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+  
Sbjct: 232 QPLVEGRRNTKWTDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPMAK 291

Query: 306 W 306
           W
Sbjct: 292 W 292


>gi|171688758|ref|XP_001909319.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944341|emb|CAP70451.1| unnamed protein product [Podospora anserina S mat+]
          Length = 511

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 149/263 (56%), Gaps = 25/263 (9%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY------- 114
           +D+ Q+++ GGG    L  GKVFEKA V VS VYG L      ++    KN         
Sbjct: 230 KDEWQRKEGGGGITCCLQDGKVFEKAGVGVSVVYGTLPKPAIMKMSANHKNIAPDGEVPE 289

Query: 115 ---FWATGLSVIVHPYNPHVPAVHFNIRMIVT-------GAYWFGGGIDLTPSLESRRHS 164
              F+A GLS+IVHP NP  P VH N R   T       GA+WFGGG DLTPS     + 
Sbjct: 290 SLEFFAAGLSLIVHPKNPMAPTVHLNYRYFETAKPDGSSGAWWFGGGSDLTPS-----YL 344

Query: 165 YDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM 224
           +D D I FH  LKE+C +H    Y  +K+WCD YFY  HR E+RGIGGIFFD L  +  +
Sbjct: 345 FDEDAIQFHRDLKEVCDKHNKDYYPKFKKWCDEYFYNKHRGEARGIGGIFFDDLDET--V 402

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +  F+FI      FI  Y  +V +     F+E ++  Q IRRG+Y EFNL++D+GT+
Sbjct: 403 SDKENTFAFIQDSLKSFIPTYVPIVLKRKDMPFTEAEKDWQQIRRGKYVEFNLVHDRGTS 462

Query: 285 FGFKT-GGNVESILASMPPLVAW 306
           FG  T G  VESIL SMP   +W
Sbjct: 463 FGLNTPGARVESILMSMPLTASW 485


>gi|164428005|ref|XP_956249.2| coproporphyrinogen III oxidase [Neurospora crassa OR74A]
 gi|18376156|emb|CAD21231.1| probable coproporphyrinogen oxidase precursor [Neurospora crassa]
 gi|157071970|gb|EAA27013.2| coproporphyrinogen III oxidase [Neurospora crassa OR74A]
          Length = 409

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 167/325 (51%), Gaps = 38/325 (11%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN------SANRSPKIFTVKH 59
           I    P   E  ++I + K  N  S +    EK   E  +        A+ +P  F V  
Sbjct: 73  IRCDSPTLAERDQQIKREKGVNDASPMRLRMEKFVKEQQKEIVRALEEADGTP--FRVDE 130

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY----- 114
           W     Q+++ GGG    L  GKVFEKA V VS VYG L      ++    KN       
Sbjct: 131 W-----QRKEGGGGITCVLQEGKVFEKAGVGVSVVYGTLPKPAIIKMRANHKNLAQEDDI 185

Query: 115 -----FWATGLSVIVHPYNPHVPAVHFNIRMIVT-------GAYWFGGGIDLTPSLESRR 162
                F+A GLS+IVHP NP  P VH N R   T       GA+WFGGG DLTPS     
Sbjct: 186 PDSLEFFAAGLSLIVHPKNPMAPTVHLNYRYFETANPDGSSGAWWFGGGSDLTPS----- 240

Query: 163 HSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP 222
           + +D D I FH +LKE+C  H    Y  +K+WCD YFY  HR E RGIGGIFFD L  + 
Sbjct: 241 YLFDEDAIQFHKSLKEVCDAHDKEYYPRFKKWCDEYFYNKHRGECRGIGGIFFDDLDET- 299

Query: 223 EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKG 282
            +   +  F+F+      F   Y S++ +     ++E++++ Q IRRG+Y EFNL++D+G
Sbjct: 300 -VSDKENTFAFVQDALKSFAPTYISIINKRKDMPYTEEEKRWQQIRRGKYVEFNLVHDRG 358

Query: 283 TNFGFKT-GGNVESILASMPPLVAW 306
           T FG  T G  VESIL S+P    W
Sbjct: 359 TAFGLNTPGARVESILMSLPLTARW 383


>gi|163803307|ref|ZP_02197185.1| coproporphyrinogen III oxidase [Vibrio sp. AND4]
 gi|159172877|gb|EDP57716.1| coproporphyrinogen III oxidase [Vibrio sp. AND4]
          Length = 305

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E  + +A          +F    W R+K ++   GGGR   L  G +FE+
Sbjct: 15  SLQDSICQQLEHEDGQA----------VFVEDAWQREKGERLG-GGGRTRVLSDGHIFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G+  P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKD 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKQLCAPFGDEVYPEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     + ++
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIVSRRKDIEYGDR 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|37525339|ref|NP_928683.1| coproporphyrinogen III oxidase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|41017106|sp|Q7N6Z9|HEM6_PHOLL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|36784766|emb|CAE13676.1| oxygen-dependent coproporphyrinogen III oxidase [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 302

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/293 (37%), Positives = 162/293 (55%), Gaps = 40/293 (13%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F +LQ  IC + E+++ +          + FT + W     Q+E+ GGGR   +  G +F
Sbjct: 13  FLSLQDEICQQLEQIDGK----------EKFTEQCW-----QREEGGGGRSRIMKEGTIF 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNP-----YFWATGLSVIVHPYNPHVPAVHFNIR 139
           E+A    S V GD+ P     +  T   P     ++ A G+S+++HP NP++P  H N+R
Sbjct: 58  EQAGANFSHVSGDMLP-----LSATAHRPELVGRHYQAMGVSLVIHPLNPYIPTSHANVR 112

Query: 140 MIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + +  D I +H T + +C  +    Y  YKE
Sbjct: 113 FFIAEKEGEAPVWWFGGGFDLTPY-----YGFKEDAIHWHTTARNICRPYGEDVYPKYKE 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFY+ HR E+RGIGG+F+D L++       +  F+F   +G  F+  Y  +V +  
Sbjct: 168 WCDNYFYIKHRNEARGIGGLFYDDLNTP----DFEHCFNFTQDIGKGFLSAYLPIVEKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             L+ E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 EILWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|218888770|ref|YP_002437634.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa LESB58]
 gi|226740888|sp|B7V0Q9|HEM6_PSEA8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218768993|emb|CAW24751.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           LESB58]
          Length = 305

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W R        GGGR   +  G + EK
Sbjct: 14  DLQDRICAALEAEDGKAR----------FAEDAWERPAG-----GGGRTRVIGDGALIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+GD  P              F A G+S+++HP NPHVP  H N+R       
Sbjct: 59  GGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      ++++ D + +H   ++ C+      Y  YKEWCDRYF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R  H  F E+
Sbjct: 174 LKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKHTPFDER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|238783886|ref|ZP_04627904.1| Coproporphyrinogen III oxidase [Yersinia bercovieri ATCC 43970]
 gi|238715273|gb|EEQ07267.1| Coproporphyrinogen III oxidase [Yersinia bercovieri ATCC 43970]
          Length = 308

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC      +  A           F  ++W R     E+ GGGR   L  G VFE+
Sbjct: 15  DLQDKICVALAAADGSA----------TFAEENWTR-----EEGGGGRSRVLINGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+WCD YFY
Sbjct: 120 GEDPVWWFGGGFDLTPF-----YGFEEDAVHWHQTAYQLCQPFGEQVYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L+S P+    D+ F F  AVGD F+  Y  +V R     + E+
Sbjct: 175 IKHRNEARGIGGLFFDDLNS-PDF---DSCFRFTQAVGDGFLAAYLPIVERRKALSWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|156502445|ref|YP_001428510.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|290952868|ref|ZP_06557489.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313937|ref|ZP_06804501.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica URFT1]
 gi|254800272|sp|A7NC51|HEM6_FRATF RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|156253048|gb|ABU61554.1| coproporphyrinogen III oxidase, aerobic [Francisella tularensis
           subsp. holarctica FTNF002-00]
          Length = 308

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 160/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P F            F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPFATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTPY-----YPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDEYRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|77166276|ref|YP_344801.1| coproporphyrinogen III oxidase [Nitrosococcus oceani ATCC 19707]
 gi|254435989|ref|ZP_05049496.1| coproporphyrinogen III oxidase, aerobic [Nitrosococcus oceani
           AFC27]
 gi|76884590|gb|ABA59271.1| coproporphyrinogen oxidase [Nitrosococcus oceani ATCC 19707]
 gi|207089100|gb|EDZ66372.1| coproporphyrinogen III oxidase, aerobic [Nitrosococcus oceani
           AFC27]
          Length = 317

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E+ +  A                ++ D  ++   GGGR   L  G +FE+
Sbjct: 19  DLQDRICSTLEQEDGAAP---------------FMEDTWRRAAGGGGRSRVLSEGALFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HPYNP+VP  H NIR  +    
Sbjct: 64  GGVNFSHVFGEGLPASATAQRPELAGRRFEALGVSLVIHPYNPYVPTSHANIRFFMASKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H   +E C       Y+ YK+WCD YFY
Sbjct: 124 DAAPIWWFGGGFDLTPY-----YPFEEDAIHWHRMAREACIPFGETVYSRYKKWCDEYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD L+      G    F F+ +VGD ++  Y  +V++     + E+
Sbjct: 179 LKHRDETRGIGGLFFDDLNEW----GFSRCFDFMQSVGDHYLLAYLPIVQQRKTLTYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 235 ERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLPPLVKW 280


>gi|238788090|ref|ZP_04631885.1| Coproporphyrinogen III oxidase [Yersinia frederiksenii ATCC 33641]
 gi|238723677|gb|EEQ15322.1| Coproporphyrinogen III oxidase [Yersinia frederiksenii ATCC 33641]
          Length = 308

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  I T   + +  A           FT ++W R     E+ GGGR   L  G VFE+
Sbjct: 15  DLQDKISTALSEADGRAE----------FTEENWTR-----EEGGGGRSRVLINGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H T  ++C       Y  YK+WCD YFY
Sbjct: 120 GEEPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAWQLCQPFGEDIYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L+S       D  F+F  AVGD F+  Y  +V R     + E+
Sbjct: 175 IKHRNEARGIGGLFFDDLNSP----DFDTCFNFTQAVGDGFLDAYLPIVARRKALSWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|41017168|sp|Q83AZ6|HEM6_COXBU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
          Length = 310

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 152/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 16  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 60

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 61  EQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 120

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 121 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 175

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 176 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 231

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 232 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 279


>gi|209363744|ref|YP_001423696.2| coproporphyrinogen III oxidase [Coxiella burnetii Dugway 5J108-111]
 gi|207081677|gb|ABS76568.2| coproporphyrinogen III oxidase [Coxiella burnetii Dugway 5J108-111]
          Length = 316

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 152/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 22  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 66

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 67  EQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 126

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 127 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 181

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 182 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 237

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 238 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 285


>gi|300724179|ref|YP_003713496.1| coproporphyrinogen III oxidase [Xenorhabdus nematophila ATCC 19061]
 gi|297630713|emb|CBJ91378.1| coproporphyrinogen III oxidase [Xenorhabdus nematophila ATCC 19061]
          Length = 302

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 166/299 (55%), Gaps = 40/299 (13%)

Query: 20  ISQRK--FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ISQ K  F +LQ  IC + E+++  +           F   +W     Q+E+ G GR   
Sbjct: 6   ISQVKNFFLSLQDQICQQLEQIDGHS----------TFIEDYW-----QREEGGNGRSRV 50

Query: 78  LCAGKVFEKAAVLVSTVYGDLSP----DFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           L  G VFE+A V  S V G   P    D + ++ G +    + A G+S+++HP NP++P 
Sbjct: 51  LTTGHVFEQAGVNFSHVTGASMPVSATDHRPELAGRS----YQAMGVSLVIHPLNPYIPT 106

Query: 134 VHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +      +  +WFGGG DLTP      + +  DVI +H   K +C       
Sbjct: 107 SHANVRFFIAEKEGESPVWWFGGGFDLTP-----YYGFQEDVIHWHTIAKNLCQPFGDDT 161

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y +YK+WCD YF++ HR E RG+GG+FFD L++       D  F+F  AVG+ F+  Y  
Sbjct: 162 YPNYKKWCDDYFFIKHRNEPRGVGGLFFDDLNTP----DFDTCFNFTQAVGNGFLPAYLP 217

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V +  +  + +++RQ QL RR RY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 218 IVEKRKNITWGDRERQFQLYRRSRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|116199677|ref|XP_001225650.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88179273|gb|EAQ86741.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 343

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 150/262 (57%), Gaps = 25/262 (9%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-------- 114
           D+ Q+++ GGG    L  GK+FEKA V VS VYG L      ++    KN          
Sbjct: 63  DEWQRKEGGGGITCVLQDGKIFEKAGVGVSVVYGTLPKPAILKMRANHKNIADENNIPDS 122

Query: 115 --FWATGLSVIVHPYNPHVPAVHFNIRMIVT-------GAYWFGGGIDLTPSLESRRHSY 165
             F+A GLS+IVHP NP  P VH N R   T       GA+WFGGG DLTPS     + +
Sbjct: 123 LEFFAAGLSLIVHPRNPMAPTVHLNYRYFETANPDGSSGAWWFGGGCDLTPS-----YLF 177

Query: 166 DPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG 225
           D D + FH +LK++C +H    Y  +K+WCD YFY  HR ESRGIGGIFFD L  +  + 
Sbjct: 178 DEDAVQFHKSLKDVCDKHDKGYYPKFKKWCDEYFYNKHRGESRGIGGIFFDDLDET--VS 235

Query: 226 GIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNF 285
             +  F+F+      F+  Y  +V +     F+EQ+++ Q IRRG+Y EFNL++D+GT F
Sbjct: 236 DRENLFAFVQDSLKSFLPTYIPIVNKRKDMAFTEQEKEWQQIRRGKYVEFNLVHDRGTAF 295

Query: 286 GFKT-GGNVESILASMPPLVAW 306
           G  T G  VESIL S+P   +W
Sbjct: 296 GLNTPGARVESILMSLPLTASW 317


>gi|300112980|ref|YP_003759555.1| Coproporphyrinogen oxidase [Nitrosococcus watsonii C-113]
 gi|299538917|gb|ADJ27234.1| Coproporphyrinogen oxidase [Nitrosococcus watsonii C-113]
          Length = 310

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 154/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E+ + EA           F  + W     Q+   GGGR   L  G VFE+
Sbjct: 19  DLQDHICSTLEQEDGEA----------PFMEETW-----QRAAGGGGRSRVLSEGAVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G+  P              F A G+S+++HP NP+VP  H NIR  +    
Sbjct: 64  GGVNFSHVFGEGLPASATAQRPELAGRRFEALGVSLVIHPRNPYVPTSHANIRFFMASKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H   +E C       Y+ YK+WCD YFY
Sbjct: 124 DAAPIWWFGGGFDLTPY-----YPFEEDAIHWHRMAREACLPFGETVYSRYKKWCDEYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD L+      G    F F+ +VG+ ++  Y  +VR+     + E+
Sbjct: 179 LKHRDETRGIGGLFFDDLNEW----GFPRCFDFMQSVGNHYLLAYVPIVRQRKSLTYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 235 ERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLPPLVKW 280


>gi|152983988|ref|YP_001345421.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PA7]
 gi|166217808|sp|A6UX86|HEM6_PSEA7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150959146|gb|ABR81171.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           PA7]
          Length = 305

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 147/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  + +A           F    W R        GGGR   +  G + EK
Sbjct: 14  DLQDRICAALEAEDGKAR----------FAEDAWERPAG-----GGGRTRVIGDGALIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+GD  P              F A G+S+++HP NPHVP  H N+R       
Sbjct: 59  GGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAEKA 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP   S     + D + +H   ++ C+      Y  YKEWCDRYF+
Sbjct: 119 GEEPVWWFGGGFDLTPYYAS-----EEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R  H  F E+
Sbjct: 174 LKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKHTPFDER 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|16329455|ref|NP_440183.1| coproporphyrinogen III oxidase [Synechocystis sp. PCC 6803]
 gi|2493811|sp|P72848|HEM6_SYNY3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|1651937|dbj|BAA16863.1| coproporphyrinogen III oxidase [Synechocystis sp. PCC 6803]
          Length = 340

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 159/315 (50%), Gaps = 44/315 (13%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + ++R+SQ   + LQ  IC   E L+ +                 +  D  Q+E+ GGGR
Sbjct: 19  DAKQRVSQF-MQTLQDEICQGLEALDGKGK---------------FQEDSWQREEGGGGR 62

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              L  G   E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P V
Sbjct: 63  SRVLADGDFLEQGGVNFSEVWGKSLPPSILKQRPEAEGHEFYATGTSMVLHPKNPYIPTV 122

Query: 135 HFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           H N R    G  +WFGGG DLTP      + +  D   FH+TLK  C Q     Y  +K 
Sbjct: 123 HLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHHTLKNACDQTHGEFYPVFKR 177

Query: 194 WCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD----------------F 231
           WCD YFYL HRQE RGIGGIFFD+      L+  P+  G  A                 F
Sbjct: 178 WCDEYFYLKHRQEMRGIGGIFFDYQDGNAPLYRGPDPNGPAAQYSNQLAPIEPLGWEDLF 237

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
           SF    G  F+  Y  +V +  +  + ++ RQ QL RRGRY EFNL+YD+GT FG +T G
Sbjct: 238 SFAQRCGRAFLPAYSPIVEKRRNTEYGDRQRQFQLYRRGRYVEFNLVYDRGTIFGLQTNG 297

Query: 292 NVESILASMPPLVAW 306
             ESIL S+PPLV W
Sbjct: 298 RTESILMSLPPLVRW 312


>gi|259484575|tpe|CBF80916.1| TPA: coproporphyrinogen III oxidase, putative (AFU_orthologue;
           AFUA_1G07480) [Aspergillus nidulans FGSC A4]
          Length = 454

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/326 (36%), Positives = 168/326 (51%), Gaps = 32/326 (9%)

Query: 7   EIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQ 66
           ++  P  +E  + + ++   N  S +    EKL  +  +       +I   K +  D   
Sbjct: 94  QLDSPSIVEIDEALKKQASVNETSPMRLRMEKLIKDHQQKIVEELSRI-DGKQFRADTWT 152

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLS--------PDFKDQILGTTKNPYFWAT 118
           + + GGG    L  G VFEKA V VS VYGDL          D K  +    ++  F+A 
Sbjct: 153 RPNGGGGISCVLQDGNVFEKAGVNVSIVYGDLPRAAIEKMRADHKSFVGADVESLSFFAA 212

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTG----------AYWFGGGIDLTPSLESRRHSYDPD 168
           GLS+++HP+NP  P VH N R   T            +WFGGG DLTPS     + +  D
Sbjct: 213 GLSLVLHPHNPMAPTVHLNYRYFETSDPKDPINGDKNWWFGGGTDLTPS-----YLFPED 267

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL-------HSS 221
           V  FH T+KE C +H    Y  +KEWCD+YFY+PHR+E RG+GGIFFD L        S+
Sbjct: 268 VQHFHKTIKEACDRHDATYYPRFKEWCDKYFYIPHRRECRGVGGIFFDDLDANFLESSST 327

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
                 +  FSF+S     F+  Y  +V R     F+   ++ Q +RRGRY EFNL+YD+
Sbjct: 328 SSQNPQETLFSFVSDALASFLPSYVPIVERRKDMPFTPAQKEWQQLRRGRYVEFNLVYDR 387

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT+FG +T    +ESIL S+P   +W
Sbjct: 388 GTSFGLRTPSARIESILMSLPRTASW 413


>gi|329297507|ref|ZP_08254843.1| coproporphyrinogen III oxidase [Plautia stali symbiont]
          Length = 269

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/242 (45%), Positives = 142/242 (58%), Gaps = 15/242 (6%)

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGGR   L  GKVFE+A V  S VYG+  P              F A G+S++VHP NP+
Sbjct: 7   GGGRSRVLRNGKVFEQAGVNFSHVYGEQMPASATAQRPELAGRSFKAMGVSLVVHPENPY 66

Query: 131 VPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           VP  H N+R  +    GA   +WFGGG DLTP      + +  D   +H T  ++C    
Sbjct: 67  VPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFTEDARHWHQTAFDLCQPFG 121

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  YK+WCD YFYL HR E RGIGG+FFD L++       D  F F+ AVG+ F++ 
Sbjct: 122 DDVYARYKKWCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFDFMQAVGNGFMQA 177

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V +     +SE++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV
Sbjct: 178 YQPIVAKRKPVAWSERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLV 237

Query: 305 AW 306
            W
Sbjct: 238 RW 239


>gi|319762841|ref|YP_004126778.1| coproporphyrinogen oxidase [Alicycliphilus denitrificans BC]
 gi|317117402|gb|ADU99890.1| Coproporphyrinogen oxidase [Alicycliphilus denitrificans BC]
          Length = 308

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 148/283 (52%), Gaps = 19/283 (6%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            E LQ+ I    E++E E            F    W R+       G G    L  G+VF
Sbjct: 18  LEGLQARITGALEEVEGEGGAR--------FRSDAWRREAGSPLQ-GDGITRILEGGRVF 68

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+RMI  G
Sbjct: 69  ERAGCGFSHVSGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRMIAAG 128

Query: 145 -AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            A WFGGG+DLTP      + ++ D + FH   ++  +      Y  +K WCD YF+L H
Sbjct: 129 DACWFGGGMDLTPY-----YGFEEDAVHFHRACRDALAPFGEGLYPRFKTWCDEYFFLKH 183

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           R E RG+GGIFFD         G +   +   +VGD F+  Y  +V+R     + E++R 
Sbjct: 184 RGEQRGVGGIFFDDFSEL----GFEQSLAMTQSVGDAFLGAYLPIVQRRMDMPWGERERD 239

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL AW
Sbjct: 240 FQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLAAW 282


>gi|313496445|gb|ADR57811.1| HemF [Pseudomonas putida BIRD-1]
          Length = 303

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 150/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  GKV EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVREAG-----GGGRTRVIGEGKVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD F+  Y  +V+R  +  ++ Q
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEWD----FDTCFAFIRAIGDAFVDAYLPIVQRRKNTPYTPQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|212217945|ref|YP_002304732.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuK_Q154]
 gi|212012207|gb|ACJ19587.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuK_Q154]
          Length = 319

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 152/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 25  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 69

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 70  EQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 129

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 130 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 184

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 185 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 240

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 241 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 288


>gi|254523147|ref|ZP_05135202.1| coproporphyrinogen III oxidase, aerobic [Stenotrophomonas sp.
           SKA14]
 gi|219720738|gb|EED39263.1| coproporphyrinogen III oxidase, aerobic [Stenotrophomonas sp.
           SKA14]
          Length = 298

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 153/286 (53%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E ++ +A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAIEAVDGQAR----------FQEDLW-----QRAEGGGGRTRVLRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + ATG+S++ HP NP+VP  H N+R       
Sbjct: 58  AGIGFSDVAGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANVRFFQAQRD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      + +D DV  +H   +++C+      Y  +K WCD YF+
Sbjct: 118 GDVVASWFGGGFDLTPF-----YPFDEDVQHWHRVARDLCTPFGEERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD LH     G  + DF ++ AVGD F++ Y  +V++       E+
Sbjct: 173 LRHRNETRGVGGLFFDDLH-----GDFERDFDYLRAVGDGFLEAYLPIVQQRKDTPHGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|282890162|ref|ZP_06298692.1| hypothetical protein pah_c014o008 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499819|gb|EFB42108.1| hypothetical protein pah_c014o008 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 277

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 156/283 (55%), Gaps = 31/283 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + L+  I   FEKLE+           K F  K WL         GGG   ++  GKVF
Sbjct: 25  LKQLRDTIIQAFEKLED----------GKTFERKPWLYHSG-----GGGGEISVLRGKVF 69

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EKAAV  S V+G+  P   D+       P+F ATG+S+I H  NPH P  H N+R I T 
Sbjct: 70  EKAAVNWSGVWGEKFPMNDDE------GPFF-ATGVSLITHMSNPHAPTAHMNVRYIETA 122

Query: 145 -AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
              WFGGG DLTP        Y+ D + FH+  +E   QH    Y  + +    YFY+PH
Sbjct: 123 NRAWFGGGYDLTP----MGFPYEEDTLHFHSVARETLDQHGAHLYPQFSQNARDYFYIPH 178

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
            Q  RG+GGIFFDH ++    G +  DFS    VG+ F K    ++ +  H  FS+++++
Sbjct: 179 MQIERGVGGIFFDHYNT----GDVSHDFSMWKDVGETFTKALMPVLEKRVHQPFSDEEKE 234

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QL +RG Y EFNLLYD+GT FGF++GGN E+IL S+PP+V W
Sbjct: 235 VQLKKRGHYVEFNLLYDRGTKFGFQSGGNPEAILCSLPPVVKW 277


>gi|262089751|gb|ACY24845.1| HemF coproporphyrinogen III oxidase [uncultured organism]
          Length = 290

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 142/252 (56%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D   + + GGGR   L  G   EK  V  S VYG   P              F A G+
Sbjct: 21  VEDNWTRAEGGGGRTRVLANGVAIEKGGVNFSHVYGAHMPASATAHRPELAGRAFEAMGV 80

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S+++HP NP+ P  H N+R  +    GA   +WFGGG DLTP      +  + DVI +H 
Sbjct: 81  SLVIHPNNPYAPTSHANVRFFIAEKDGAEPVWWFGGGYDLTPY-----YGNEADVIHWHQ 135

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T K  C       Y  YK+WCD YFYL HR E+RG+GG+FFD L+      G D  F+F+
Sbjct: 136 TAKNACEPFGDDIYPRYKKWCDDYFYLKHRNEARGVGGLFFDDLNDQ----GFDQSFAFL 191

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVGD ++  Y  ++    +  +SE++R+ QL RRGRY EFNL+YD+GT FG +TGG  E
Sbjct: 192 RAVGDSYVPAYQPILAARKNMPYSEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTE 251

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 252 SILMSLPPLVRW 263


>gi|294669636|ref|ZP_06734703.1| hypothetical protein NEIELOOT_01537 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308549|gb|EFE49792.1| hypothetical protein NEIELOOT_01537 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 303

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 153/286 (53%), Gaps = 31/286 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ  ICT  E  E+ A           F   HW      +  LG G    L  G VF
Sbjct: 10  LQQLQDNICTALEAEEDGA----------AFVADHW------QSHLGSGESRVLKQGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGAAMPAAATAHRPELAGAAFEAMGVSLVIHPRNPYVPTSHANVRCFIAY 113

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + +D D++ +H T K +C + +   Y  YK+WCDRY
Sbjct: 114 PKDAEPVWWFGGGFDLTPF-----YPFDEDIVHWHQTAKNLCDRFSDGLYDEYKDWCDRY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR+E+RG+GG+FFD L+            +FI   G  +I+ Y  +V R  +  + 
Sbjct: 169 FYLKHREETRGVGGLFFDDLNRW----DFATCLNFIRETGKAYIEAYRPIVARRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           E++RQ QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPLV
Sbjct: 225 ERERQFQLYRRGRYVEFNLVFDRGTHFGLQSGGRTESILMSMPPLV 270


>gi|108763944|ref|YP_634879.1| coproporphyrinogen III oxidase [Myxococcus xanthus DK 1622]
 gi|108467824|gb|ABF93009.1| coproporphyrinogen III oxidase, aerobic [Myxococcus xanthus DK
           1622]
          Length = 301

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 153/296 (51%), Gaps = 30/296 (10%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D+E  K        +LQ  IC   E+L+              F    W R          
Sbjct: 5   DVESLKERMTGFIRSLQDDICGGLERLDGSTR----------FREDSWTRPGGGGG---- 50

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
            R   L  G V EKA V  S VYG+L   F  ++ G  +  +FWA G+S+++HP NPHVP
Sbjct: 51  -RSRVLEDGAVLEKAGVNTSVVYGELEEQFAQKLQGEGR--HFWAGGISLVLHPRNPHVP 107

Query: 133 AVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            VH N R I  G   WFGGG DLTP      + Y+ D   FH   +  C +H    Y  +
Sbjct: 108 TVHANYRFIQQGGKAWFGGGADLTPY-----YLYEEDAAHFHRVHQAACDKHDAGYYPRF 162

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG-IDADFSFISAVGDCFIKLYPSLVR 250
           K  CD+YFYL HR+E+RG+GGIFF++      MGG ++ +F+F+   G  F+  Y  +  
Sbjct: 163 KSACDKYFYLRHREETRGVGGIFFEN------MGGELEKEFAFVQDCGRAFLDAYLPIAE 216

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R      +E  R  Q +RRGRY EFNL+YD+GT FG +T G  ESIL S+PP V W
Sbjct: 217 RRKDTPATEGQRFWQEVRRGRYVEFNLVYDRGTVFGLETRGRTESILMSLPPQVRW 272


>gi|330013618|ref|ZP_08307704.1| coproporphyrinogen III oxidase [Klebsiella sp. MS 92-3]
 gi|328533442|gb|EGF60177.1| coproporphyrinogen III oxidase [Klebsiella sp. MS 92-3]
          Length = 299

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 148/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G+VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|294635470|ref|ZP_06713957.1| coproporphyrinogen III oxidase [Edwardsiella tarda ATCC 23685]
 gi|291091166|gb|EFE23727.1| coproporphyrinogen III oxidase [Edwardsiella tarda ATCC 23685]
          Length = 306

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 146/251 (58%), Gaps = 15/251 (5%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           +D+ Q+   GGGR   L  G +FE+A V  S + GD  P              F A G+S
Sbjct: 34  QDEWQRAQGGGGRTRVLRQGALFEQAGVNFSHIRGDSLPAAASAQRPELAGCAFQAMGVS 93

Query: 122 VIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
           +++HP++P+VP  H N+R         +  +WFGGG DLTP      + +  DV+ +H  
Sbjct: 94  LVLHPWSPYVPTAHANVRFFSAERPDGSSLWWFGGGFDLTPF-----YPFHEDVVHWHRQ 148

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
            +++C       Y  YK WCDRYF LPHRQE+RG+GG+FFD L++ P+       F+F  
Sbjct: 149 ARDLCQPFDAQYYPRYKAWCDRYFSLPHRQEARGVGGLFFDDLNT-PDFAHA---FAFTR 204

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           AVG+ F   Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ES
Sbjct: 205 AVGNGFCPAYLPIVERRRALPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRSES 264

Query: 296 ILASMPPLVAW 306
           IL SMPPLV W
Sbjct: 265 ILMSMPPLVRW 275


>gi|146312598|ref|YP_001177672.1| coproporphyrinogen III oxidase [Enterobacter sp. 638]
 gi|167008823|sp|A4WD41|HEM6_ENT38 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|145319474|gb|ABP61621.1| coproporphyrinogen oxidase [Enterobacter sp. 638]
          Length = 299

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 156/287 (54%), Gaps = 33/287 (11%)

Query: 27  NLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
            LQ  IC +   ++  E HE+S            W     Q+E  GGGR   L  G VFE
Sbjct: 14  QLQDDICQKLSAVDGGEFHEDS------------W-----QREAGGGGRSRVLRNGGVFE 56

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT-- 143
           +A V  S V+GD  P              F A G+S++VHP +P VP  H N+R  +   
Sbjct: 57  QAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPQSPFVPTSHANVRFFIAEK 116

Query: 144 -GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
            GA   +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+WCD YF
Sbjct: 117 PGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDICQPFGEEVYPKYKKWCDDYF 171

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           YL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  +  +  
Sbjct: 172 YLKHRDEQRGIGGLFFDDLNAP----DFDTAFNFMQAVGQGYTDAYLPIVERRRNTDYGV 227

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           ++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 228 REREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|161830024|ref|YP_001597552.1| coproporphyrinogen III oxidase [Coxiella burnetii RSA 331]
 gi|189028101|sp|A9NA93|HEM6_COXBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|161761891|gb|ABX77533.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii RSA 331]
          Length = 310

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 151/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 16  LKGLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 60

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 61  EQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 120

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 121 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 175

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 176 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 231

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 232 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 279


>gi|86610261|ref|YP_479023.1| coproporphyrinogen III oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558803|gb|ABD03760.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 337

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 162/323 (50%), Gaps = 52/323 (16%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ R+++SQ   + LQ  IC   E L+ +A           F    W R           
Sbjct: 11  VDARQQVSQ-FMQRLQDDICARLEALDGKAK----------FREDRWERPGGGGG----- 54

Query: 74  RMATLCAGKVFEKAAVLVSTVYGD-LSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           R   +  G VFE+  V  S V+G  L P    Q      +P F+ATG S+++HP NP+VP
Sbjct: 55  RSRVIQQGDVFEQGGVNFSEVFGSHLPPSILKQRPEAAGHP-FYATGTSMVLHPRNPYVP 113

Query: 133 AVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            VH N R    G  +WFGGG+DLTP      + ++ D   FH TLK  C +   A Y  +
Sbjct: 114 TVHLNYRYFEAGPVWWFGGGMDLTPY-----YLFEEDAAHFHRTLKAACDRLDPAYYPVF 168

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM-----GGIDAD---------------- 230
           K WCDRYF+LPHR E+RG+GGIFFD+    P +     G  + D                
Sbjct: 169 KIWCDRYFFLPHRGEARGVGGIFFDYQDERPGLLYRPEGQAEGDPEQLASEPPSLQVRVG 228

Query: 231 -------FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
                  F  +   GD F+  Y  +V R     + E++RQ QL RRGRY EFNL+YD+GT
Sbjct: 229 SRSWEHLFQLVQTCGDAFLPAYVPIVERRQGMEWGERERQFQLYRRGRYVEFNLVYDRGT 288

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG +T G  ESIL S+PPLV W
Sbjct: 289 IFGLQTQGRTESILMSLPPLVRW 311


>gi|297180819|gb|ADI17025.1| coproporphyrinogen III oxidase [uncultured Vibrionales bacterium
           HF0010_22E23]
          Length = 307

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 152/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ +  A                + +D  ++++ GGGR   L  G +FE+
Sbjct: 21  SLQDTICQALEQEDGAAS---------------FKQDSWERQEGGGGRSRVLRDGAIFEQ 65

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V+GD  P              F A G+S++VHP NPHVP  H N+R  +    
Sbjct: 66  AGVNFSHVFGDKMPASATAHRPELAGRSFEAMGVSLVVHPNNPHVPTSHANVRFFIAEKE 125

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D   +H   K +C       Y  +K WCDRYF+
Sbjct: 126 GEAPVWWFGGGFDLTPF-----YPVEEDCAHWHQVAKSLCEPFGDDVYAEHKAWCDRYFF 180

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+      G +  F++I AVG  ++  Y  +V +     F E+
Sbjct: 181 LPHRNETRGVGGLFFDDLNGW----GFENSFAYIRAVGLGYLDGYLPIVAKRKDTEFGEK 236

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 237 ERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPMARW 282


>gi|152971310|ref|YP_001336419.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|262042059|ref|ZP_06015236.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|166217801|sp|A6TC68|HEM6_KLEP7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150956159|gb|ABR78189.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259040599|gb|EEW41693.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 299

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 148/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G+VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|153871109|ref|ZP_02000362.1| Coproporphyrinogen 3 oxidase, aerobic [Beggiatoa sp. PS]
 gi|152072425|gb|EDN69638.1| Coproporphyrinogen 3 oxidase, aerobic [Beggiatoa sp. PS]
          Length = 302

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 141/246 (57%), Gaps = 15/246 (6%)

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
           +E  GGGR   L  G VFE+A V  S V+G   P              F A G+S+++HP
Sbjct: 40  REQGGGGRSRVLSNGAVFEQAGVNFSQVHGTKLPASATAQRPELAGRSFQAMGISLVIHP 99

Query: 127 YNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
            NP++P  H N+R  +         +WFGGG DLTP      + ++ DVI +H T K  C
Sbjct: 100 LNPYIPTSHANLRFFIAEKSDQEPIWWFGGGFDLTPY-----YGFEEDVIHWHRTAKAAC 154

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
                  Y  YK+WCD YF+L HR E RG+GG+FFD L+      G D  F+F+ ++GD 
Sbjct: 155 DPFGKDIYARYKDWCDNYFFLKHRNEPRGVGGLFFDDLNQW----GFDTCFAFMRSIGDH 210

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           ++  Y  +V++     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+
Sbjct: 211 YLAAYLPIVKKRKSLSYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSL 270

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 271 PPLVKW 276


>gi|17864388|ref|NP_524777.1| coproporphyrinogen oxidase [Drosophila melanogaster]
 gi|13431557|sp|Q9V3D2|HEM6_DROME RecName: Full=Coproporphyrinogen-III oxidase; Short=COX;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|5679053|gb|AAD46837.1|AF160897_1 GM14838p [Drosophila melanogaster]
 gi|7297203|gb|AAF52469.1| coproporphyrinogen oxidase [Drosophila melanogaster]
 gi|220943608|gb|ACL84347.1| Coprox-PA [synthetic construct]
 gi|220953578|gb|ACL89332.1| Coprox-PA [synthetic construct]
          Length = 390

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 150/279 (53%), Gaps = 33/279 (11%)

Query: 42  EAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPD 101
           EA EN   +    F V  W R +      GGG    L  G VFEKA V +S V G L P 
Sbjct: 105 EAEENCGQK----FKVDRWERPEG-----GGGITCVLQDGDVFEKAGVNISVVTGSLPPA 155

Query: 102 FKDQILGTTKN-------PYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWF 148
              Q+    KN       P+F A+G+S ++HP NPHVP +HFN R            +WF
Sbjct: 156 AVQQMRARGKNLKEGASLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVETAKGEKQWWF 214

Query: 149 GGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESR 208
           GGG DLTP      +  + D   FH TLK  C +H    Y  +K+WCD YF + HR ESR
Sbjct: 215 GGGTDLTPY-----YLCEKDASHFHQTLKSACDEHDPTYYPRFKKWCDDYFRIKHRNESR 269

Query: 209 GIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIR 268
           GIGGIFFD + S  +    +A F+F+S+     I  Y  LVR++ +  +   +RQ QL+R
Sbjct: 270 GIGGIFFDDIDSPNQ----EAAFNFVSSCARAVIPSYVPLVRKHKNREYGNNERQWQLLR 325

Query: 269 RGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           RGRY EFNL+YD+GT FG  T G   ESIL S+P    W
Sbjct: 326 RGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARW 364


>gi|160872448|ref|ZP_02062580.1| coproporphyrinogen III oxidase, aerobic [Rickettsiella grylli]
 gi|159121247|gb|EDP46585.1| coproporphyrinogen III oxidase, aerobic [Rickettsiella grylli]
          Length = 305

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 158/284 (55%), Gaps = 30/284 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ+ IC   EK EN  HE         F    W+  +      GGG    + +G + EK 
Sbjct: 17  LQTKICLCLEKEEN--HEK--------FITDKWIHPQ------GGGGKTCILSGHLIEKG 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA-- 145
           AV  S V+G+  P    Q   +     F A G+S+++HP NP+VP VH N+R I      
Sbjct: 61  AVNFSHVWGEALPASVSQRYPSLGATAFQAMGISLVIHPRNPYVPTVHMNLRFIALPPGR 120

Query: 146 ---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
              +WFGGG DLTP      + +  D   +H   K+ C    ++ Y  YK+ CD YFYL 
Sbjct: 121 EPQWWFGGGFDLTPY-----YPFLEDCQHWHRVAKQSCDPFGLSLYQRYKKNCDDYFYLK 175

Query: 203 HRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDR 262
           HRQE+RGIGG+FFD L++ P     D  F+F+ +VGD F+K Y  +V+R  +  + E++R
Sbjct: 176 HRQEARGIGGLFFDDLNAWP----FDRCFAFVQSVGDHFLKAYLPIVQRRKNDAYGERER 231

Query: 263 QEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           Q Q +RR RY EFNL+YD+GT FG ++ G  ESIL++MPP   W
Sbjct: 232 QFQALRRSRYVEFNLIYDRGTLFGLQSNGRTESILSTMPPHAHW 275


>gi|153208198|ref|ZP_01946608.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165923958|ref|ZP_02219790.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii RSA 334]
 gi|189028100|sp|A9KC01|HEM6_COXBN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|120576103|gb|EAX32727.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165916614|gb|EDR35218.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii RSA 334]
          Length = 310

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 152/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V 
Sbjct: 16  LKDLQNRLCRAFEKEEGESR----------FQETLW-----EKPNGGGGRTRLLTEGHVI 60

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + G
Sbjct: 61  EQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIAG 120

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD Y
Sbjct: 121 KDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDDY 175

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H + 
Sbjct: 176 FYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPYG 231

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 232 ERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 279


>gi|325102953|ref|YP_004272607.1| Coproporphyrinogen oxidase [Pedobacter saltans DSM 12145]
 gi|324971801|gb|ADY50785.1| Coproporphyrinogen oxidase [Pedobacter saltans DSM 12145]
          Length = 303

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 160/290 (55%), Gaps = 32/290 (11%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           ++ +Q  I +  EKL+  +          +F  +HW R           R   +  G + 
Sbjct: 11  YKKIQDEITSGLEKLDGLS----------LFEEEHWERPGGGGG-----RTRVIQNGNLI 55

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           EK  V  S VYG L P+   +   T K+ +F ATG+S+++HP+NP VP +H NIR     
Sbjct: 56  EKGGVNFSAVYGKL-PNAIKKAFKTDKDDFF-ATGVSIVLHPHNPWVPIIHMNIRYFEMD 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
           +       WFGGGID+TP      +  + D  FFHN +K +C + +   Y  +K+W D Y
Sbjct: 114 SDNGQSLKWFGGGIDVTP-----HYIIEKDAQFFHNYIKSVCDKSSPEFYPKFKKWADDY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD--FSFISAVGDCFIKLYPSLVRRNYHHL 256
           FY+ HR E+RGIGGIF+D L  +PE  GI+ +  F F   VG  FI +Y  LV+   +  
Sbjct: 169 FYIKHRHETRGIGGIFYDRL--TPESTGINWEGIFDFSKNVGRSFIPIYTELVKETRYKK 226

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           F   ++Q Q  RR RYAEFNL+YD GT FG +T G +ESIL SMPP+ +W
Sbjct: 227 FGLDEKQWQFQRRSRYAEFNLVYDSGTKFGLETDGRIESILMSMPPMASW 276


>gi|33597012|ref|NP_884655.1| coproporphyrinogen III oxidase [Bordetella parapertussis 12822]
 gi|33600854|ref|NP_888414.1| coproporphyrinogen III oxidase [Bordetella bronchiseptica RB50]
 gi|41017144|sp|Q7W7U0|HEM6_BORPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|41017147|sp|Q7WL80|HEM6_BORBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33566463|emb|CAE37716.1| coproporphyrinogen III oxidase [Bordetella parapertussis]
 gi|33568454|emb|CAE32366.1| coproporphyrinogen III oxidase [Bordetella bronchiseptica RB50]
          Length = 303

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 150/289 (51%), Gaps = 34/289 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  I    E+   EA           F    W     Q+ + GGG    L  G++FE+
Sbjct: 15  DLQGRIVAALEQAGGEA-----------FRTDAW-----QRAEGGGGVSRLLEGGQLFER 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
           A VL S V G   P              + A G+S+++HP NP+VP  H N+RM V  A 
Sbjct: 59  AGVLFSHVKGTRLPPSASAHRPELAGRGWEAMGVSMVLHPRNPYVPTTHMNVRMFVAAAR 118

Query: 146 --------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                   +WFGGG+DLTP      + ++ D   FH   ++    H    Y  YK+WCD 
Sbjct: 119 PGHAESDVFWFGGGLDLTPY-----YPFEDDARHFHRACRDALDPHGADYYPRYKQWCDE 173

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF+L HR E+RGIGGIFFD L+      G DA F+   +VGD F+  Y  +V+      +
Sbjct: 174 YFFLKHRNETRGIGGIFFDDLNDP----GFDASFALTRSVGDSFLPAYLPIVQARRDMPY 229

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 230 GERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|254230003|ref|ZP_04923404.1| coproporphyrinogen III oxidase, aerobic [Vibrio sp. Ex25]
 gi|262392840|ref|YP_003284694.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. Ex25]
 gi|151937505|gb|EDN56362.1| coproporphyrinogen III oxidase, aerobic [Vibrio sp. Ex25]
 gi|262336434|gb|ACY50229.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. Ex25]
          Length = 305

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + EA          +F    W R+  ++   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQEDGEA----------VFVEDAWHREPGERLG-GGGRSRVMRDGLVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K +C+      Y  +K WCD+YF+
Sbjct: 124 GEEPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKAICAPFGEEVYAEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     + E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIVSRRKDIEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 ERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|307822447|ref|ZP_07652679.1| Coproporphyrinogen oxidase [Methylobacter tundripaludum SV96]
 gi|307737013|gb|EFO07858.1| Coproporphyrinogen oxidase [Methylobacter tundripaludum SV96]
          Length = 304

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 158/291 (54%), Gaps = 40/291 (13%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  ICT  E +E EA           F  + W R +      GGGR   L  G+V E+
Sbjct: 15  NLQDQICTALESVEPEAR----------FIEELWDRAEG-----GGGRTRVLADGRVIEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNP-----YFWATGLSVIVHPYNPHVPAVHFNIRMI 141
             V  S V G     FK     T K P      F A G+S+++HP NP+VP  H N+R +
Sbjct: 60  GGVNFSHVSG-----FKLPPSATAKRPELADRQFQAMGVSLVIHPNNPYVPTSHANVRFL 114

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG DLTP      + +  DV+ +H T +  C       Y  YK+WC
Sbjct: 115 IAEKPGEPTIWWFGGGFDLTPF-----YPFKEDVLHWHQTARAACQPFGDDIYPTYKKWC 169

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+L HR E+RG+GG+FFD L+      G +  F+F+ +VG+ +I  Y  ++++    
Sbjct: 170 DEYFFLKHRNETRGVGGLFFDDLNEW----GFEKSFAFMQSVGNHYIDAYLPIIQKRKDT 225

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +S+++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 226 PYSDKERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPVAHW 276


>gi|260774580|ref|ZP_05883493.1| coproporphyrinogen III oxidase aerobic [Vibrio metschnikovii CIP
           69.14]
 gi|260610486|gb|EEX35692.1| coproporphyrinogen III oxidase aerobic [Vibrio metschnikovii CIP
           69.14]
          Length = 304

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 152/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E+ + +A           F  + W R+  ++   GGGR   +  G VFE+
Sbjct: 15  ELQDSICQQLEQADGKAK----------FVEEIWHREPGERLG-GGGRTRVMTDGLVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV---- 142
             V  S V G   P              F A G+S+++HP+NP VP  H N+R  +    
Sbjct: 64  GGVNFSHVTGQQMPASATAHRPELAGRRFEAMGVSLVMHPHNPFVPTSHANVRFFIAEKE 123

Query: 143 --TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
             T  +WFGGG DLTP      + +  DV  +H T + +CS      Y  +K WCD YF+
Sbjct: 124 GETPIWWFGGGFDLTPF-----YPFLEDVQAWHATARTLCSPFGDQVYAEHKAWCDDYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+  P        F+++ AVG  + + Y  +V R     + E 
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWP----FAECFAYMQAVGKGYTEAYLPIVARRKETAYGEA 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 235 QRQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 280


>gi|89092295|ref|ZP_01165249.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
 gi|89083383|gb|EAR62601.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
          Length = 304

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 148/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E+ +                   ++ D  Q+E  GGGR   L  G + EK
Sbjct: 15  GLQDAICDALEQADGGGK---------------FIEDAWQREAGGGGRTRVLNNGSIIEK 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+GD  P              F A G+S+++HP+NP++P  H N+R  +    
Sbjct: 60  GGVNFSHVFGDKLPGSATAHRPELAGRSFQAMGVSLVIHPHNPYIPTSHANVRFFIAEKE 119

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  D D  F+H T KE C       Y  +KEWCD YFY
Sbjct: 120 GEEPVWWFGGGFDLTPY-----YGNDEDCKFWHETAKEACDPFGEDIYPRFKEWCDEYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RG+GG+FFD L+      G +  F+ + ++G+ + K Y  ++ +N    + E+
Sbjct: 175 LKHRDEPRGVGGLFFDDLNEL----GFEKSFALMQSIGNAYTKAYLPIIEKNKDKEYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R  QL RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 231 QRDFQLHRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPEVRW 276


>gi|148545346|ref|YP_001265448.1| coproporphyrinogen III oxidase [Pseudomonas putida F1]
 gi|166217810|sp|A5VWK4|HEM6_PSEP1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|148509404|gb|ABQ76264.1| coproporphyrinogen oxidase [Pseudomonas putida F1]
          Length = 303

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  GKV EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVREAG-----GGGRTRVIGDGKVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HPYNPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCVHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R     ++ Q
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEWD----FDTCFAFIRAIGDAYINAYLPIVQRRKDTPYTPQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|90415414|ref|ZP_01223348.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2207]
 gi|90332737|gb|EAS47907.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2207]
          Length = 305

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 141/254 (55%), Gaps = 15/254 (5%)

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W  D+  +E+ GGGR   L    + EK  V  S V+G   P    Q         F A 
Sbjct: 35  EWKEDRWVREEGGGGRSRVLVDDAIIEKGGVNFSHVFGTEMPASATQHRPELAGRRFEAM 94

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFF 172
           G+S+++HP NP+ P  H N+R  +    GA   +WFGGG DLTP      +  + D   +
Sbjct: 95  GVSLVIHPQNPYAPTSHANVRFFIAEKDGAEPVWWFGGGYDLTPY-----YGNEEDCSHW 149

Query: 173 HNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFS 232
           H T K  C + +   Y+ +K WCD YFYL HR E RGIGG+FFD  +      G +  F+
Sbjct: 150 HQTAKSACDRFSKDYYSRFKNWCDDYFYLKHRSEPRGIGGLFFDDFNEL----GFEQSFA 205

Query: 233 FISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGN 292
           F+  VGD F   Y  ++ R ++  F E +RQ QL RRGRY EFNL++D+GT FG +TGG 
Sbjct: 206 FMRGVGDSFSSAYIPILERRHNIAFGEAERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGR 265

Query: 293 VESILASMPPLVAW 306
            ESIL SMPPLV W
Sbjct: 266 TESILMSMPPLVRW 279


>gi|290475992|ref|YP_003468888.1| coproporphyrinogen III oxidase [Xenorhabdus bovienii SS-2004]
 gi|289175321|emb|CBJ82124.1| coproporphyrinogen III oxidase [Xenorhabdus bovienii SS-2004]
          Length = 302

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 161/295 (54%), Gaps = 32/295 (10%)

Query: 20  ISQRK--FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ISQ K  F +LQ  IC + E+L+   H N        F  + W     Q+E+ GGGR   
Sbjct: 6   ISQVKNFFLSLQDEICKQLERLD--GHSN--------FMEECW-----QREEGGGGRSRV 50

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L AG VFE+A V  S + G   P              + A G+S+++HP NP++P  H N
Sbjct: 51  LKAGNVFEQAGVNFSHITGASLPPSASAHRPELAGRSYQALGVSLVIHPLNPYIPTSHAN 110

Query: 138 IRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R  +         +WFGGG DLTP      + +  D I +H   K +C       Y  Y
Sbjct: 111 VRFFIAEKEGEAPVWWFGGGFDLTPY-----YGFKEDAIHWHTVAKTLCQPFGNNVYPEY 165

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YF++ HR E RGIGG+F+D L++       +  F+F  AVG+ F+  Y  +V R
Sbjct: 166 KKWCDDYFFIKHRNEPRGIGGLFYDDLNTP----DFETCFNFTQAVGNGFLAAYLPIVER 221

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             +  + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 222 RKNINWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|315125144|ref|YP_004067147.1| coproporphyrinogen III oxidase [Pseudoalteromonas sp. SM9913]
 gi|315013657|gb|ADT66995.1| coproporphyrinogen III oxidase [Pseudoalteromonas sp. SM9913]
          Length = 305

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 151/288 (52%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F  LQ  IC   E  + +A                ++ D  Q+E+ GGGR   +  G V 
Sbjct: 13  FMALQDTICQGLEAADGKAQ---------------FVEDSWQREEGGGGRTRVITNGNVI 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S V+G   P              F A G+S+++HP NPH+P  H N+R  +  
Sbjct: 58  EQGGVNYSHVFGASMPGSATAHRPELAGRSFHACGVSLVIHPKNPHIPTSHANVRFFIAE 117

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      +    DV+ +H    ++C       Y  YK+WCD Y
Sbjct: 118 KEGEEPIWWFGGGFDLTPF-----YPVLEDVVHWHQVAHDVCQPFGDDVYPKYKKWCDEY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+      G +  F+F+ +VG+ F+  Y  ++ R  +  ++
Sbjct: 173 FYLKHRDETRGVGGLFFDDLNEL----GFEQSFAFMQSVGNGFLDAYVPIIERRKNDKYT 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EQ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 229 EQQRDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|241766065|ref|ZP_04763980.1| Coproporphyrinogen oxidase [Acidovorax delafieldii 2AN]
 gi|241363921|gb|EER59215.1| Coproporphyrinogen oxidase [Acidovorax delafieldii 2AN]
          Length = 322

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 150/289 (51%), Gaps = 26/289 (8%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL-GGGRMATLCAGKV 83
            + LQ+ I    E +E E            F    W   K+  E L G G    L  G+V
Sbjct: 19  LQGLQARITDALEAVEGEGGAR--------FLADAW--SKAPGEPLQGDGLTKILENGRV 68

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           FE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+RMI  
Sbjct: 69  FERAGCGFSHVRGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRMIAA 128

Query: 144 G------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
           G        WFGGG+DLTP      +  + D + FH T ++  +      Y  +K+WCD 
Sbjct: 129 GHPGHAPTCWFGGGMDLTPY-----YGLEEDAVHFHRTCRDALAPFGDDKYPRFKQWCDE 183

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFYL HR E RG+GG+F+D         G +   +   AVGD F+K Y  +V +     +
Sbjct: 184 YFYLKHRNEQRGVGGVFYDDFSEL----GFEQSLAMTQAVGDAFLKAYLPIVEKRQDTPY 239

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPLVAW
Sbjct: 240 GERERDFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLVAW 288


>gi|331007620|ref|ZP_08330762.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC1989]
 gi|330418560|gb|EGG93084.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC1989]
          Length = 308

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 151/286 (52%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ+ IC   + ++                   ++ D  Q+++ GGG+   L  G V EK
Sbjct: 15  NLQNNICEALQNIDG----------------GKFIEDTWQRDEGGGGKSRVLAGGHVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+GD  P              F A G+S+++HP NPH P  H N+R  +    
Sbjct: 59  GGVNFSHVFGDKMPASATAHRPELAGRNFEAMGVSLVIHPNNPHAPTSHMNVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP    ++     D + +H T K+ C     + Y  +K+WCD YFY
Sbjct: 119 GEAPVWWFGGGYDLTPYYGDKK-----DCVHWHQTAKDACDPFDQSYYPRFKKWCDDYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD  +      G D  F F+ ++GD +I  Y  ++       ++++
Sbjct: 174 LKHRDEARGIGGLFFDDFNEL----GFDKSFLFLQSIGDSYIHAYAPILDNKKDIPYTDK 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 230 ERNFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSLPPLVRW 275


>gi|187478700|ref|YP_786724.1| coproporphyrinogen III oxidase [Bordetella avium 197N]
 gi|115423286|emb|CAJ49819.1| coproporphyrinogen III oxidase, aerobic [Bordetella avium 197N]
          Length = 304

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 152/290 (52%), Gaps = 36/290 (12%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC-AGKVFE 85
            LQ+ I T  E    E+  + A   P+                 GGG ++ L   G++ E
Sbjct: 16  KLQNRIVTSLEATGGESFRSDAWERPE-----------------GGGGLSRLIEGGQLLE 58

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA 145
           +  VL S V G   P              + A G+S+++HP NP+VP  H N+RM V  A
Sbjct: 59  RGGVLFSHVTGTRLPPSASAHRPELAGRSWEAMGVSLVLHPRNPYVPTTHMNVRMFVAAA 118

Query: 146 ---------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
                    +WFGGG+DLTP      ++Y+ D   FH   ++  +QH    Y  +K WCD
Sbjct: 119 RPGHDEQDVFWFGGGLDLTPY-----YAYEDDARHFHTVCRDALAQHGPDYYPRFKRWCD 173

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFYL HR+E+RG+GGIFFD L+ +    G  A F+ + +VGD F+  Y  +V R     
Sbjct: 174 EYFYLKHRKETRGVGGIFFDDLNEA----GFPASFALMRSVGDSFLDAYLPIVERRRAQA 229

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E++R  Q  RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP   W
Sbjct: 230 YGERERDFQAYRRGRYVEFNLVYDRGTLFGLQSGGRTESILLSMPPAAHW 279


>gi|33593304|ref|NP_880948.1| coproporphyrinogen III oxidase [Bordetella pertussis Tohama I]
 gi|41017141|sp|Q7VWE7|HEM6_BORPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33572660|emb|CAE42583.1| coproporphyrinogen III oxidase [Bordetella pertussis Tohama I]
 gi|332382713|gb|AEE67560.1| coproporphyrinogen III oxidase [Bordetella pertussis CS]
          Length = 303

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 150/289 (51%), Gaps = 34/289 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  I    E+   EA           F    W     Q+ + GGG    L  G++FE+
Sbjct: 15  DLQGRIVAALEQAGGEA-----------FRTDAW-----QRAEGGGGVSRLLEGGQLFER 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
           A VL S V G   P              + A G+S+++HP NP+VP  H N+RM V  A 
Sbjct: 59  AGVLFSHVKGTRLPPSASAHRPELAGRGWEAMGVSMVLHPRNPYVPTTHMNVRMFVAAAR 118

Query: 146 --------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                   +WFGGG+DLTP      + ++ D   FH   ++    H    Y  YK+WCD 
Sbjct: 119 PGHAESDVFWFGGGLDLTPY-----YPFEDDARHFHRACRDALDPHGADYYPRYKQWCDE 173

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF+L HR E+RGIGGIFFD L+      G DA F+   +VGD F+  Y  +V+      +
Sbjct: 174 YFFLKHRNETRGIGGIFFDDLNEP----GFDASFALTCSVGDSFLPAYLPIVQARRDMPY 229

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 230 GERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|269966991|ref|ZP_06181061.1| coproporphyrinogen III oxidase, aerobic [Vibrio alginolyticus 40B]
 gi|269828385|gb|EEZ82649.1| coproporphyrinogen III oxidase, aerobic [Vibrio alginolyticus 40B]
          Length = 305

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + +A          +F    W R+  ++   GGGR   L  G VFE+
Sbjct: 15  SLQDSICQQLEQEDGKA----------VFVEDAWHREPGERLG-GGGRSRVLRDGLVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKD 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K++C+      Y  +K WCD+YF+
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKQLCAPFGDDVYQEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F++I AVG+ + + Y  +V R     + E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWE----FDKCFAYIKAVGEGYCQAYLPIVSRRKEIEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|149445088|ref|XP_001519105.1| PREDICTED: similar to Coproporphyrinogen oxidase [Ornithorhynchus
           anatinus]
          Length = 411

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 157/292 (53%), Gaps = 38/292 (13%)

Query: 29  QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAA 88
           Q+ +C    +L+  AH          F+V  W     Q+++ GGG    L  G +FEKA 
Sbjct: 117 QARVCQALAELDQGAH----------FSVDRW-----QRKEGGGGISCVLQDGNIFEKAG 161

Query: 89  VLVSTVYGDLSPDFKDQILGTTKNPY-------FWATGLSVIVHPYNPHVPAVHFNIRMI 141
           V VS V+G+LS +   Q+    K+         F A G+S ++HP NPH P +HFN R  
Sbjct: 162 VSVSVVHGNLSEEAAKQMRSRGKSLKAKNGKLPFSAMGVSSVIHPKNPHTPTIHFNYRYF 221

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +WFGGG DLTP+     +  + D + FH TLKE C  H    Y  +K+WC
Sbjct: 222 EVEEADGNKLWWFGGGCDLTPT-----YLNEEDAVHFHKTLKEACDHHNPELYPKFKKWC 276

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF++ HR E RGIGGIFFD L S  +    D  F F+ +     +  Y  LV+++ + 
Sbjct: 277 DDYFFITHRGERRGIGGIFFDDLDSPSK----DDVFQFVQSCARAVVPSYIPLVKKHCND 332

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG-FKTGGNVESILASMPPLVAW 306
            F+ Q++Q Q +RRGRY EFNLLYD+GT FG F  G  +ESIL S+P    W
Sbjct: 333 SFTAQEKQWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARW 384


>gi|206580251|ref|YP_002237218.1| coproporphyrinogen III oxidase, aerobic [Klebsiella pneumoniae 342]
 gi|226740885|sp|B5XVR1|HEM6_KLEP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|206569309|gb|ACI11085.1| coproporphyrinogen III oxidase, aerobic [Klebsiella pneumoniae 342]
          Length = 299

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 147/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D I +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAIHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKAMPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|118497545|ref|YP_898595.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           novicida U112]
 gi|195536241|ref|ZP_03079248.1| coproporphyrinogen III oxidase, aerobic [Francisella tularensis
           subsp. novicida FTE]
 gi|254800274|sp|A0Q6H6|HEM6_FRATN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|118423451|gb|ABK89841.1| coproporphyrinogen III oxidase [Francisella novicida U112]
 gi|194372718|gb|EDX27429.1| coproporphyrinogen III oxidase, aerobic [Francisella tularensis
           subsp. novicida FTE]
          Length = 308

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 161/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y+ +K
Sbjct: 118 RIFIAGADTDTPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYSKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+ +W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMASW 282


>gi|270262972|ref|ZP_06191243.1| coproporphyrinogen III oxidase, aerobic [Serratia odorifera 4Rx13]
 gi|270043656|gb|EFA16749.1| coproporphyrinogen III oxidase, aerobic [Serratia odorifera 4Rx13]
          Length = 306

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC +  + +  A          +F    W R     E+ GGGR   L  G VFE+
Sbjct: 15  SLQDSICAQLAQADGGA----------VFNEDRWTR-----EEGGGGRSRVLTQGSVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP++P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELAGRSFQAMGVSLVIHPHSPYIPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T + +C+      Y  YK+WCD YF+
Sbjct: 120 GEEPVWWFGGGFDLTPF-----YGFEEDAVHWHRTAERLCAPFGDEVYPKYKKWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L++       D+ F+F  AVG+ F+  Y  +V +     + + 
Sbjct: 175 IKHRNEARGIGGLFFDDLNTP----DFDSCFAFTRAVGEGFLDAYLPIVEKRKALSWGDN 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|323525390|ref|YP_004227543.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1001]
 gi|323382392|gb|ADX54483.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1001]
          Length = 307

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 147/260 (56%), Gaps = 16/260 (6%)

Query: 53  KIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN 112
           K F    W R   +K   GGG    L  G  FE+A +  S V GD  P            
Sbjct: 32  KPFATDTWQRAPGEKLR-GGGCTRILEGGHFFERAGIGFSDVSGDALPGSASAARPQLAG 90

Query: 113 PYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYD 166
             F A G+S+++HP+NPH P VH N+R++V         +WFGGG+DLTP      + Y+
Sbjct: 91  RGFEAMGVSLVLHPHNPHCPTVHMNVRLLVATKAGEEPVFWFGGGMDLTPY-----YGYE 145

Query: 167 PDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG 226
            D   FH T ++  + +    Y  +K WCD YF+L HR E RGIGGIFFD  +S+P   G
Sbjct: 146 EDAQHFHRTCRDALAPYGADLYPKFKRWCDEYFFLKHRNEPRGIGGIFFDD-YSAP---G 201

Query: 227 IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
            D  F+ + +VG+ F+K Y  ++ +  +  + E +R+ Q  RRGRY EFNL++D+GT FG
Sbjct: 202 FDQSFAMLKSVGEGFLKAYLPIIEKRRNVPYGEAEREFQAYRRGRYVEFNLVFDRGTLFG 261

Query: 287 FKTGGNVESILASMPPLVAW 306
            ++GG  ESIL SMPP+V W
Sbjct: 262 LQSGGRTESILMSMPPVVNW 281


>gi|66043295|ref|YP_233136.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|302186433|ref|ZP_07263106.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           642]
 gi|75504057|sp|Q500S4|HEM6_PSEU2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|63254002|gb|AAY35098.1| Coproporphyrinogen oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970348|gb|EGH70414.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 304

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGSAH----------FMEDAWTRPAG-----GGGRTRVIENGTVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGEDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|237801641|ref|ZP_04590102.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024500|gb|EGI04556.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 304

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVIENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|253988874|ref|YP_003040230.1| coproporphyrinogen III oxidase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780324|emb|CAQ83485.1| coproporphyrinogen 3 oxidase, aerobic [Photorhabdus asymbiotica]
          Length = 302

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 162/292 (55%), Gaps = 38/292 (13%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F +LQ  IC + E+ +  A           FT + W     Q+++ GGGR   +  G VF
Sbjct: 13  FLSLQDKICQQLEQADGTAK----------FTEQSW-----QRKEGGGGRSRIMQEGTVF 57

Query: 85  EKAAVLVSTVYGDLSP----DFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           E+A    S + G   P     ++ ++ G +    + A G+SV++HP NP++P  H N+R 
Sbjct: 58  EQAGANFSHISGTRLPVSATSYRPELAGRS----YQAMGISVVIHPLNPYIPTSHANVRF 113

Query: 141 IV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +      +  +WFGGG DLTP      + ++ D I +H T   +C  +    Y  YK+W
Sbjct: 114 FIAEKEGESPVWWFGGGFDLTPY-----YGFEEDAIHWHTTASNICQPYGEDIYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFY+ HR E+RGIGG+F+D L++       +  F+F   +G  F+  Y  +V +   
Sbjct: 169 CDDYFYIKHRNEARGIGGLFYDDLNTP----NFEYCFNFTQDIGKGFLHAYLPIVEKRKS 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L+ E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 225 LLWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|242240615|ref|YP_002988796.1| coproporphyrinogen oxidase [Dickeya dadantii Ech703]
 gi|242132672|gb|ACS86974.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech703]
          Length = 311

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC + E+++  A          +F    W     Q    GGGR   L  G VFE+
Sbjct: 18  TLQDSICRQLEQVDGNA----------VFQEDAW-----QHASGGGGRSRVLRQGTVFEQ 62

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 63  AGVNFSHVSGAALPPSASMHRPELAGRRFQAMGVSLVIHPLNPYVPTSHANVRFFIAEKD 122

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D I +H T   +C       Y  YK+WCD YF+
Sbjct: 123 GEPPVWWFGGGFDLTPF-----YGFKEDAIHWHQTAFALCRPFGDDVYPRYKKWCDDYFF 177

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RGIGG+FFD L++       D  F+F+ AVG+ F+  Y  +V R     + ++
Sbjct: 178 LKHRGEARGIGGLFFDDLNAP----DFDTSFAFMRAVGEGFLHAYLPIVNRRKPLAWGDR 233

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 234 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 279


>gi|330901108|gb|EGH32527.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 292

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGSAH----------FMEDAWTRPAG-----GGGRTRVIENGTVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|283832171|ref|ZP_06351912.1| coproporphyrinogen III oxidase [Citrobacter youngae ATCC 29220]
 gi|291071805|gb|EFE09914.1| coproporphyrinogen III oxidase [Citrobacter youngae ATCC 29220]
          Length = 299

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 146/252 (57%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G +FE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDSWQREAGGGGRSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP++P  H N+R  +    GA   +WFGGG DLTP      +  + D + +H 
Sbjct: 92  SLVVHPLNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGIEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YF+L HR E RGIGG+FFD L ++P+    D  F+F+
Sbjct: 147 TARDLCQPFGEDVYPRYKKWCDDYFFLKHRNEQRGIGGLFFDDL-NTPD---FDRCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG  +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGKGYTDAYLPIVGRRKTMSWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|330976429|gb|EGH76484.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 286

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGSAH----------FMEDAWTRPAG-----GGGRTRVIENGTVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGEDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|289677577|ref|ZP_06498467.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           FF5]
          Length = 304

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGSAH----------FMEDAWTRPAG-----GGGRTRVIENGTVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|238752038|ref|ZP_04613522.1| Coproporphyrinogen III oxidase [Yersinia rohdei ATCC 43380]
 gi|238709738|gb|EEQ01972.1| Coproporphyrinogen III oxidase [Yersinia rohdei ATCC 43380]
          Length = 308

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC    + +  A           FT ++W R     E+ GGGR   L  G VFE+
Sbjct: 15  DLQDKICAALSEADGSAE----------FTEENWAR-----EEGGGGRSRVLTNGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +  D I +H T  ++C       Y  YK+WCD YFY
Sbjct: 120 GEDPVWWFGGGFDLTPF-----YGFAEDAIHWHQTAYQLCQPFGEHLYPQYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD  +S       D  F F  AVGD F+  Y  +V R     + E+
Sbjct: 175 IKHRNEARGIGGLFFDDFNSP----DFDTCFKFTQAVGDGFLDAYLPIVARRKALSWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PP+V W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPMVRW 276


>gi|254372906|ref|ZP_04988395.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570633|gb|EDN36287.1| coproporphyrinogen III oxidase [Francisella novicida GA99-3549]
          Length = 308

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDTPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNTQYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|91787846|ref|YP_548798.1| coproporphyrinogen III oxidase [Polaromonas sp. JS666]
 gi|122967913|sp|Q12C42|HEM6_POLSJ RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91697071|gb|ABE43900.1| Coproporphyrinogen oxidase [Polaromonas sp. JS666]
          Length = 308

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 141/261 (54%), Gaps = 19/261 (7%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W ++  +    G G    L  G+VFE+A    S V G   P    Q         
Sbjct: 32  FITDAWQKEPGEPLQ-GNGITKILENGEVFERAGCGFSHVQGSRLPPSATQHRPELAGAP 90

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVT---------GAYWFGGGIDLTPSLESRRHSY 165
           F A G+S++ HP NP+VP VH N+RM+              WFGGG+DLTP      + +
Sbjct: 91  FEAMGVSLVFHPRNPYVPTVHMNVRMLAATPVSAGPAEAVCWFGGGMDLTPY-----YGF 145

Query: 166 DPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG 225
           D D + FH T K+  +      Y  +K+WCD YFYL HRQE RGIGGIFFD         
Sbjct: 146 DEDAVHFHQTCKDALAPFGGDKYPRFKQWCDEYFYLKHRQEQRGIGGIFFDDFQEL---- 201

Query: 226 GIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNF 285
           G++  F+ + +V D F+  Y  +VRR     +  ++R  QL RRGRY EFNL++D+GT+F
Sbjct: 202 GLEQSFAMMQSVADSFLPAYLPIVRRRQSQPYGARERDFQLYRRGRYVEFNLVWDRGTHF 261

Query: 286 GFKTGGNVESILASMPPLVAW 306
           G ++GG  ESIL SMPPL +W
Sbjct: 262 GLQSGGRTESILMSMPPLASW 282


>gi|208779344|ref|ZP_03246690.1| coproporphyrinogen III oxidase, aerobic [Francisella novicida FTG]
 gi|208745144|gb|EDZ91442.1| coproporphyrinogen III oxidase, aerobic [Francisella novicida FTG]
          Length = 308

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 160/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y+ +K
Sbjct: 118 RIFIAGADTDTPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYSKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|94499922|ref|ZP_01306458.1| Coproporphyrinogen oxidase [Oceanobacter sp. RED65]
 gi|94428123|gb|EAT13097.1| Coproporphyrinogen oxidase [Oceanobacter sp. RED65]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 142/246 (57%), Gaps = 15/246 (6%)

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
           +E+ GGGR   +  G V EK  V  S V+G   P              F A G+S+++HP
Sbjct: 37  REEGGGGRSRVIENGNVIEKGGVNFSHVHGKTLPASATANRPELAGRSFQAMGVSLVIHP 96

Query: 127 YNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +NP+VP  H N+R  +         +WFGGG DLTP      + ++ DV ++H T K+ C
Sbjct: 97  HNPYVPTSHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGFEEDVRYWHQTAKQAC 151

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
                  Y  YK WCD YFY+ HRQE RG+GG+FFD L+     G  +  F+F+ +VGD 
Sbjct: 152 DPFGNDLYEKYKNWCDDYFYIKHRQEPRGVGGLFFDDLND----GDFENSFAFMRSVGDH 207

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           +IK Y  ++ +  +  F EQ+R+ Q  RRGRY EFNL+ D+GT FG +TGG  ESIL S+
Sbjct: 208 YIKAYRPIIAKRKNTDFDEQERKFQCYRRGRYVEFNLVQDRGTIFGLQTGGRTESILMSL 267

Query: 301 PPLVAW 306
           PP+V W
Sbjct: 268 PPVVHW 273


>gi|288934156|ref|YP_003438215.1| coproporphyrinogen oxidase [Klebsiella variicola At-22]
 gi|288888885|gb|ADC57203.1| Coproporphyrinogen oxidase [Klebsiella variicola At-22]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 147/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEKVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|290508360|ref|ZP_06547731.1| coproporphyrinogen III oxidase, aerobic [Klebsiella sp. 1_1_55]
 gi|289777754|gb|EFD85751.1| coproporphyrinogen III oxidase, aerobic [Klebsiella sp. 1_1_55]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 147/252 (58%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+E  GGGR   L  G VFE+A V  S V+GD  P              F A G+
Sbjct: 32  IEDAWQREGGGGGRSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGV 91

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NP+VP  H N+R  +    GA   +WFGGG DLTP      + ++ D + +H 
Sbjct: 92  SLVVHPLNPYVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHR 146

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T +++C       Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+
Sbjct: 147 TARDLCLPFGEKVYPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFM 202

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ +   Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  E
Sbjct: 203 QAVGNGYADAYLPIVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTE 262

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 263 SILMSMPPLVRW 274


>gi|271499349|ref|YP_003332374.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech586]
 gi|270342904|gb|ACZ75669.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech586]
          Length = 312

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  +C + E  +  A                ++ D  Q    GGGR   L  G+VFE+
Sbjct: 15  GLQDTLCRQLELADGTAS---------------FIEDAWQHASGGGGRSRVLRQGRVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H NIR  +    
Sbjct: 60  AGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANIRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+WCD YF+
Sbjct: 120 GEPAVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFDLCQPFGDDVYPRYKKWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R     + E+
Sbjct: 175 LKHRNEARGVGGLFFDDLNTP----DFDTSFAFMRAVGEGFQHAYLPIVNRRKDIPWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|219125200|ref|XP_002182874.1| coproporphyrinogen III oxidase [Phaeodactylum tricornutum CCAP
           1055/1]
 gi|217405668|gb|EEC45610.1| coproporphyrinogen III oxidase [Phaeodactylum tricornutum CCAP
           1055/1]
          Length = 304

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 157/285 (55%), Gaps = 21/285 (7%)

Query: 34  TEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVST 93
           + FEKL  EA  +      +I     +  D   + + GGG    L  GKVFEKA V +S 
Sbjct: 3   SRFEKLCREAQISITKAIEEIDGEGVFREDCWTRANGGGGMSRVLSGGKVFEKAGVNLSV 62

Query: 94  VYGDLSPDF----------KDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           VYG +  +           + + +   +   F+A GLS ++HP NPH P +HFN R   T
Sbjct: 63  VYGSMPQEALQAATERGVDRAKGMAPGERVPFFACGLSSVMHPKNPHAPTMHFNYRYFET 122

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
             G +WFGGG D+TPS     +  + D+  FH T KE+C +H    Y  +K W DRYF +
Sbjct: 123 DGGVWWFGGGTDITPS-----YLNEDDMKHFHGTYKEVCDKHDPEYYEEFKAWADRYFVI 177

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RG+GGIFFD  ++       D  F+F     +  IK Y  +V ++    ++E+ 
Sbjct: 178 QHRNETRGLGGIFFDDQNNKTP----DEHFAFSEEAVNSVIKAYGPIVEKHKDDPYTEKQ 233

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +Q QL+RRGRY EFNL+YD+GT FG KTGG +ESIL S+P    W
Sbjct: 234 KQWQLMRRGRYVEFNLVYDRGTVFGLKTGGRIESILMSLPETARW 278


>gi|157371701|ref|YP_001479690.1| coproporphyrinogen III oxidase [Serratia proteamaculans 568]
 gi|167008825|sp|A8GHH2|HEM6_SERP5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157323465|gb|ABV42562.1| Coproporphyrinogen oxidase [Serratia proteamaculans 568]
          Length = 306

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 155/285 (54%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  ICT+  + +  A          +F    W R     E+ GGGR   L  G VFE+A
Sbjct: 16  LQDRICTQLAQADGSA----------VFNEDRWTR-----EEGGGGRSRVLTEGAVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V  S V G   P              F A G+S+++HP +P++P  H N+R  +     
Sbjct: 61  GVNFSHVSGATLPASATAHRPELAGRSFQAMGVSLVIHPRSPYIPTSHANVRFFIAEKPG 120

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ D + +H T + +C+      Y  YK+WCD YF++
Sbjct: 121 EEPVWWFGGGFDLTPF-----YGFEEDAVHWHRTAERLCAPFGEQVYPKYKKWCDDYFFI 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGG+FFD L++ P+       F+F  AVG+ F++ Y  +V +     + + +
Sbjct: 176 KHRNEARGIGGLFFDDLNT-PDFATC---FAFTQAVGEGFLEAYLPIVEKRKTLSWGDHE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 232 RQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|67537920|ref|XP_662734.1| hypothetical protein AN5130.2 [Aspergillus nidulans FGSC A4]
 gi|40743121|gb|EAA62311.1| hypothetical protein AN5130.2 [Aspergillus nidulans FGSC A4]
          Length = 487

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 149/275 (54%), Gaps = 31/275 (11%)

Query: 58  KHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLS--------PDFKDQILGT 109
           K +  D   + + GGG    L  G VFEKA V VS VYGDL          D K  +   
Sbjct: 177 KQFRADTWTRPNGGGGISCVLQDGNVFEKAGVNVSIVYGDLPRAAIEKMRADHKSFVGAD 236

Query: 110 TKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG----------AYWFGGGIDLTPSLE 159
            ++  F+A GLS+++HP+NP  P VH N R   T            +WFGGG DLTPS  
Sbjct: 237 VESLSFFAAGLSLVLHPHNPMAPTVHLNYRYFETSDPKDPINGDKNWWFGGGTDLTPS-- 294

Query: 160 SRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL- 218
              + +  DV  FH T+KE C +H    Y  +KEWCD+YFY+PHR+E RG+GGIFFD L 
Sbjct: 295 ---YLFPEDVQHFHKTIKEACDRHDATYYPRFKEWCDKYFYIPHRRECRGVGGIFFDDLD 351

Query: 219 ------HSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRY 272
                  S+      +  FSF+S     F+  Y  +V R     F+   ++ Q +RRGRY
Sbjct: 352 ANFLESSSTSSQNPQETLFSFVSDALASFLPSYVPIVERRKDMPFTPAQKEWQQLRRGRY 411

Query: 273 AEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
            EFNL+YD+GT+FG +T    +ESIL S+P   +W
Sbjct: 412 VEFNLVYDRGTSFGLRTPSARIESILMSLPRTASW 446


>gi|325917394|ref|ZP_08179608.1| coproporphyrinogen oxidase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536395|gb|EGD08177.1| coproporphyrinogen oxidase [Xanthomonas vesicatoria ATCC 35937]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 149/286 (52%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  +  A           F+   W     Q+E+ GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAVEAADGRAR----------FSEDLW-----QREEGGGGRTRILRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + A G+S++ HP NPHVP  H N+R       
Sbjct: 58  AGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPNNPHVPTTHMNVRYFRAERD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      +  D DV  +H T + +C+      Y  +K WCD YF+
Sbjct: 118 GEVVAAWFGGGFDLTPF-----YPMDEDVQHWHRTAQALCAPFGEERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  LV+R     F E+
Sbjct: 173 LRHRNETRGVGGLFFDDLGQD-----FERDFAYQQAVGNGFLDAYMPLVQRRKDEPFGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|158297942|ref|XP_001689093.1| AGAP004749-PA [Anopheles gambiae str. PEST]
 gi|158297944|ref|XP_318069.4| AGAP004749-PB [Anopheles gambiae str. PEST]
 gi|157014569|gb|EDO63510.1| AGAP004749-PA [Anopheles gambiae str. PEST]
 gi|157014570|gb|EAA13292.4| AGAP004749-PB [Anopheles gambiae str. PEST]
          Length = 397

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/264 (43%), Positives = 153/264 (57%), Gaps = 27/264 (10%)

Query: 58  KHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN----- 112
           K +L D+ ++++ GGG    L  G VFEKA V +S V+G+L      Q+    K      
Sbjct: 118 KKFLVDRWERKEGGGGITCVLQDGDVFEKAGVNISVVHGNLPKGAIQQMRSRGKQLADGE 177

Query: 113 -PYFWATGLSVIVHPYNPHVPAVHFNIRMI-VTGA-----YWFGGGIDLTPSLESRRHSY 165
            P+F A G+S ++HP NP VP +HFN R   VT +     +WFGGG DLTP      +  
Sbjct: 178 LPFF-AVGVSAVIHPRNPFVPTIHFNYRYFEVTDSTGQRQWWFGGGTDLTPY-----YLN 231

Query: 166 DPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG 225
           + D   FH TLKE C  H    Y  +KEWCD+YF++PHR ESRG+GGIFFD      ++ 
Sbjct: 232 EEDAKHFHRTLKEACDSHDATYYPKFKEWCDKYFFIPHRNESRGVGGIFFD------DLD 285

Query: 226 GIDAD--FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
           G DA+  F F+S+     I  Y  LVR + +  + ++ RQ QL+RRGRY EFNL+YD+GT
Sbjct: 286 GPDAERAFDFVSSCAHSVIPSYLPLVREHKNDPYGDRHRQWQLLRRGRYVEFNLIYDRGT 345

Query: 284 NFGFKT-GGNVESILASMPPLVAW 306
            FG  T G   ESIL S+P    W
Sbjct: 346 KFGLYTPGARYESILMSLPLNARW 369


>gi|71735087|ref|YP_272340.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123638996|sp|Q48QH6|HEM6_PSE14 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|71555640|gb|AAZ34851.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 304

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVIENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTAQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|218439994|ref|YP_002378323.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 7424]
 gi|218172722|gb|ACK71455.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7424]
          Length = 344

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 160/315 (50%), Gaps = 44/315 (13%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + + R+SQ   + LQ  IC   E+L+                V  +  D  ++E+ GGGR
Sbjct: 20  DAKARVSQ-FMKALQDEICQGLEELDG---------------VAQFREDSWEREEGGGGR 63

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G +FE+  V  S V+G   P    +     +   F+ATG S+++HP +P++P V
Sbjct: 64  SRVMREGAIFEQGGVNFSEVWGKQLPPSILKQRPEAEGHQFYATGTSMVLHPRSPYIPTV 123

Query: 135 HFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           H N R    G  +WFGGG DLTP      + Y  D   FH T K  C +H    Y  +K 
Sbjct: 124 HLNYRYFEAGPVWWFGGGADLTPY-----YPYAEDASHFHRTFKAACDKHHPEYYPVFKR 178

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHS-SPEMGGIDAD---------------------F 231
           WCD YFYL HR E RG+GGIFFD+     P   G DAD                     F
Sbjct: 179 WCDEYFYLKHRGEMRGVGGIFFDYQDGLDPLYRGPDADKPAAIYSNQLSPKNPRTWEELF 238

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
           +F+S  G  F+  Y  + ++     + +++RQ QL RRGRY EFNL+YD+GT FG +T G
Sbjct: 239 AFVSDCGRAFLPAYVPIAQKRKDTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNG 298

Query: 292 NVESILASMPPLVAW 306
             ESIL S+PPLV W
Sbjct: 299 RTESILMSLPPLVRW 313


>gi|183599731|ref|ZP_02961224.1| hypothetical protein PROSTU_03234 [Providencia stuartii ATCC 25827]
 gi|188021990|gb|EDU60030.1| hypothetical protein PROSTU_03234 [Providencia stuartii ATCC 25827]
          Length = 305

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC +  +L+ +          + F  + W R +      GGGR   L  G +FE+
Sbjct: 15  ELQETICQKITELDGK----------ETFLEQTWERAEG-----GGGRSRVLTQGAIFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S + G   P              + A G+S+++HP NP++P  H N+R  +    
Sbjct: 60  AGVNFSHIQGTKLPSSATAHRPELAGRSYQAMGVSLVIHPLNPYIPTTHANVRFFIAEKE 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ DVI +H    ++C+      Y  YK WCD YF+
Sbjct: 120 GQDPVWWFGGGFDLTPY-----YGFEDDVIHWHTIAHDLCAPFGSETYRKYKAWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RG+GG+F+D L+        +  F F  AVG  F+  Y  +V +  HH + E+
Sbjct: 175 LKHRNEPRGVGGLFYDDLNQP----DFETCFDFTQAVGHGFLDAYVPIVEKRRHHQWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|254374360|ref|ZP_04989842.1| hypothetical protein FTDG_00527 [Francisella novicida GA99-3548]
 gi|151572080|gb|EDN37734.1| hypothetical protein FTDG_00527 [Francisella novicida GA99-3548]
 gi|332678244|gb|AEE87373.1| Coproporphyrinogen III oxidase, aerobic [Francisella cf. novicida
           Fx1]
          Length = 308

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTPY-----YPFEEDAIHWHQTAKNICDKHDRTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNTEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|169764060|ref|XP_001727930.1| coproporphyrinogen-III oxidase [Aspergillus oryzae RIB40]
 gi|83770958|dbj|BAE61091.1| unnamed protein product [Aspergillus oryzae]
          Length = 437

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 169/326 (51%), Gaps = 32/326 (9%)

Query: 7   EIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQ 66
           E+  P  +E  + + ++   +  S +    EKL  E  +   +   +I    H+  D   
Sbjct: 77  ELDSPSIVELDEALKKQATISENSPMRLRMEKLIKEHQKKIVDELSRI-DGTHFKTDTWA 135

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLS--------PDFKDQILGTTKNPYFWAT 118
           + + GGG    L  G VFEKA V VS VYG+L          D K  +    ++  F+A 
Sbjct: 136 RPNGGGGISCVLQDGNVFEKAGVNVSVVYGELPRAAIEKMRADHKSFVGADVESLEFFAA 195

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTG----------AYWFGGGIDLTPSLESRRHSYDPD 168
           GLS+++HP+NP  P VH N R   T            +WFGGG DLTPS     + +  D
Sbjct: 196 GLSLVLHPHNPMAPTVHLNYRYFETSDPKDPINGDKNWWFGGGTDLTPS-----YLFPED 250

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS------- 221
           V  FH T+K+ C +H    Y  +K WCD+YFYLPHR+ESRG+GGIFFD L +S       
Sbjct: 251 VKHFHQTIKDACDRHDATYYPRFKAWCDKYFYLPHRRESRGVGGIFFDDLDASFLESSAT 310

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
                 +  FSF+S     F+  Y  ++ R     F+   ++ Q +RRGRY EFNL+YD+
Sbjct: 311 SSQNPQETLFSFVSDSLASFLPSYVPIIERRKDTPFTPAQKEWQQLRRGRYVEFNLVYDR 370

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT+FG +T    +ESIL S+P   +W
Sbjct: 371 GTSFGLRTPNARIESILMSLPRTASW 396


>gi|304309711|ref|YP_003809309.1| Oxygen-dependent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
 gi|301795444|emb|CBL43642.1| Oxygen-dependent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
          Length = 334

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 155/287 (54%), Gaps = 34/287 (11%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ+ IC+  E          A  S   F    W RD       GGG    L  G+VFEKA
Sbjct: 41  LQARICSGLE----------AEESRGCFIEDRWDRDAG-----GGGCSRVLEGGEVFEKA 85

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---G 144
            V  S VYG+  P              F A G+S+++HP NP VP  H N+R  V    G
Sbjct: 86  GVNFSHVYGESLPASATAHRPELAGRSFNAMGVSLVIHPRNPFVPTSHANVRYFVAEKPG 145

Query: 145 A---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           A   +WFGGG DLTP      + ++ D + +H T K  C       Y  YK+WCD YF+L
Sbjct: 146 AEPVWWFGGGFDLTP-----YYPFEEDCVHWHKTAKAACDPFGAGVYAQYKKWCDEYFFL 200

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV--RRNYHHLFSE 259
            HR E+RG+GG+FFD L+        +  F+F+ +VGD F+  Y  +V  R+N H  +++
Sbjct: 201 KHRNETRGVGGLFFDDLN----QWDFETSFAFMRSVGDHFLPAYQPIVAARKNTH--YTD 254

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             R+ QL RRGRY EFNL+YD+GT FG +TGG VESIL S+P  V+W
Sbjct: 255 AQREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRVESILMSLPSQVSW 301


>gi|119486200|ref|ZP_01620260.1| coproporphyrinogen III oxidase [Lyngbya sp. PCC 8106]
 gi|119456691|gb|EAW37820.1| coproporphyrinogen III oxidase [Lyngbya sp. PCC 8106]
          Length = 364

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 164/320 (51%), Gaps = 46/320 (14%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P   + + R+SQ   + +Q  IC   E+L+ ++           F    W R +      
Sbjct: 35  PPGADSQARVSQF-MKQIQDEICQGLEQLDGKSK----------FQEDSWERPEG----- 78

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
           GGGR   L  G VFE+  V  S V+G +L P    Q     +   F+ATG S+++HP NP
Sbjct: 79  GGGRSRVLHDGDVFEQGGVNFSEVWGKNLPPSILAQ-RPEAEGHGFYATGTSMVLHPRNP 137

Query: 130 HVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           ++P VH N R    G  +WFGGG+DLTP      + +  D   FH T K  C +H    Y
Sbjct: 138 YIPTVHLNYRYFEAGPVWWFGGGVDLTPY-----YPFAEDAAHFHKTFKVACDRHHDEYY 192

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHL----------HS------------SPEMGG 226
             +K WCD YFY+ HRQE+RGIGGIFFD+           HS            +PE   
Sbjct: 193 PVFKHWCDEYFYIKHRQEARGIGGIFFDYQDGQGELYRGPHSDSEAAKYSGHIGTPETRD 252

Query: 227 IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
            +A F+F+   G  F+  Y  +V R     + + +R  QL RRGRY EFNL+YD+GT FG
Sbjct: 253 WEALFAFVQDCGRAFLPGYQPIVERRRGTEYGDHERNFQLYRRGRYVEFNLVYDRGTIFG 312

Query: 287 FKTGGNVESILASMPPLVAW 306
            +T G  ESIL S+PPLV W
Sbjct: 313 LQTNGRTESILMSLPPLVRW 332


>gi|26986818|ref|NP_742243.1| coproporphyrinogen III oxidase [Pseudomonas putida KT2440]
 gi|38372332|sp|Q88RQ6|HEM6_PSEPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24981415|gb|AAN65707.1|AE016197_5 coproporphyrinogen III oxidase, aerobic [Pseudomonas putida KT2440]
          Length = 303

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  G V EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVREAG-----GGGRTRVIGEGNVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD F+  Y  +V+R  +  ++ Q
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEWD----FDTCFAFIRAIGDAFVDAYLPIVQRRKNTPYTPQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|285016941|ref|YP_003374652.1| coproporphyrinogen 3 oxidase, aerobic protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472159|emb|CBA14666.1| probable coproporphyrinogen 3 oxidase, aerobic protein [Xanthomonas
           albilineans]
          Length = 299

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 150/286 (52%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E  + +A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  GLQDRICATVEATDGQAR----------FAEDVW-----QRAEGGGGRTRILRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI----- 141
           A V  S V G   P              + A G+S++ HP +P++P  H N+R       
Sbjct: 58  AGVGFSDVSGTRLPPSASANRPELAGASWRAVGVSLVFHPLSPYIPTTHTNVRYFEAERE 117

Query: 142 -VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
             T A+WFGGG DLTP      + +D D   +H T  ++C+      Y  +K WCD YFY
Sbjct: 118 GATVAWWFGGGFDLTPY-----YPFDEDARHWHQTAHDLCAPFGAERYPAHKRWCDEYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD LH+       + DF++  AVGD F+  Y  +V R     + E+
Sbjct: 173 LKHRNETRGVGGLFFDDLHAD-----FERDFAYQRAVGDGFLDAYLPIVARRRALPWGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|85059690|ref|YP_455392.1| coproporphyrinogen III oxidase [Sodalis glossinidius str.
           'morsitans']
 gi|123519114|sp|Q2NS88|HEM6_SODGM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|84780210|dbj|BAE74987.1| coproporphyrinogen III oxidase [Sodalis glossinidius str.
           'morsitans']
          Length = 304

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 151/285 (52%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC      +  A          +F    W RD+      GGGR   L  G+VFE+A
Sbjct: 16  LQETICAALTAADGGA----------VFHEDLWQRDEG-----GGGRTRVLRQGRVFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---G 144
            V  S VYG   P              + A G+S++VHP NP++P  H N+R  +    G
Sbjct: 61  GVNFSRVYGGALPASATAHRPELAGRSYQAMGVSLVVHPENPYIPTSHANVRFFIAEKPG 120

Query: 145 A---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
           A   +WFGGG DLTP      + +  D + +H T + +C       Y  YK WCD YF+L
Sbjct: 121 AEPIWWFGGGFDLTPF-----YGFHEDAVHWHRTAQALCQPFGDTVYPRYKRWCDDYFFL 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGG+FFD L S+P     +  F+F  AV   ++  Y  +V R   H + E++
Sbjct: 176 KHRNEARGIGGLFFDDL-SAPN---FNEAFAFCRAVSQGYLDAYLPIVERRKSHPWGERE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRY EFNL++D+GT FG ++GG  ES+L SMPPL  W
Sbjct: 232 RQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESVLMSMPPLARW 276


>gi|192359457|ref|YP_001984040.1| coproporphyrinogen III oxidase [Cellvibrio japonicus Ueda107]
 gi|190685622|gb|ACE83300.1| coproporphyrinogen III oxidase, aerobic [Cellvibrio japonicus
           Ueda107]
          Length = 306

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 143/252 (56%), Gaps = 15/252 (5%)

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           + D  Q+ + GGGR   L  G+V EK  V  S VYG   P              F A G+
Sbjct: 37  IEDSWQRAEGGGGRSRVLADGQVIEKGGVNFSHVYGTQMPASATAHRPELAGRAFEAMGV 96

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S+++HP NP+VP  H N+R  +    GA   +WFGGG DLTP      +  + DVI +H 
Sbjct: 97  SLVIHPGNPYVPTSHANVRFFIAEKEGAAPVWWFGGGYDLTPY-----YGNEADVIHWHQ 151

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           + K  C       Y  +K+WCD YFYL HR E+RG+GG+FFD  ++          F+ +
Sbjct: 152 SAKNACDPLGEHLYPKFKKWCDDYFYLKHRGEARGVGGLFFDDYNAE----SFAHSFALM 207

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVGD ++  Y  +V+   H  + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  E
Sbjct: 208 RAVGDSYVPAYLPIVQARKHTPYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTE 267

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 268 SILMSLPPLVRW 279


>gi|331653863|ref|ZP_08354864.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M718]
 gi|331048712|gb|EGI20788.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M718]
          Length = 299

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 155/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREGGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|254430328|ref|ZP_05044031.1| coproporphyrinogen III oxidase, aerobic [Cyanobium sp. PCC 7001]
 gi|197624781|gb|EDY37340.1| coproporphyrinogen III oxidase, aerobic [Cyanobium sp. PCC 7001]
          Length = 371

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 154/306 (50%), Gaps = 50/306 (16%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E+L+ E            F  + W R +      GGGR   +  G+VFE+
Sbjct: 48  GLQDSICAGLEQLDGEGR----------FAEESWERPEG-----GGGRSRVMKEGRVFEQ 92

Query: 87  AAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG- 144
             V  S V G +L P    Q      +P+F ATG S+++HP NP++P VH N R    G 
Sbjct: 93  GGVNFSEVQGSELPPSILSQRPEAKGHPWF-ATGTSMVLHPRNPYIPTVHLNYRYFEAGP 151

Query: 145 AYWFGGGIDLTPS---LESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
            +WFGGG DLTP    LE  RH        FH TLK  C     A Y  +K WCD YF+L
Sbjct: 152 VWWFGGGADLTPYYPFLEDARH--------FHRTLKGACDSVNPAYYPVFKPWCDEYFFL 203

Query: 202 PHRQESRGIGGIFFDH---------------------LHSSPEMGGIDADFSFISAVGDC 240
            HRQE+RG+GGIF+D+                     L   P     +  F   SA G  
Sbjct: 204 RHRQETRGVGGIFYDYQDPRGVLYKGQNPEGPAAAASLRQGPLPQSWEQLFQLASACGHA 263

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  +  +  H  + +++RQ QL RRGRY EFNL++D+GT FG +T G  ESIL S+
Sbjct: 264 FLPSYVPIAEKRQHTTYGDRERQFQLYRRGRYVEFNLVFDRGTIFGLQTNGRTESILMSL 323

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 324 PPLVRW 329


>gi|291618330|ref|YP_003521072.1| HemF [Pantoea ananatis LMG 20103]
 gi|291153360|gb|ADD77944.1| HemF [Pantoea ananatis LMG 20103]
 gi|327394721|dbj|BAK12143.1| coproporphyrinogen III oxidase HemF [Pantoea ananatis AJ13355]
          Length = 304

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 148/254 (58%), Gaps = 15/254 (5%)

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
           H++ D  Q+   GGGR   L  G VFE+A V  S V+GD  P              F A 
Sbjct: 30  HFIEDSWQRPGGGGGRSRVLRDGAVFEQAGVNFSHVHGDQMPASATAHRPELAGCSFEAM 89

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFF 172
           G+S+++HP+NP+VP  H N+R  +    GA   +WFGGG D+TP      + ++ D + +
Sbjct: 90  GVSLVIHPHNPYVPTSHANVRFFIAEKPGAEPIWWFGGGFDMTPF-----YGFEEDALHW 144

Query: 173 HNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFS 232
           H T  ++C       Y  +K+WCD YFYL HR E RGIGG+FFD +H    + G +  F+
Sbjct: 145 HQTAFDLCQPFGEDVYPRFKKWCDDYFYLKHRDEQRGIGGLFFDDVH----LPGFEKSFA 200

Query: 233 FISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGN 292
            I AVG  F+  Y  +V R     F E++RQ QL RRGRY EFNL++D+GT FG +TGG 
Sbjct: 201 LIQAVGRGFLDAYQPIVARRKSLPFGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGR 260

Query: 293 VESILASMPPLVAW 306
            ESIL S+PPLV W
Sbjct: 261 TESILMSLPPLVRW 274


>gi|88705374|ref|ZP_01103085.1| Coproporphyrinogen III oxidase [Congregibacter litoralis KT71]
 gi|88700464|gb|EAQ97572.1| Coproporphyrinogen III oxidase [Congregibacter litoralis KT71]
          Length = 310

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 152/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC    +++  A           FT++ W R +      GGGR   L  G V EK
Sbjct: 14  GLQDSICESLAQVDGGAE----------FTIEEWDRPEG-----GGGRSRVLSDGAVLEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V GD  P              + A G+S+++HP NP+ P  H N+R+ +    
Sbjct: 59  AGVNFSHVMGDQLPGSATAARPELAGRSYQAMGVSLVIHPRNPYAPTSHANVRLFIAEKP 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  + C+      Y  YK+WCD YFY
Sbjct: 119 GEEPVWWFGGGYDLTPY-----YGFEEDCVHWHKTAADACAPFGDEVYPKYKKWCDEYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+F+D L++       D  F+F+ A+GD ++  Y  ++ R     + ++
Sbjct: 174 LKHRNEPRGIGGLFYDDLNTW----DFDTCFAFMRAIGDSYLAAYRPILERRKDTPYDDR 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPLV W
Sbjct: 230 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSNGRTEAILMSLPPLVRW 275


>gi|67922276|ref|ZP_00515789.1| Coproporphyrinogen oxidase [Crocosphaera watsonii WH 8501]
 gi|67855852|gb|EAM51098.1| Coproporphyrinogen oxidase [Crocosphaera watsonii WH 8501]
          Length = 343

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 148/268 (55%), Gaps = 28/268 (10%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           +D   +E+ GGGR   +  G   E+  V  S V+G   P    +     +   F+ATG S
Sbjct: 51  QDSWDREEGGGGRSRVIRDGNFLEQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTS 110

Query: 122 VIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP NP+VP VH N R    G  +WFGGGIDLTP      + +  DV  FH TLKE C
Sbjct: 111 MVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGIDLTPY-----YPFAEDVKQFHQTLKETC 165

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS-PEMGGIDAD--------- 230
            +H    Y+ +K WCD YFYL HRQE+RG+GG+FFD+   + P   G  AD         
Sbjct: 166 DKHHPEYYSVFKPWCDEYFYLKHRQETRGVGGLFFDYQDGTDPLYRGPHADKAAAKYSNQ 225

Query: 231 ------------FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                       F+F++  G  F+  Y  +V +  +  + ++ RQ QL RRGRY EFNL+
Sbjct: 226 LPPQENRTWEDLFAFVNDCGRAFLTAYLPIVEKRRNTEYEDKQRQFQLYRRGRYVEFNLV 285

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 286 YDRGTIFGLQTNGRTESILMSLPPLVRW 313


>gi|307151643|ref|YP_003887027.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7822]
 gi|306981871|gb|ADN13752.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7822]
          Length = 343

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 162/317 (51%), Gaps = 48/317 (15%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEA--HENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           + ++R+SQ   ++LQ  IC   E+L+      E+S NR                 E+ GG
Sbjct: 20  DAKERVSQ-FMKSLQDEICQGLEELDGTGKFREDSWNR-----------------EEGGG 61

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G V E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P
Sbjct: 62  GRSRVLRDGGVLEQGGVNFSEVWGKQLPPSILKQRPEAEGHEFYATGTSLVLHPRNPYIP 121

Query: 133 AVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            VH N R    G  +WFGGG DLTP      + Y  D   FH T K  C QH    Y  +
Sbjct: 122 TVHLNYRYFEAGPVWWFGGGADLTPY-----YPYAEDAAHFHRTFKAACDQHHPEYYPVF 176

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHS-SPEMGGIDAD-------------------- 230
           K WCD YFYL HR E+RGIGG+FFD+     P   G  AD                    
Sbjct: 177 KRWCDEYFYLKHRGETRGIGGLFFDYQDGLDPLYRGPHADQGAAIYSQQLPPQSPRTWEQ 236

Query: 231 -FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT 289
            F+F++  G  F+  Y  + +R  +  + +++RQ QL RRGRY EFNL+YD+GT FG +T
Sbjct: 237 LFAFVNDCGRAFLPAYVPIAQRRKNTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQT 296

Query: 290 GGNVESILASMPPLVAW 306
            G  ESIL S+PPLV W
Sbjct: 297 NGRTESILMSLPPLVRW 313


>gi|56708148|ref|YP_170044.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670619|ref|YP_667176.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis FSC198]
 gi|224457244|ref|ZP_03665717.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254874952|ref|ZP_05247662.1| hemF, coproporphyinogen III oxidase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|81597443|sp|Q5NFZ8|HEM6_FRATT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122970927|sp|Q14HF0|HEM6_FRAT1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|56604640|emb|CAG45696.1| Coproporphyinogen III oxidase [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320952|emb|CAL09079.1| Coproporphyinogen III oxidase [Francisella tularensis subsp.
           tularensis FSC198]
 gi|254840951|gb|EET19387.1| hemF, coproporphyinogen III oxidase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159356|gb|ADA78747.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 308

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTHDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPIATW 282


>gi|322831812|ref|YP_004211839.1| Coproporphyrinogen oxidase [Rahnella sp. Y9602]
 gi|321167013|gb|ADW72712.1| Coproporphyrinogen oxidase [Rahnella sp. Y9602]
          Length = 316

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC +    +              F+   W+R     E+ GGG+   L  G VFE+
Sbjct: 17  KLQDHICQQLAAADGNGQ----------FSEDQWVR-----EEGGGGQSRVLTHGAVFEQ 61

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 62  AGVNFSHVAGATLPASATAHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANVRFFIAEKP 121

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H T +++C       Y  YK+WCD YF+
Sbjct: 122 GEAPVWWFGGGFDLTPY-----YGFEEDARHWHLTAQQLCQPFGDDVYPKYKKWCDDYFF 176

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L+S       D  FSF+ AVG+ F   Y  +V +     + E+
Sbjct: 177 IKHRNEARGIGGLFFDDLNSP----DFDTSFSFMQAVGNGFTDAYLPIVEKRKALPWGER 232

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 233 ERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 278


>gi|330890225|gb|EGH22886.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 309

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVIENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|221135277|ref|ZP_03561580.1| coproporphyrinogen III oxidase [Glaciecola sp. HTCC2999]
          Length = 310

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 160/302 (52%), Gaps = 32/302 (10%)

Query: 13  DIEERKRISQRK--FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           ++   ++I+Q K     LQ  IC   E  + +A                ++ D+ ++E  
Sbjct: 4   ELPSHEKIAQVKAFLLKLQDNICQTLELSDGKAR---------------FVEDEWEREQG 48

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGGR   L  G V E+  V  S V+GD  P              F A G+S+++HP+NP+
Sbjct: 49  GGGRTRVLTNGAVIEQGGVNFSHVFGDQMPASATAARPELAGRRFQAMGVSLVIHPHNPY 108

Query: 131 VPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           +P  H N+R  +         +WFGGG DLTP        +  DV+ +H    ++C    
Sbjct: 109 IPTSHANVRFFIAEKEGEAPIWWFGGGFDLTPFF-----PFKEDVVHWHKVAHDLCLPFG 163

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  YK+WCD YFYL HR E+RG+GG+FFD L ++P+    +  F F+ AVG+ ++  
Sbjct: 164 EDVYPKYKKWCDDYFYLKHRNETRGVGGLFFDDL-NTPD---FETAFGFMQAVGNGYLDA 219

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  ++ +  +  +   +R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV
Sbjct: 220 YVPIIEKRKNTEYGNMERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLV 279

Query: 305 AW 306
            W
Sbjct: 280 RW 281


>gi|251790867|ref|YP_003005588.1| Coproporphyrinogen oxidase [Dickeya zeae Ech1591]
 gi|247539488|gb|ACT08109.1| Coproporphyrinogen oxidase [Dickeya zeae Ech1591]
          Length = 312

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  +C + E  +  A                ++ D  Q    GGGR   L  G+VFE+
Sbjct: 15  KLQDTLCRQLELADGSAT---------------FIEDAWQHASGGGGRSRVLRQGRVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H NIR  +    
Sbjct: 60  AGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANIRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+WCD YF+
Sbjct: 120 GEPAVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFDLCRPFGDDVYPRYKKWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R     + E+
Sbjct: 175 LKHRNEARGVGGLFFDDLNTP----DFDTSFAFMRAVGEGFQHAYLPIVNRRKDIPWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|186685247|ref|YP_001868443.1| coproporphyrinogen III oxidase [Nostoc punctiforme PCC 73102]
 gi|186467699|gb|ACC83500.1| coproporphyrinogen III oxidase [Nostoc punctiforme PCC 73102]
          Length = 346

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/303 (37%), Positives = 160/303 (52%), Gaps = 32/303 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           + Q  +    ++L++E  E+ A    K+  V  +  D  ++ + GGGR   L  G +FE+
Sbjct: 22  DAQIRVSQFMKQLQDEITESLA----KLDGVAKFNEDSWERPEGGGGRSRVLREGAIFEQ 77

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-A 145
           A V  S V+G   P              F+ATG S+++HP+NP+VP VH N R    G  
Sbjct: 78  AGVNFSEVWGSHLPASILTQRPEAAGHGFYATGTSMVLHPHNPYVPTVHLNYRYFEAGPV 137

Query: 146 YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQ 205
           +WFGGGIDLTP      + +  D    H TLK+ C +H    Y  +K+WCD YFYL HR 
Sbjct: 138 WWFGGGIDLTPY-----YPFAEDAAHLHKTLKQACDKHHPEYYPVFKKWCDEYFYLKHRD 192

Query: 206 ESRGIGGIFFDH------LHSSPEMGGIDAD----------------FSFISAVGDCFIK 243
           E+RG+GG+FFD+      L+  P   G  A                 F+F+   G  F+ 
Sbjct: 193 ETRGVGGLFFDYQDGQGALYRGPNPNGEAAIYSNQVGTPATRNWEDLFAFVQGCGRAFLP 252

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V R +   + ++ R  QL RRGRY EFNL+YD+GT FG +T G  ESIL S+PPL
Sbjct: 253 AYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLPPL 312

Query: 304 VAW 306
           V W
Sbjct: 313 VRW 315


>gi|125984037|ref|XP_001355783.1| GA17449 [Drosophila pseudoobscura pseudoobscura]
 gi|54644100|gb|EAL32842.1| GA17449 [Drosophila pseudoobscura pseudoobscura]
          Length = 388

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 148/268 (55%), Gaps = 29/268 (10%)

Query: 53  KIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN 112
           K F V  W     Q+E+ GGG    +  G VFEKA V +S V G L P    Q+    KN
Sbjct: 110 KKFQVDRW-----QREEGGGGITCVIQDGDVFEKAGVNISVVTGWLPPAAVQQMRSRGKN 164

Query: 113 -------PYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLE 159
                  P+F A+G+S ++HP NPH+P +HFN R            +WFGGG DLTP   
Sbjct: 165 LTEGAKLPFF-ASGVSAVIHPRNPHIPTIHFNYRYFEVETPDGKKQWWFGGGTDLTPYYL 223

Query: 160 SRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH 219
            ++     D   FH TLK  C +H  + Y  +K+WCD YF + HR ESRGIGGIFFD + 
Sbjct: 224 DKQ-----DARHFHQTLKSACDEHDTSYYPKFKKWCDDYFRIKHRSESRGIGGIFFDDID 278

Query: 220 SSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
           S  +    +A F+F++      I  Y  LV+++ +  +   +RQ QL+RRGRY EFNL+Y
Sbjct: 279 SPNQ----EAAFNFVTGCAKAVIPSYMPLVQKHKNREYGNNERQWQLLRRGRYVEFNLIY 334

Query: 280 DKGTNFGFKT-GGNVESILASMPPLVAW 306
           D+GT FG  T G   ESIL S+P    W
Sbjct: 335 DRGTKFGLYTPGARYESILMSLPLHARW 362


>gi|332291696|ref|YP_004430305.1| Coproporphyrinogen oxidase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169782|gb|AEE19037.1| Coproporphyrinogen oxidase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 301

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 158/289 (54%), Gaps = 34/289 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  I +  E+L+ +A           F   +W R +      GGGR   +  G +FEK
Sbjct: 11  NLQDQITSTLEQLDGKAS----------FQEDNWKRPEG-----GGGRTRVIENGNIFEK 55

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM------ 140
             V  S V+G+L P+   +  G  K+  F+A GLS+++HP +P VP VH N R       
Sbjct: 56  GGVNTSQVHGEL-PEAMQKYFGV-KDANFFACGLSLVLHPSSPMVPTVHANWRYFEMYDS 113

Query: 141 ---IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
              IV    WFGGG DLTP      + +D D   FH T K  C  H    Y  YK  CD 
Sbjct: 114 EGNIVD--QWFGGGQDLTPY-----YLFDEDATHFHQTCKTACDAHDADFYPKYKARCDE 166

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFY  HR E RGIGG+FFD+  ++ E    D  ++F++ VGD F++ Y  +V R     F
Sbjct: 167 YFYNAHRNEGRGIGGLFFDYCKATEERSMQDW-YNFVTTVGDSFLEAYAPIVERRKDTAF 225

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +++ +  Q +RRGRY EFNL++DKGT FG KT G +ESIL S+PP+V W
Sbjct: 226 AKEQKDWQEVRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPVVQW 274


>gi|330860529|emb|CBX70831.1| coproporphyrinogen-III oxidase, aerobic [Yersinia enterocolitica
           W22703]
          Length = 275

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 144/250 (57%), Gaps = 18/250 (7%)

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
           +E+ GGGR   +  G VFE+A V  S V G   P              F A G+S+++HP
Sbjct: 2   REEGGGGRSRVMVKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHP 61

Query: 127 YNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
            +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T   +C
Sbjct: 62  NSPYLPTSHANVRFFIAEKPDEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLC 116

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS----SPEMGGIDADFSFISA 236
                  YT YK+WCD YFY+ HR E+RGIGG+FFD L+S    SP+    D  F+F  A
Sbjct: 117 QPFDEQLYTRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSDDLNSPD---FDTCFNFTQA 173

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VGD F+  Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESI
Sbjct: 174 VGDGFLDAYMPIVARRKALCWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESI 233

Query: 297 LASMPPLVAW 306
           L SMPPLV W
Sbjct: 234 LMSMPPLVRW 243


>gi|194477076|ref|YP_002049255.1| coproporphyrinogen III oxidase [Paulinella chromatophora]
 gi|171192083|gb|ACB43045.1| coproporphyrinogen III oxidase [Paulinella chromatophora]
          Length = 342

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/318 (36%), Positives = 159/318 (50%), Gaps = 43/318 (13%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P  I  R+R+ +    NLQ  IC   E  + +A           F  + W R +      
Sbjct: 4   PPSINSRQRV-KALLMNLQDTICKGLETADGKA----------FFQEETWERSEG----- 47

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGGR   +  G +FE+  V  S V GD  P          K   ++ATG S+++HP NP+
Sbjct: 48  GGGRSRVIQNGGIFEQGGVNFSEVEGDQLPPSILNQRPEAKGQRWYATGTSMVLHPRNPY 107

Query: 131 VPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           +P VH N R    G  +WFGGG DLTP      + +  D   FH+TLK  C       Y 
Sbjct: 108 IPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFLEDAQHFHSTLKNACDNRNPNYYK 162

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD------------- 230
            +K WCD YFYLPHR E+RG+GGIF+D+      L+      G+ +              
Sbjct: 163 VFKPWCDEYFYLPHRGETRGVGGIFYDYQDPSGLLYKGQNPNGLASVASQQLGVQTHNWE 222

Query: 231 --FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F    A G+ F+  Y  ++ +  H  + +++RQ QL RRGRY EFNL++D+GT FG +
Sbjct: 223 DLFQLTQACGNAFLPSYVPIISKRNHFSYGDRERQFQLYRRGRYVEFNLVFDRGTIFGLQ 282

Query: 289 TGGNVESILASMPPLVAW 306
           T G  ESIL SMPPLV W
Sbjct: 283 TNGRTESILMSMPPLVRW 300


>gi|134301962|ref|YP_001121931.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|254800275|sp|A4IY09|HEM6_FRATW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|134049739|gb|ABO46810.1| coproporphyrinogen III oxidase, aerobic [Francisella tularensis
           subsp. tularensis WY96-3418]
          Length = 308

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|119503590|ref|ZP_01625673.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
 gi|119460652|gb|EAW41744.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
          Length = 308

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 150/291 (51%), Gaps = 30/291 (10%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           ++   +LQ  IC     ++              F  + W R +      GGG    L  G
Sbjct: 7   EQYLRSLQKSICDRLTTIDGSGS----------FEEETWDRPEG-----GGGVSRVLAEG 51

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            VFEKA V  S V G+  P     +        F A G+S+++HP+NP+VP  H N+R+ 
Sbjct: 52  AVFEKAGVNFSHVRGESLPGSATAVRPQLAGRSFQAMGVSLVIHPHNPYVPTAHANVRLF 111

Query: 142 VTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           V         +W GGG DLTP      + +  D + +H T    C  +    Y  YK WC
Sbjct: 112 VAEQPGKEPIWWMGGGFDLTPY-----YGFFDDAVHWHQTAAAACEPYGPEVYPKYKAWC 166

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+L HR E RG+GG+FFD L+      G D  FSF+  VGD F++ Y  +V R    
Sbjct: 167 DEYFHLKHRNEPRGVGGLFFDDLNEW----GFDKTFSFMRNVGDHFLEGYVPIVERRKDE 222

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++RQ QL RRGRY EFNL+YD+GT FG ++ G  ESIL S+PPLV W
Sbjct: 223 FWGERERQWQLYRRGRYVEFNLVYDRGTLFGLQSNGRTESILMSLPPLVRW 273


>gi|257485579|ref|ZP_05639620.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289627015|ref|ZP_06459969.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289647921|ref|ZP_06479264.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298484633|ref|ZP_07002737.1| Coproporphyrinogen III oxidase, aerobic [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160857|gb|EFI01874.1| Coproporphyrinogen III oxidase, aerobic [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326687|gb|EFW82732.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331339|gb|EFW87282.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330867906|gb|EGH02615.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330985716|gb|EGH83819.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331011867|gb|EGH91923.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 304

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVIENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|209517573|ref|ZP_03266412.1| Coproporphyrinogen oxidase [Burkholderia sp. H160]
 gi|209501986|gb|EEA02003.1| Coproporphyrinogen oxidase [Burkholderia sp. H160]
          Length = 307

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 141/258 (54%), Gaps = 16/258 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W R+  +K   GGG    L  G+ FE+A +  S V GD  P              
Sbjct: 34  FATDAWQREPGEKLR-GGGVTRILEGGQFFERAGIGFSDVAGDALPGSASAARPQLAGRG 92

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S+++HP+NPH P VH N+R++V         +WFGGG+DLTP      + Y+ D
Sbjct: 93  FEAMGVSLVLHPHNPHCPTVHMNVRLLVATKEGEEPVFWFGGGMDLTPY-----YGYEED 147

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
              FH   ++  + +    Y  +K WCD YF+L HR E RGIGGIFFD         G D
Sbjct: 148 ARHFHQVCRDALAPYGADLYPRFKRWCDEYFFLKHRNEPRGIGGIFFDDFSEL----GFD 203

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+ + +VG+ F+K Y  ++ R  +  + E +R  Q  RRGRY EFNL +D+GT FG +
Sbjct: 204 ESFAMLKSVGEGFLKAYLPIIERRRNTSYGEAERAFQAYRRGRYVEFNLAFDRGTLFGLQ 263

Query: 289 TGGNVESILASMPPLVAW 306
           +GG  ESIL SMPP+V W
Sbjct: 264 SGGRTESILMSMPPVVNW 281


>gi|312958126|ref|ZP_07772649.1| Coproporphyrinogen-3 oxidase [Pseudomonas fluorescens WH6]
 gi|311287557|gb|EFQ66115.1| Coproporphyrinogen-3 oxidase [Pseudomonas fluorescens WH6]
          Length = 310

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  E +            FT   W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICSALETFETDTR----------FTEDAWTRPAG-----GGGRTRVIANGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  D D I +H   ++ C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGNDEDCIHWHRVAEQACAPFGPDVYARYKAWCDTYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R     ++ Q
Sbjct: 174 IKHRNEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKATAYTAQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|71281546|ref|YP_270654.1| coproporphyrinogen III oxidase [Colwellia psychrerythraea 34H]
 gi|71147286|gb|AAZ27759.1| coproporphyrinogen III oxidase, aerobic [Colwellia psychrerythraea
           34H]
          Length = 312

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 149/288 (51%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F++LQ  IC   E+ +              F   +W R +      GGGR   +  G V 
Sbjct: 20  FKSLQDKICQALEEADGTGK----------FVEDNWKRKEG-----GGGRTRVMTDGTVV 64

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S V GD  P              + A G+S+++HP NP++P  H N+R  +  
Sbjct: 65  EQGGVNFSVVSGDKLPPSATAHRPELAGRTWQACGVSLVIHPKNPNIPTSHANVRFFIAE 124

Query: 145 ------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      +  D D+  +H T  ++C       Y  +K+WCD Y
Sbjct: 125 KEGEKPVWWFGGGFDLTPF-----YPNDEDIQHWHQTAHDLCQPFGDNVYNDHKKWCDEY 179

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D  F ++ AVG  FI  Y  +++R     F 
Sbjct: 180 FYLKHRDETRGVGGLFFDDLNQWD----FDTCFDYVKAVGQGFIDAYVPIMQRRKDEAFG 235

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EQ+RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 236 EQERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 283


>gi|220933307|ref|YP_002512206.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800278|sp|B8GTF9|HEM6_THISH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|219994617|gb|ACL71219.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 304

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 141/250 (56%), Gaps = 15/250 (6%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D   +E+ GGGR   L  G VFE+A +  S V G   P              F ATG+S+
Sbjct: 37  DSWTREEGGGGRSRVLTEGAVFEQAGINFSHVTGASLPPSATAHRPELAGRRFQATGVSL 96

Query: 123 IVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+VP  H N+R  +    GA   +WFGGG DLTP      +  D D + +H   
Sbjct: 97  VIHPRNPYVPTSHANVRFFIAEKEGAEPIWWFGGGFDLTPY-----YGEDEDCVHWHRVA 151

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           K  C       Y  YK+WCD YF+L HR E RG+GG+FFD L+      G +  F+F+ +
Sbjct: 152 KAACEPFGPEVYPRYKQWCDEYFFLRHRNEPRGVGGLFFDDLNEW----GFEKSFAFMRS 207

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VGD ++  Y  +V R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESI
Sbjct: 208 VGDHYLDAYLPIVARRKDTPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESI 267

Query: 297 LASMPPLVAW 306
           L S+PPLV W
Sbjct: 268 LMSLPPLVRW 277


>gi|330806733|ref|YP_004351195.1| coproporphyrinogen oxidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374841|gb|AEA66191.1| Coproporphyrinogen oxidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 304

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 148/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E       E+   R    F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALET------EDGGTR----FVEDAWTRPAG-----GGGRTRVIENGTVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   ++ C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAEQACAPFGPEVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+FI A+GD +I  Y  +VRR  H  F+ +
Sbjct: 174 LKHRNEPRGIGGLFFDDLNAW----DFDTCFAFIRAIGDAYIDAYLPIVRRRKHDAFTAK 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|242807645|ref|XP_002484998.1| coproporphyrinogen III oxidase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218715623|gb|EED15045.1| coproporphyrinogen III oxidase, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 441

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 164/330 (49%), Gaps = 40/330 (12%)

Query: 7   EIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKI----FTVKHWLR 62
           E   P   E  K + ++      S +    EKL  E  +   +   +I    F    W R
Sbjct: 77  ETEAPSIAEIDKALKEKSPVTDDSPMRLRMEKLIKEHQKKITDELSRIDGKPFQADTWTR 136

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLS--------PDFKDQILGTTKNPY 114
                   GGG    L  G VFEKA V VS VYG+L          D K  +     +  
Sbjct: 137 PNG-----GGGISCVLQDGNVFEKAGVNVSVVYGELPRPAIEKMRADHKSFVGANVDSLS 191

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG----------AYWFGGGIDLTPSLESRRHS 164
           F+A GLS+++HP+NPH P VH N R   T            +WFGGG DLTPS     + 
Sbjct: 192 FFAAGLSLVLHPHNPHAPTVHLNYRYFETSDPKDPVNGDKNWWFGGGTDLTPS-----YL 246

Query: 165 YDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS---- 220
           Y  D   FH T+K++C +H    Y  +K WCD+YFYLPHR E+RGIGGIFFD L +    
Sbjct: 247 YPEDCKHFHQTIKDVCDRHDSTYYPRFKTWCDKYFYLPHRNEARGIGGIFFDDLDAHFLQ 306

Query: 221 ---SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNL 277
              S      +  FSF+S     F+  Y  ++ R     F+ + ++ Q +RRGRY EFNL
Sbjct: 307 SSSSSSQNPQETLFSFVSDALGSFLPSYVPILERRKDTPFTPEQKEWQQLRRGRYVEFNL 366

Query: 278 LYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           +YD+GT+FG +T    VESIL S+P   +W
Sbjct: 367 VYDRGTSFGLRTPNARVESILMSLPRTASW 396


>gi|325923783|ref|ZP_08185398.1| coproporphyrinogen oxidase [Xanthomonas gardneri ATCC 19865]
 gi|325545716|gb|EGD16955.1| coproporphyrinogen oxidase [Xanthomonas gardneri ATCC 19865]
          Length = 299

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 148/286 (51%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E ++  A           F    W     Q+E+ GGGR   L  G VFE+
Sbjct: 13  GLQDRICAAVEAIDGSAR----------FAEDLW-----QREEGGGGRTRILRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + A G+S++ HP+NPH+P  H N+R       
Sbjct: 58  AGIGFSDVSGSRLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANVRYFRAERD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      +  D DV+ +H T + +C+      Y   K WCD YF+
Sbjct: 118 GDVVAAWFGGGFDLTPF-----YPVDEDVLHWHRTAQALCAPFGEERYAAQKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R     + E+
Sbjct: 173 LRHRNETRGVGGLFFDDLDKD-----FERDFAYQRAVGDGFLDAYLPIVERRKDTPYGER 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|312886821|ref|ZP_07746427.1| Coproporphyrinogen oxidase [Mucilaginibacter paludis DSM 18603]
 gi|311300648|gb|EFQ77711.1| Coproporphyrinogen oxidase [Mucilaginibacter paludis DSM 18603]
          Length = 303

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 157/292 (53%), Gaps = 31/292 (10%)

Query: 23  RKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGK 82
           R+++ +Q  IC   E L+ +A          +F  + W RD          R   +  G 
Sbjct: 9   RQYQQIQDEICAGLEGLDGKA----------VFIEERWERDGGGGG-----RSRVIQNGN 53

Query: 83  VFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV 142
           + EK  V  S V G L PD     L   ++ +F ATG+S+++HP +P VP +H NIR   
Sbjct: 54  ILEKGGVNFSAVEG-LLPDTIKNALKVDQHDFF-ATGVSIVIHPNHPMVPIIHMNIRYFE 111

Query: 143 TGAY--------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
             +         WFGGGIDLTP      +  + DV FFH  LK +C Q+    Y  +K+W
Sbjct: 112 MPSTDKDKPPVRWFGGGIDLTP-----HYVIEDDVRFFHGVLKSVCDQYGADFYNRFKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
            D YFY+ HR E+RG+GGIF+D + ++  +   D  F F  A+G  F+ +Y  LV RN +
Sbjct: 167 ADDYFYIKHRNETRGVGGIFYDRITATDNLSWDDI-FEFSKALGRSFLPVYTELVNRNRN 225

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             ++E  ++ Q  RR RYAEFNL+YD GT FG +T G +ESIL S+PP   W
Sbjct: 226 KEYTEAHQEWQYQRRSRYAEFNLVYDAGTKFGLETNGRIESILMSLPPQARW 277


>gi|328855845|gb|EGG04969.1| hypothetical protein MELLADRAFT_88438 [Melampsora larici-populina
           98AG31]
          Length = 315

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 156/304 (51%), Gaps = 49/304 (16%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           E LQ  I    E L+              F   HWLR+       G G    L  G VFE
Sbjct: 10  EGLQKDIVQALEALDPSTS----------FHWDHWLREAG-----GSGTSCVLQDGSVFE 54

Query: 86  KAAVLVSTVYGDLSPDFKDQIL------------GTTKNPYFWATGLSVIVHPYNPHVPA 133
           KA V VS V+G L P    Q+             GTT+ P+F A GLS++VHP NP  P 
Sbjct: 55  KAGVNVSVVHGKLPPAAVRQMRARIDEDRFGWWDGTTELPFF-ACGLSLVVHPVNPMAPT 113

Query: 134 VHFNIRMI----------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           VH N R            +    WFGGG DLTPS     + ++ D I FH TLK+ C +H
Sbjct: 114 VHLNYRYFEIDDPKEPEGIPKVSWFGGGTDLTPS-----YLFESDAIHFHRTLKDACDEH 168

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
             + Y  +KEWCD YFY+PHR E RG+GGIFFD L      G ++  F F+  +G+ F+ 
Sbjct: 169 DKSYYPCFKEWCDDYFYIPHRGERRGVGGIFFDDLG-----GDMEKLFDFVRGLGNSFLP 223

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPP 302
            Y  ++ +     +S+  ++ Q +RRGRY EFNL++D+GT FG  T G  VESIL S+P 
Sbjct: 224 AYMPIIEQRQWMRYSDHQKRWQQLRRGRYVEFNLVHDRGTKFGLATPGARVESILMSLPL 283

Query: 303 LVAW 306
              W
Sbjct: 284 TSRW 287


>gi|115314806|ref|YP_763529.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|122325178|sp|Q0BLZ2|HEM6_FRATO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|115129705|gb|ABI82892.1| coproporphyrinogen oxidase [Francisella tularensis subsp.
           holarctica OSU18]
          Length = 308

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRNEYRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|167031110|ref|YP_001666341.1| coproporphyrinogen III oxidase [Pseudomonas putida GB-1]
 gi|189028102|sp|B0KF35|HEM6_PSEPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166857598|gb|ABY96005.1| Coproporphyrinogen oxidase [Pseudomonas putida GB-1]
          Length = 303

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  GKV EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVREAG-----GGGRTRVIGDGKVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+FI A+GD ++  Y  +V+R     ++ Q
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEWD----FDTCFAFIRAIGDAYVNAYLPIVQRRKDTPYTPQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|254369334|ref|ZP_04985346.1| coproporphyinogen III oxidase [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122284|gb|EDO66424.1| coproporphyinogen III oxidase [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFITQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDEYRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|54114191|gb|AAV29729.1| NT02FT1461 [synthetic construct]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 157/294 (53%), Gaps = 22/294 (7%)

Query: 22  QRKFENLQSIICTEFEKLEN--EAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           Q K  N +  +    + +    E HE +A +    F    W +  +  + L G G    +
Sbjct: 2   QEKISNFEDFLTQLQQNITTALEQHETNAAK----FISDKWQKPDTHDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPIATW 282


>gi|326800750|ref|YP_004318569.1| coproporphyrinogen oxidase [Sphingobacterium sp. 21]
 gi|326551514|gb|ADZ79899.1| Coproporphyrinogen oxidase [Sphingobacterium sp. 21]
          Length = 301

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 151/285 (52%), Gaps = 26/285 (9%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           ++ +Q  IC   E+ + +A           F  + W R     E  GGGR   +  G V 
Sbjct: 11  YQQIQDTICKGLEEADGKA----------FFEEERWTR-----EGGGGGRTRIIQDGNVI 55

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM--IV 142
           E+  V  S V+G L    K       +   F+ATG+S+++HP NP VP +H NIR   + 
Sbjct: 56  ERGGVNFSAVHGKLPEKIKAAF--DVQEDDFFATGVSIVIHPKNPWVPIIHMNIRYFELN 113

Query: 143 TGAYWFGGGIDLTPSLESRRHSYDP-DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               WFGGGIDLTP      H   P D  FFH  LK++C Q     Y  +K+W D YF++
Sbjct: 114 EQTRWFGGGIDLTP------HYVIPEDAAFFHKRLKDICDQFQTDFYARFKKWADDYFFI 167

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RGIGGIF+D L         D  F F   +G+ F+ +Y  L++RN +  F+  +
Sbjct: 168 KHRNETRGIGGIFYDRLQPDNSKLSYDQLFEFSKRLGEGFVPIYAELIKRNQNKAFTPNE 227

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  Q IRR RY EFNL+YD GT FG +T G +ESIL S+PP   W
Sbjct: 228 KDWQFIRRSRYVEFNLVYDSGTKFGLETNGRIESILMSLPPQANW 272


>gi|296160584|ref|ZP_06843399.1| Coproporphyrinogen oxidase [Burkholderia sp. Ch1-1]
 gi|295889110|gb|EFG68913.1| Coproporphyrinogen oxidase [Burkholderia sp. Ch1-1]
          Length = 307

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 143/258 (55%), Gaps = 16/258 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W R   +K   GGG    L  G  FE+A +  S V GD  P              
Sbjct: 34  FATDAWQRAPGEKLR-GGGYTRILEGGNFFERAGIGFSDVAGDALPASASAARPQLAGRG 92

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S+++HP+NPH P VH N+R+++         +WFGGG+DLTP      + Y+ D
Sbjct: 93  FEAMGVSLVLHPHNPHCPTVHMNVRLLIATKAGEEPVFWFGGGMDLTPF-----YGYEED 147

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
              FH T ++    +    Y  +K WCD YF+L HR E RGIGGIFFD   S+P   G D
Sbjct: 148 AQHFHRTCRDALQPYGADLYPSFKRWCDEYFFLKHRNEPRGIGGIFFDDF-SAP---GFD 203

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+ + +VGD F+K Y  ++ +  +  + + +R  Q  RRGRY EFNL++D+GT FG +
Sbjct: 204 QSFAMLRSVGDAFLKAYLPIIEKRRNIPYGQAERDFQAYRRGRYVEFNLVFDRGTLFGLQ 263

Query: 289 TGGNVESILASMPPLVAW 306
           +GG  ESIL SMPP+V W
Sbjct: 264 SGGRTESILMSMPPVVNW 281


>gi|254370632|ref|ZP_04986637.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151568875|gb|EDN34529.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           tularensis FSC033]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTHDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLNHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPIATW 282


>gi|298491452|ref|YP_003721629.1| Coproporphyrinogen oxidase ['Nostoc azollae' 0708]
 gi|298233370|gb|ADI64506.1| Coproporphyrinogen oxidase ['Nostoc azollae' 0708]
          Length = 348

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/274 (41%), Positives = 151/274 (55%), Gaps = 30/274 (10%)

Query: 57  VKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYF 115
           V  +  D  Q+ + GGGR   L  G +FE+A V  S V+G +L P    Q     K   F
Sbjct: 48  VGKFQEDSWQRPEGGGGRSRILRDGAIFEQAGVNFSEVWGSNLPPSILAQ-RPEAKGHGF 106

Query: 116 WATGLSVIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           +ATG S+++HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   FH 
Sbjct: 107 YATGTSLVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHQ 161

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGID 228
           TLK+ C QH    Y  +K WCD YFYL HR E+RGIGG+F D+      ++  P+  G  
Sbjct: 162 TLKQACDQHHSEYYPVFKRWCDEYFYLKHRDETRGIGGLFLDYQDGQGSIYRGPDPNGEA 221

Query: 229 ADFS-------------FISAVGDCFIKLYPS---LVRRNYHHLFSEQDRQEQLIRRGRY 272
           AD+S               + V DC   L P+   +V+R +   + + +R  QL RRGRY
Sbjct: 222 ADYSNQVGTIAPRTWEELFALVQDCGRALLPAYVPIVKRRHGIEYGDHERNFQLYRRGRY 281

Query: 273 AEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            EFNL+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 282 VEFNLVYDRGTIFGLQTNGRTESILMSLPPLVRW 315


>gi|91226312|ref|ZP_01261152.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
 gi|91189323|gb|EAS75602.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
          Length = 305

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + +A          +F    W R+  ++   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEQEDGKA----------VFVEDAWHREPGERLG-GGGRSRVMRDGLVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKD 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K +C+      Y  +K WCD+YF+
Sbjct: 124 GEDPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKLLCAPFGDDVYQEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F++I AVG+ + + Y  +V R     + E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNQWE----FDKCFAYIKAVGEGYCQAYLPIVSRRKEFKYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|89256361|ref|YP_513723.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica LVS]
 gi|167010444|ref|ZP_02275375.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367697|ref|ZP_04983718.1| coproporphyinogen III oxidase [Francisella tularensis subsp.
           holarctica 257]
 gi|122500740|sp|Q2A3H9|HEM6_FRATH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|89144192|emb|CAJ79461.1| Coproporphyinogen III oxidase [Francisella tularensis subsp.
           holarctica LVS]
 gi|134253508|gb|EBA52602.1| coproporphyinogen III oxidase [Francisella tularensis subsp.
           holarctica 257]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTALEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ + GA      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDEYRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|15802967|ref|NP_288997.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 EDL933]
 gi|12516817|gb|AAG57554.1|AE005474_2 coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           EDL933]
          Length = 299

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 155/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREGGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGKDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRKAXAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|15832561|ref|NP_311334.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           Sakai]
 gi|168748507|ref|ZP_02773529.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4113]
 gi|168756207|ref|ZP_02781214.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4401]
 gi|168761044|ref|ZP_02786051.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4501]
 gi|168768527|ref|ZP_02793534.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4486]
 gi|168773652|ref|ZP_02798659.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4196]
 gi|168778401|ref|ZP_02803408.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4076]
 gi|168787782|ref|ZP_02812789.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC869]
 gi|168798806|ref|ZP_02823813.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC508]
 gi|195936587|ref|ZP_03081969.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208809242|ref|ZP_03251579.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4206]
 gi|208814040|ref|ZP_03255369.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4045]
 gi|208819013|ref|ZP_03259333.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4042]
 gi|209395878|ref|YP_002271913.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4115]
 gi|217326825|ref|ZP_03442908.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. TW14588]
 gi|254794389|ref|YP_003079226.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223122|ref|ZP_05937403.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259325|ref|ZP_05951858.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|21362581|sp|Q8XBI4|HEM6_ECO57 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740876|sp|B5YZY1|HEM6_ECO5E RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|13362777|dbj|BAB36730.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187770584|gb|EDU34428.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4196]
 gi|188017108|gb|EDU55230.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4113]
 gi|189003195|gb|EDU72181.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4076]
 gi|189356604|gb|EDU75023.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4401]
 gi|189362170|gb|EDU80589.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4486]
 gi|189368463|gb|EDU86879.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4501]
 gi|189372256|gb|EDU90672.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC869]
 gi|189378668|gb|EDU97084.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC508]
 gi|208729043|gb|EDZ78644.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4206]
 gi|208735317|gb|EDZ84004.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4045]
 gi|208739136|gb|EDZ86818.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4042]
 gi|209157278|gb|ACI34711.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4115]
 gi|209764010|gb|ACI80317.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764012|gb|ACI80318.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764016|gb|ACI80320.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|217319192|gb|EEC27617.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. TW14588]
 gi|254593789|gb|ACT73150.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320188776|gb|EFW63435.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC1212]
 gi|326340239|gb|EGD64043.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. 1125]
 gi|326344924|gb|EGD68668.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. 1044]
          Length = 299

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 155/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREGGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGKDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|209919917|ref|YP_002294001.1| coproporphyrinogen III oxidase [Escherichia coli SE11]
 gi|226740881|sp|B6I512|HEM6_ECOSE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|209913176|dbj|BAG78250.1| coproporphyrinogen III oxidase [Escherichia coli SE11]
 gi|324020115|gb|EGB89334.1| coproporphyrinogen III oxidase [Escherichia coli MS 117-3]
          Length = 299

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREGGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYLRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L ++P+    D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDL-NTPD---FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|91782567|ref|YP_557773.1| coproporphyrinogen III oxidase [Burkholderia xenovorans LB400]
 gi|123358982|sp|Q142L8|HEM6_BURXL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91686521|gb|ABE29721.1| Coproporphyrinogen oxidase [Burkholderia xenovorans LB400]
          Length = 307

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 143/258 (55%), Gaps = 16/258 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W R   +K   GGG    L  G  FE+A +  S V GD  P              
Sbjct: 34  FATDAWQRAPGEKLR-GGGYTRILEGGNFFERAGIGFSDVAGDALPASASAARPQLAGRG 92

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S+++HP+NPH P VH N+R+++         +WFGGG+DLTP      + Y+ D
Sbjct: 93  FEAMGVSLVLHPHNPHCPTVHMNVRLLIATKAGEEPVFWFGGGMDLTPF-----YGYEED 147

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
              FH T ++    +    Y  +K WCD YF+L HR E RGIGGIFFD   S+P   G D
Sbjct: 148 AQHFHRTCRDALQPYGADLYPSFKRWCDEYFFLRHRNEPRGIGGIFFDDF-SAP---GFD 203

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+ + +VGD F+K Y  ++ +  +  + + +R  Q  RRGRY EFNL++D+GT FG +
Sbjct: 204 QSFAMLRSVGDAFLKAYLPIIEKRRNIPYGQAERDFQAYRRGRYVEFNLVFDRGTLFGLQ 263

Query: 289 TGGNVESILASMPPLVAW 306
           +GG  ESIL SMPP+V W
Sbjct: 264 SGGRTESILMSMPPVVNW 281


>gi|28899808|ref|NP_799413.1| coproporphyrinogen III oxidase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153837672|ref|ZP_01990339.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ3810]
 gi|260362027|ref|ZP_05775032.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           K5030]
 gi|260876486|ref|ZP_05888841.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AN-5034]
 gi|260897457|ref|ZP_05905953.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           Peru-466]
 gi|260901348|ref|ZP_05909743.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ4037]
 gi|31340151|sp|Q87KE3|HEM6_VIBPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|28808060|dbj|BAC61297.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149748962|gb|EDM59789.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ3810]
 gi|308087909|gb|EFO37604.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           Peru-466]
 gi|308090350|gb|EFO40045.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AN-5034]
 gi|308109895|gb|EFO47435.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ4037]
 gi|308114126|gb|EFO51666.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           K5030]
 gi|328471158|gb|EGF42060.1| coproporphyrinogen III oxidase [Vibrio parahaemolyticus 10329]
          Length = 305

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 155/286 (54%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E+ + +A          +F    W R+  ++   GGGR   L  G VFE+
Sbjct: 15  SLQDSICQQLEQEDGKA----------VFVEDAWHREPGERLG-GGGRSRVLRDGLVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H+T K +C+      Y  +K WCD+YF+
Sbjct: 124 GEEPIWWFGGGFDLTPF-----YPFEEDCQSWHDTAKAICAPFGEDVYAEHKAWCDKYFF 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V R     + E+
Sbjct: 179 LPHRNETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIVSRRKDIEYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|291283664|ref|YP_003500482.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O55:H7
           str. CB9615]
 gi|209764008|gb|ACI80316.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764014|gb|ACI80319.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|290763537|gb|ADD57498.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O55:H7
           str. CB9615]
 gi|320640949|gb|EFX10433.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           G5101]
 gi|320646230|gb|EFX15157.1| coproporphyrinogen III oxidase [Escherichia coli O157:H- str.
           493-89]
 gi|320651736|gb|EFX20116.1| coproporphyrinogen III oxidase [Escherichia coli O157:H- str. H
           2687]
 gi|320657121|gb|EFX24930.1| coproporphyrinogen III oxidase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662880|gb|EFX30208.1| coproporphyrinogen III oxidase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667767|gb|EFX34678.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 299

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 155/286 (54%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  IC +   ++                   ++ D  Q+E  GGGR   L  G VFE+
Sbjct: 14  NLQDTICQQLTAVDG----------------AEFVEDSWQREGGGGGRSRVLRNGGVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R  +    
Sbjct: 58  AGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVRFFIAEKP 117

Query: 144 GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
           GA   +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+WCD YFY
Sbjct: 118 GAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFY 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R     + E+
Sbjct: 173 LKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGER 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 229 ERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|255532056|ref|YP_003092428.1| coproporphyrinogen III oxidase [Pedobacter heparinus DSM 2366]
 gi|255345040|gb|ACU04366.1| Coproporphyrinogen oxidase [Pedobacter heparinus DSM 2366]
          Length = 298

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 107/230 (46%), Positives = 138/230 (60%), Gaps = 13/230 (5%)

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G V EK  V  S V+G L    K       +N  F+ATG+S+++HP NPHVP +H NIR 
Sbjct: 52  GNVIEKGGVNFSAVHGKLPDAVKKAF--KVENDDFFATGVSIVMHPSNPHVPIIHMNIRY 109

Query: 141 --IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
             +     WFGGGIDLTP      +  D DV FFH+ LK+ C     A YT +KE  D Y
Sbjct: 110 FEMDEQTRWFGGGIDLTP-----HYLIDTDVRFFHHLLKQTCDLFDPAFYTKFKENADDY 164

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD--FSFISAVGDCFIKLYPSLVRRNYHHL 256
           F++ HR+E+RG+GGIF+D L   PE  G+  D    F  AVG+ FI  Y  L+ RN    
Sbjct: 165 FFIKHREETRGVGGIFYDRL--KPENTGLTFDQLLDFSIAVGNTFIPAYTELIERNRDKE 222

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           F+ Q ++ Q +RR RYAEFNL+YD GT FG +T G +ESIL S+PP+  W
Sbjct: 223 FTAQQQEWQYLRRSRYAEFNLVYDAGTKFGLETNGRIESILMSLPPMAKW 272


>gi|170719279|ref|YP_001746967.1| coproporphyrinogen III oxidase [Pseudomonas putida W619]
 gi|226740889|sp|B1J4A2|HEM6_PSEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|169757282|gb|ACA70598.1| Coproporphyrinogen oxidase [Pseudomonas putida W619]
          Length = 303

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 150/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+R+       GGGR   +  GK+ EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVREAG-----GGGRTRVIGDGKLIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E RGIGG+FFD L+      G D  F+FI A+GD ++  Y  +V+R     ++ +
Sbjct: 174 IKHRGEPRGIGGLFFDDLNEW----GFDTCFAFIRAIGDAYVDAYLPIVQRRKDTPYTAE 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|161502397|ref|YP_001569509.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189028104|sp|A9MID0|HEM6_SALAR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|160863744|gb|ABX20367.1| hypothetical protein SARI_00431 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 299

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 154/258 (59%), Gaps = 23/258 (8%)

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPD----FKDQILGTTKNPY 114
           +++ D  ++E  GGGR   L  G +FE+A V  S V GD  P      + +++G +    
Sbjct: 30  NFIEDSWRREAGGGGRSRVLRNGGIFEQAGVNFSHVNGDAMPASATAHRPELVGRS---- 85

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S++VHP NP++P  H N+R  +    GA   +WFGGG DLTP      + ++ D
Sbjct: 86  FEAMGVSLVVHPRNPYIPTSHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEED 140

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
            + +H T +++C       Y  YK+WCD YF++ HR E RGIGG+FFD L++ P+     
Sbjct: 141 AVHWHRTARDLCQPFGEDVYPRYKKWCDDYFFIKHRNEQRGIGGLFFDDLNT-PDFASC- 198

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+F+ AVG  + + Y  +V R     + E++R  QL RRGRY EFNL++D+GT FG +
Sbjct: 199 --FAFMQAVGKGYTEAYLPIVERRKTMAWGERERSFQLYRRGRYVEFNLVWDRGTLFGLQ 256

Query: 289 TGGNVESILASMPPLVAW 306
           TGG  ESIL SMPPLV W
Sbjct: 257 TGGRTESILMSMPPLVRW 274


>gi|86133874|ref|ZP_01052456.1| Coproporphyrinogen III oxidase [Polaribacter sp. MED152]
 gi|85820737|gb|EAQ41884.1| Coproporphyrinogen III oxidase [Polaribacter sp. MED152]
          Length = 300

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 160/288 (55%), Gaps = 30/288 (10%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           ENLQ  I ++ E+++  A           F    W R +      GGGR   +  G VFE
Sbjct: 10  ENLQDSITSKLEEVDGSAK----------FKEDLWDRKEG-----GGGRTRVIENGAVFE 54

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI---- 141
           K  V +S V+G+L    ++Q     K   F+A GLS+++HP NP VP VH N R      
Sbjct: 55  KGGVNISAVHGELPEVLRNQF--KVKEGNFFACGLSLVLHPKNPFVPTVHANWRYFEMYN 112

Query: 142 VTG---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
            TG     WFGGG DLTP      + +D D   FHN  K  C +H    Y  +K+ CD Y
Sbjct: 113 STGDIVTQWFGGGQDLTPY-----YLFDEDATHFHNVCKNACDKHHSEFYPKFKKTCDEY 167

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F+  HR E+RGIGG+FFD+L  + E   I+  ++F++ +GD F+  Y  +V +  +  ++
Sbjct: 168 FWNTHRNEARGIGGLFFDYLKHT-EQFTIEDRYNFVTEIGDSFLDSYVPIVEKRKNSTYT 226

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  Q +RRGRY EFNL++D+GT FG KT G +ESIL S+PP+V W
Sbjct: 227 QDHKDWQEVRRGRYVEFNLVHDRGTLFGLKTNGRIESILMSLPPVVQW 274


>gi|238764739|ref|ZP_04625682.1| Coproporphyrinogen III oxidase [Yersinia kristensenii ATCC 33638]
 gi|238697030|gb|EEP89804.1| Coproporphyrinogen III oxidase [Yersinia kristensenii ATCC 33638]
          Length = 308

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC    + + +A           FT ++W+R     E+ GGGR   L  G VFE+
Sbjct: 15  DLQDNICAALAQADGKAE----------FTEENWVR-----EEGGGGRSRVLVKGAVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP +P++P  H N+R  +    
Sbjct: 60  AGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYLPTSHANVRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D I +H T   +C       Y  YK+WCD YFY
Sbjct: 120 GENPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCHPFGEQIYPRYKKWCDDYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E+RGIGG+FFD L +SP+       F+F  AVG+ F+  Y  +V R     + E+
Sbjct: 175 IKHRNEARGIGGLFFDDL-NSPDFATC---FNFTQAVGNGFLDAYMPIVARRRALSWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 231 EREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|328777038|ref|XP_003249262.1| PREDICTED: coproporphyrinogen-III oxidase-like [Apis mellifera]
          Length = 386

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 122/313 (38%), Positives = 160/313 (51%), Gaps = 42/313 (13%)

Query: 12  DDIEERKRISQRKFENL-----QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQ 66
           D  E RKR   RK   L     Q+  C   E LE+  H          F V  W+R +  
Sbjct: 71  DVKELRKRQDMRKKMELLVMTTQADFCKALESLEDPNHR---------FKVDRWIRKEG- 120

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN------PYFWATGL 120
               GGG    L  G VFEKA V VS V G L P    Q+    KN      P+F A G+
Sbjct: 121 ----GGGITCVLQDGVVFEKAGVNVSVVTGTLPPGAVQQMRARGKNMQEGSVPFF-AAGV 175

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S ++HP NP +P +HFN R            +WFGGG DLTP      +  + D+  FH 
Sbjct: 176 SAVIHPRNPMIPTIHFNYRYFEVENSDGSIQWWFGGGTDLTPY-----YLNEDDIKQFHK 230

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           TLK  C +H ++ Y  YK+WCD YF++ HR E RG+GGIFFD + +  +    +  F F+
Sbjct: 231 TLKIACDKHDLSFYPKYKKWCDDYFFITHRGERRGVGGIFFDDIDTPSQ----EEAFQFV 286

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNV 293
            +  +  I  Y  LV ++ +  +   +RQ QL+RRGRY EFNL+YD+GT FG  T G   
Sbjct: 287 KSCAEAVIPSYIPLVEKHKNDRYGYAERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARY 346

Query: 294 ESILASMPPLVAW 306
           ESIL S+P    W
Sbjct: 347 ESILMSLPLSAKW 359


>gi|229587601|ref|YP_002869720.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens SBW25]
 gi|259709756|sp|C3K4I0|HEM6_PSEFS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|229359467|emb|CAY46308.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas fluorescens
           SBW25]
          Length = 310

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 147/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  E +            F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICSALETFETDTR----------FIEDAWTRPAG-----GGGRTRVIENGSVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D I +H   ++ C+      Y+ YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGNEEDCIHWHRVAEQACAPFGPDVYSRYKAWCDTYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           + HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R     ++EQ
Sbjct: 174 IKHRNEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYIDAYLPIVQRRKAMAYTEQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            RQ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QRQFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|284006779|emb|CBA72044.1| Coproporphyrinogen III oxidase, aerobic [Arsenophonus nasoniae]
          Length = 302

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 154/285 (54%), Gaps = 30/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  +C + E ++N A           F  + W     Q +  GGGR   L  G +FE+A
Sbjct: 16  LQDKLCQQLEHVDNNAK----------FAEQSW-----QHKHKGGGRSRILKHGTIFEQA 60

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V  S + G   P    +         + A G+S++ HP NP++P  H N+R  +     
Sbjct: 61  GVNFSHISGKQLPASASENRPLLAGRRYQAMGVSLVTHPLNPYIPTAHANVRFFIAEKPG 120

Query: 144 --GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
               +WFGGG DLTP      + ++ D+I +H T + +C  +    Y HYK+WCDRYF++
Sbjct: 121 EPSIWWFGGGFDLTPY-----YGFEEDIIHWHKTAQSVCLPYGKEIYPHYKKWCDRYFFI 175

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E RG+GG+FFD L + P+       F F   VG+ F+  Y  +V +     + E++
Sbjct: 176 EHRNEPRGVGGLFFDDL-NQPDF---TTCFHFAQDVGNGFLNAYLPIVEKRKEIAWGERE 231

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RQ QL RRGRYAEFNL+ D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 232 RQFQLYRRGRYAEFNLVCDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|300866327|ref|ZP_07111030.1| coproporphyrinogen III oxidase [Oscillatoria sp. PCC 6506]
 gi|300335670|emb|CBN56190.1| coproporphyrinogen III oxidase [Oscillatoria sp. PCC 6506]
          Length = 316

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 114/304 (37%), Positives = 153/304 (50%), Gaps = 43/304 (14%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           + +Q  IC   E L+              F  + W R +      GGGR   +  G VFE
Sbjct: 2   QGIQDEICQGLEALDGIGK----------FKEESWERPEG-----GGGRSRVMTQGDVFE 46

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG- 144
           +  V  S V+G+  P              F+ATG S+++HP NP++P VH N R    G 
Sbjct: 47  QGGVNFSEVWGETLPPSILHQYPELAGKGFYATGTSMVLHPRNPYIPTVHLNYRYFEAGH 106

Query: 145 AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHR 204
            +WFGGG DLTP      + +  D   FH TLK  C +H    Y  +K WCD YFYL HR
Sbjct: 107 VWWFGGGADLTPY-----YPFAEDAAHFHQTLKAACDRHHPEYYPTFKLWCDEYFYLKHR 161

Query: 205 QESRGIGGIFFDH------LHSSPEMGGIDAD----------------FSFISAVGDCFI 242
           QE+RG+GG+FFD+      L+  P+  G  A+                F+F+   G  F+
Sbjct: 162 QETRGVGGLFFDYQDGQTQLYRGPDPKGPAANYSNQIGIPEPRSWEDLFAFVQECGRAFL 221

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T G  ESIL S+PP
Sbjct: 222 PAYSPIVERRRSMEYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLPP 281

Query: 303 LVAW 306
           LV W
Sbjct: 282 LVRW 285


>gi|226327998|ref|ZP_03803516.1| hypothetical protein PROPEN_01889 [Proteus penneri ATCC 35198]
 gi|225203702|gb|EEG86056.1| hypothetical protein PROPEN_01889 [Proteus penneri ATCC 35198]
          Length = 302

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 155/286 (54%), Gaps = 30/286 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F +LQ  IC   E ++ +                 + +D  ++++ GGGR   L  G +F
Sbjct: 13  FLSLQDTICHSLENIDQKGT---------------FQQDTWERKEGGGGRTRVLTNGALF 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R  +  
Sbjct: 58  EQAGVNFSHVYGDTLPKSATAHRPELAGRRFQAMGVSLVIHPINPYIPTSHANVRFFIAE 117

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ DVI +H   K +C+  +   Y  YK+WCD Y
Sbjct: 118 KEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCTPFSEDYYPRYKKWCDDY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FY+ HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +     + 
Sbjct: 173 FYIKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGLGYLDAYLPIVEKRKSMHWG 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV
Sbjct: 229 ERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLV 274


>gi|327493891|gb|AEA86532.1| coproporphyrinogen oxidase [Euglena gracilis]
          Length = 276

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 157/287 (54%), Gaps = 26/287 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ IC   E L+          S K F +  W RD +     G G    L  G + EK
Sbjct: 6   DLQTAICAAVEALDG---------SGKKFCIDRWERDPTNPS-AGYGITRVLEGGDLIEK 55

Query: 87  AAVLVSTVYGDLSPDFKDQI--LGTTKNPY----FWATGLSVIVHPYNPHVPAVHFNIRM 140
            A  VS + G L+P     +   G   NP     + A  +S++ HP  P VP +  ++R+
Sbjct: 56  GAANVSIIKGVLTPQRAQSMSSRGRDINPAGGDPYAAAAMSLVFHPRXPLVPTLRADVRV 115

Query: 141 I-VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYF 199
             V G  W+GGG DLTP+     + ++ D   FH   K +C  H    Y  +K+WCD YF
Sbjct: 116 FEVAGCRWYGGGCDLTPA-----YLFEDDAAEFHRHWKAVCDTHHPEYYPQFKKWCDXYF 170

Query: 200 YLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSE 259
           +LP R+E RG+GGIFFD L  SP   G  A+  F+ AVGD  +  + ++V R  H  ++E
Sbjct: 171 HLPARKEHRGVGGIFFDDLSESP--AGQPAE-PFVRAVGDAIVPSWAAIVARRRHLPYTE 227

Query: 260 QDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + RQ QL+RRGRY EFNLLYD+G  FG + GG VESI+ S PPL+AW
Sbjct: 228 EQRQWQLLRRGRYLEFNLLYDRGVRFGME-GGRVESIMVSAPPLIAW 273


>gi|195050860|ref|XP_001992983.1| GH13345 [Drosophila grimshawi]
 gi|193900042|gb|EDV98908.1| GH13345 [Drosophila grimshawi]
          Length = 386

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 145/266 (54%), Gaps = 29/266 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILG------ 108
           F V  W+R +      GGG    L  G VFEKA V VS V G L P    Q+        
Sbjct: 110 FKVDRWMRKEG-----GGGVTCVLQDGDVFEKAGVNVSVVTGSLPPAAVQQMRARGKALT 164

Query: 109 -TTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESR 161
              K P+F A+G+S ++HP NPHVP +HFN R            +WFGGG DLTP     
Sbjct: 165 ENVKLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVELPDGEKQWWFGGGTDLTPY---- 219

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
            +  + D   FH TLK  C +H    Y  +K+WCD YF++ HR ESRGIGGIFFD +   
Sbjct: 220 -YLDETDARHFHKTLKSACDEHDATYYPRFKKWCDDYFHIKHRNESRGIGGIFFDDIDVP 278

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            +    D+ F+FI++     I  Y  LV+++ +  +   +RQ QL+RRGRY EFNL+YD+
Sbjct: 279 TQ----DSAFNFITSCARAVIPSYMPLVQKHKNDAYGNNERQWQLLRRGRYVEFNLIYDR 334

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT FG  T G   ESIL S+P    W
Sbjct: 335 GTKFGLYTPGARYESILMSLPLNARW 360


>gi|56755559|gb|AAW25958.1| SJCHGC00935 protein [Schistosoma japonicum]
          Length = 356

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 156/292 (53%), Gaps = 37/292 (12%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  +C E EK++ +A           F V  W R        GGG    L  G VFEKA
Sbjct: 63  LQGHLCKEIEKIDRKAK----------FKVDKWERRAG-----GGGISCVLENGDVFEKA 107

Query: 88  AVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            V VS + G+LSP    ++      +  +K+  F+  G+S ++HP NP+VP  HFN R  
Sbjct: 108 GVNVSVISGNLSPQAVKEMRARHSEIDPSKDCKFFVCGISSVMHPLNPYVPTTHFNFRYF 167

Query: 142 VTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +W+GGG DLTP      + ++ D   FH  LK  C QH  + Y  +K+WC
Sbjct: 168 EVDLGNNRKCWWYGGGADLTPY-----YLFNEDAKHFHEQLKLACDQHNKSFYPRFKKWC 222

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E+RG+GGIFFD L  + +    +  F+F+ +  +  I  Y  +V +  H 
Sbjct: 223 DDYFYLTHRGETRGVGGIFFDDLEDASQ----ERVFNFVKSCAEAIIPAYLPIVEKRRHL 278

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
            ++ ++R+ QL+RRGRY EFNL+YD+GT FG  T    +ESIL S+P    W
Sbjct: 279 TYTNKEREWQLVRRGRYVEFNLIYDRGTKFGLATPEARIESILMSLPRYAQW 330


>gi|220907308|ref|YP_002482619.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 7425]
 gi|219863919|gb|ACL44258.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7425]
          Length = 345

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 160/315 (50%), Gaps = 44/315 (13%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + R+R+S      LQ  IC   E+++              F    W R +      GGGR
Sbjct: 20  DSRQRVSA-FLRQLQDDICQGLEQIDGSGK----------FREDAWERPEG-----GGGR 63

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              + +G + E+  V  S V+G+  P    Q         F+ATG S+++HP +P++P V
Sbjct: 64  SRVMQSGTILEQGGVNFSEVWGEKLPPSILQQRPEAAGHGFYATGTSMVLHPRSPYIPTV 123

Query: 135 HFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           H N R    G  +WFGGG DLTP      + +  D   FH TLK  C +H    Y  +K 
Sbjct: 124 HLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHQTLKAACDRHHPQYYPTFKL 178

Query: 194 WCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGG----------------IDADF 231
           WCD YFYL HRQE+RG+GG+FFD+      L+  P   G                 +  F
Sbjct: 179 WCDEYFYLKHRQETRGVGGLFFDYQDGRGELYHGPNPQGPAGVYSAGLPPLESRSWEDLF 238

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
           +FI++ G  F+  Y  +V R     + E++RQ QL RRGRY EFNL+YD+GT FG +T G
Sbjct: 239 AFINSCGSAFLNSYVPIVERRQGLEYGERERQFQLYRRGRYVEFNLVYDRGTIFGLQTNG 298

Query: 292 NVESILASMPPLVAW 306
             ESIL S+PPLV W
Sbjct: 299 RTESILMSLPPLVRW 313


>gi|86605573|ref|YP_474336.1| coproporphyrinogen III oxidase [Synechococcus sp. JA-3-3Ab]
 gi|86554115|gb|ABC99073.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp.
           JA-3-3Ab]
          Length = 337

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 160/320 (50%), Gaps = 52/320 (16%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           R+R+SQ    +LQ  IC   E L+ +A           F    W R           R  
Sbjct: 14  RQRVSQ-FMRHLQDEICARLEALDGKAK----------FREDSWERPGGGGG-----RSR 57

Query: 77  TLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +  G VFE+  V  S V+G  L P    Q      +P F+ATG S+++HP NP+VP VH
Sbjct: 58  VIQQGGVFEQGGVNFSEVFGSQLPPSICKQRPEAAGHP-FYATGTSMVLHPRNPYVPTVH 116

Query: 136 FNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            N R    G  +WFGGG+DLTP      + ++ D   FH T K  C +   A Y  +K W
Sbjct: 117 LNYRYFEAGPVWWFGGGMDLTPY-----YLFEEDAAHFHRTAKAACDRLDPAYYPAFKIW 171

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEM-----GGIDAD------------------- 230
           CDRYF+LPHR E+RG+GGIFFD+    P +     G  +AD                   
Sbjct: 172 CDRYFFLPHRGEARGVGGIFFDYQDDRPGLLYRPEGEAEADPEQLAAEPPPLQVRVGSRS 231

Query: 231 ----FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
               F  + A  + F+  Y  +V R     + E++RQ QL RRGRY EFNL+YD+GT FG
Sbjct: 232 WEHLFELVQACAEAFLPAYVPIVERRQGMEWGERERQFQLYRRGRYVEFNLVYDRGTVFG 291

Query: 287 FKTGGNVESILASMPPLVAW 306
            +T G  ESIL S+PPLV W
Sbjct: 292 LQTQGRTESILMSLPPLVRW 311


>gi|167628071|ref|YP_001678571.1| coproporphyrinogen III oxidase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254800271|sp|B0U151|HEM6_FRAP2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167598072|gb|ABZ88070.1| Coproporphyrinogen oxidase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 308

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 110/301 (36%), Positives = 163/301 (54%), Gaps = 31/301 (10%)

Query: 17  RKRISQRKFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +++I+Q  FEN    LQ  I +  E+ E  + +         F    W +  + ++ L G
Sbjct: 2   QEKITQ--FENFLAQLQQKITSTLEQSETSSAK---------FISDKWQKPDTPEQKLKG 50

Query: 73  -GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
            G    +  G++FEK  V  S V+GD  P              F ATG+S+++HP NP V
Sbjct: 51  YGNSMIIEGGEIFEKGVVAFSRVHGDALPPSATAKRQELAGKSFIATGVSLVIHPRNPFV 110

Query: 132 PAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N R+ V GA      +WFGGG DLTP      + ++ D I +H T K +C +H  
Sbjct: 111 PTSHANFRIFVAGADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDA 165

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           + Y  +K+ CD YFYL HR E RG+GG+FFD L+        D  F F++   + ++  Y
Sbjct: 166 SYYPSFKKLCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFKFVTDCANSYLDAY 221

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V +  +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  
Sbjct: 222 IPIVEKRKNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMAT 281

Query: 306 W 306
           W
Sbjct: 282 W 282


>gi|325297066|ref|NP_001191537.1| coproporphirynogen oxidase [Aplysia californica]
 gi|30515682|gb|AAP34327.1|AF510850_1 coproporphirynogen oxidase [Aplysia californica]
          Length = 390

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 146/265 (55%), Gaps = 28/265 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK--- 111
           F V  WLR++      GGG    L  G VFEKA V +S V G L P+   Q+    K   
Sbjct: 115 FLVDRWLREQG-----GGGITCVLQDGTVFEKAGVNISVVSGILPPNAVQQMRARGKKMK 169

Query: 112 --NPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPS-LESRR 162
             N  F+A G+S +VHP NPH+P VHFN R            +WFGGG DLTP  LE + 
Sbjct: 170 GANLKFFAAGVSSVVHPRNPHIPTVHFNYRYFEVENDDGEKHWWFGGGTDLTPYYLEEK- 228

Query: 163 HSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP 222
                DV+ FH TLK+ C  H    Y  YK+WCD YF +PHR ESRG+GGIFFD +    
Sbjct: 229 -----DVVHFHKTLKKACDGHGKQLYPKYKKWCDDYFRVPHRGESRGVGGIFFDDVDEPS 283

Query: 223 EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKG 282
           +    D  F F++   +  +  Y  LV+++     S  +R+ QL+RRGRY EFNL+YD+G
Sbjct: 284 Q----DKCFEFVTDCAESVVPSYLPLVQKHKKDGVSYPEREWQLLRRGRYVEFNLIYDRG 339

Query: 283 TNFGFKT-GGNVESILASMPPLVAW 306
           T FG  T G   ESIL S+P    W
Sbjct: 340 TKFGLYTPGARYESILMSLPLTARW 364


>gi|53803045|ref|YP_115186.1| coproporphyrinogen III oxidase [Methylococcus capsulatus str. Bath]
 gi|62510600|sp|Q603L4|HEM6_METCA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|53756806|gb|AAU91097.1| coproporphyrinogen III oxidase, aerobic [Methylococcus capsulatus
           str. Bath]
          Length = 304

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E  E  A                ++ D+ +    GGGR   L  G+ FE+
Sbjct: 15  DLQESICNALETEEPRAR---------------FVEDRWEHAAGGGGRTRVLSGGETFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV---- 142
             V  S V G   P              F ATG+S+++HP NP+VP  H N+R  +    
Sbjct: 60  GGVNFSHVRGASLPASATAHRPELAGRGFQATGVSLVIHPLNPYVPTSHANVRFFLAEKE 119

Query: 143 --TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
             T  +WFGGG DLTP      + ++ DVI +H T +  C       Y  +K WCD YF+
Sbjct: 120 GETPIWWFGGGFDLTPF-----YPFEEDVIHWHRTARNACLPFGEDVYPRFKRWCDEYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G +  F+F+ +VGD ++K Y  +V+R     + E+
Sbjct: 175 LNHRNETRGVGGLFFDDLNEW----GFERSFAFLRSVGDHYLKAYLPIVQRRKAIPYGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP+  W
Sbjct: 231 EREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPVAHW 276


>gi|330965117|gb|EGH65377.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 304

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 147/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVVENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP++PHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   ++ C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAEQACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|226478796|emb|CAX72893.1| Coproporphyrinogen oxidase [Schistosoma japonicum]
          Length = 391

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 156/292 (53%), Gaps = 37/292 (12%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  +C E EK++ +A           F V  W R        GGG    L  G VFEKA
Sbjct: 98  LQGHLCKEIEKIDRKAK----------FKVDKWERRAG-----GGGISCVLENGDVFEKA 142

Query: 88  AVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            V VS + G+LSP    ++      +  +K+  F+  G+S ++HP NP+VP  HFN R  
Sbjct: 143 GVNVSVISGNLSPQAVKEMRARHSEIDPSKDCKFFVCGISSVMHPLNPYVPTTHFNFRYF 202

Query: 142 VTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +W+GGG DLTP      + ++ D   FH  LK  C QH  + Y  +K+WC
Sbjct: 203 EVDLGNNRKCWWYGGGADLTPY-----YLFNEDAKHFHEQLKLACDQHNKSFYPRFKKWC 257

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E+RG+GGIFFD L  + +    +  F+F+ +  +  I  Y  +V +  H 
Sbjct: 258 DDYFYLTHRGETRGVGGIFFDDLEDASQ----ERVFNFVKSCAEAIIPAYLPIVEKRRHL 313

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
            ++ ++R+ QL+RRGRY EFNL+YD+GT FG  T    +ESIL S+P    W
Sbjct: 314 TYTNKEREWQLVRRGRYVEFNLIYDRGTKFGLATPEARIESILMSLPRYAQW 365


>gi|121594260|ref|YP_986156.1| coproporphyrinogen III oxidase [Acidovorax sp. JS42]
 gi|120606340|gb|ABM42080.1| Coproporphyrinogen oxidase [Acidovorax sp. JS42]
          Length = 334

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 149/303 (49%), Gaps = 36/303 (11%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            E LQ+ I +  E +E    +  A      F    W R+       G G    L  G+VF
Sbjct: 21  LEGLQARITSALEDIEGPQSQGGAR-----FRSDAWRRESGSALQ-GDGITRILEGGRVF 74

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+RMI  G
Sbjct: 75  ERAGCGFSHVSGPRLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRMIAAG 134

Query: 145 AY---------------------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
                                  WFGGG+DLTP      + +D D + FH   ++  +  
Sbjct: 135 TGAAGTGAAGTGAAGQAGQGPICWFGGGMDLTPY-----YGFDEDAVHFHRACRDALAPF 189

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K WCD YFYL HR E RG+GGIFFD         G +   +   +VGD F+ 
Sbjct: 190 GEGLYPRFKTWCDEYFYLKHRNEQRGVGGIFFDDFAEP----GFEQSLAMTQSVGDAFLG 245

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V+R  H    E++R+ QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL
Sbjct: 246 AYLPIVQRRMHMDHGEREREFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPL 305

Query: 304 VAW 306
            AW
Sbjct: 306 AAW 308


>gi|47225709|emb|CAG08052.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 452

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 147/258 (56%), Gaps = 23/258 (8%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-------F 115
           DK Q+++ GGG    +  GKVFEKA V VS V G L+ +   Q+    K+         F
Sbjct: 178 DKWQRKEGGGGISCVMQDGKVFEKAGVNVSVVSGYLTEEAAKQMRSRGKSLRGRDGKLPF 237

Query: 116 WATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDV 169
            A G+S ++HP NPHVP VHFN R         +  +WFGGG DLTP      +    D 
Sbjct: 238 CAMGVSSVIHPKNPHVPTVHFNYRYFEIEEEDGSKQWWFGGGTDLTPV-----YINPEDA 292

Query: 170 IFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDA 229
             FH TLKE C +H    Y  +K+WCDRYFY+ HR E+RGIGGIFFD L S  +    + 
Sbjct: 293 SLFHGTLKEACDRHHPRYYPDFKKWCDRYFYIRHRGETRGIGGIFFDDLDSPSQ----EE 348

Query: 230 DFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT 289
            FSF+ +     +  Y  +VR++ +  F+++++  Q +RRGRY EFNL+YD+G  FG  T
Sbjct: 349 VFSFVKSCARTVVPCYLPIVRKHLNDPFTQEEKDWQQVRRGRYVEFNLVYDRGVKFGLAT 408

Query: 290 -GGNVESILASMPPLVAW 306
            G  +ESIL S+P    W
Sbjct: 409 PGSRIESILMSLPLTARW 426


>gi|188533231|ref|YP_001907028.1| coproporphyrinogen III oxidase [Erwinia tasmaniensis Et1/99]
 gi|226740883|sp|B2VI13|HEM6_ERWT9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|188028273|emb|CAO96131.1| Coproporphyrinogen III oxidase [Erwinia tasmaniensis Et1/99]
          Length = 302

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 158/300 (52%), Gaps = 34/300 (11%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           DI + KR       NLQ  IC + E+ +  A                +  D  Q+   GG
Sbjct: 5   DIAQVKRF----LLNLQDEICQKLEQADGAAR---------------FAEDSWQRPGGGG 45

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G+VFE+A V  S V+GD  P              F A G+S+++HP NP++P
Sbjct: 46  GRSRVLRQGRVFEQAGVNFSHVHGDEMPASATAHRPELAGRSFEALGVSLVIHPENPYIP 105

Query: 133 AVHFNIRMIVT---GA---YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R  +    GA   +WFGGG DLTP      + +  D + +H T  ++C      
Sbjct: 106 TSHANVRFFIAEKPGADPVWWFGGGFDLTPF-----YGFTEDAVHWHQTAFDLCLPFGAE 160

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK+WCD YF+L HR E RGIGG+FFD L++     G D  F F+ AVG  F   Y 
Sbjct: 161 VYPRYKKWCDDYFHLKHRNEQRGIGGLFFDDLNAH----GFDQSFRFMQAVGRGFCDAYL 216

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 217 PIVERRKALTWGERERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|261364748|ref|ZP_05977631.1| coproporphyrinogen III oxidase, aerobic [Neisseria mucosa ATCC
           25996]
 gi|288567051|gb|EFC88611.1| coproporphyrinogen III oxidase, aerobic [Neisseria mucosa ATCC
           25996]
          Length = 301

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 156/286 (54%), Gaps = 31/286 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            +NLQ+ IC   E+ +  A          +FT + W         LG G    L  G VF
Sbjct: 10  LKNLQNQICAALEQEDGGA----------VFTREEW------TGKLGVGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S V GD  P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGDKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + ++ D++ +H   +++C+    A Y  +K+WCD Y
Sbjct: 114 PEGGDPVWWFGGGFDLTPF-----YPFEEDILHWHTVARDVCAPFGEAVYPEFKKWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I+ Y  +V +  +  + 
Sbjct: 169 FYLKHRSETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIEAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLV 270


>gi|149276487|ref|ZP_01882631.1| coproporphyrinogen III oxidase [Pedobacter sp. BAL39]
 gi|149233007|gb|EDM38382.1| coproporphyrinogen III oxidase [Pedobacter sp. BAL39]
          Length = 298

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 157/286 (54%), Gaps = 28/286 (9%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F+ +Q  IC   E+ + +A           F  + W R     E  GGGR   L  G V 
Sbjct: 11  FKEVQDSICAGLEQADGKAR----------FEEELWNR-----EGGGGGRTRILQHGNVI 55

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM--IV 142
           EK  V  S V+G L    K       +N  F+ATG+S+++HP NP VP +H NIR   + 
Sbjct: 56  EKGGVNFSAVHGKLPEAVKKAF--KVENDDFFATGVSIVMHPSNPFVPIIHMNIRYFEMD 113

Query: 143 TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLP 202
               WFGGGIDLTP      +  D D  +FH+ LK+ C  +  + Y  +K+  D YFY+ 
Sbjct: 114 DQTRWFGGGIDLTP-----HYVIDTDARYFHHLLKKTCDTYDASFYPKFKQRADDYFYIE 168

Query: 203 HRQESRGIGGIFFDHLHSSPEMGGIDAD--FSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           HR E+RG+GGIF+D L   P+  G+D D    F  AVGD F+  Y  L+ RN    FS +
Sbjct: 169 HRAETRGVGGIFYDRL--KPDQTGLDFDQLLDFSVAVGDTFLPAYTELIDRNRDAEFSAE 226

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +++ Q +RR RYAEFNL+YD GT FG +T G +ESIL S+PP   W
Sbjct: 227 EQEWQYLRRSRYAEFNLVYDAGTKFGLETNGRIESILMSLPPTAKW 272


>gi|195387572|ref|XP_002052468.1| GJ17558 [Drosophila virilis]
 gi|194148925|gb|EDW64623.1| GJ17558 [Drosophila virilis]
          Length = 386

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 151/266 (56%), Gaps = 24/266 (9%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-- 112
           F+ + +  D+ Q+++ GGG    L  G+VFEKA V VS V G L P    Q+    K   
Sbjct: 105 FSGQKFKVDRWQRKEGGGGVTCVLQDGEVFEKAGVNVSVVTGMLPPAAVQQMRARGKELK 164

Query: 113 -----PYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESR 161
                P+F A+G+S ++HP NPHVP +HFN R            +WFGGG DLTP     
Sbjct: 165 ENVKLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVELPDGKKQWWFGGGTDLTPY---- 219

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
            +  + D   FH TLK  C +H  + Y  +K+WCD YF++ HR ESRGIGGIFFD +   
Sbjct: 220 -YLDENDARHFHQTLKSACDEHDTSYYPRFKKWCDDYFHIKHRNESRGIGGIFFDDIDEP 278

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            +    D+ F+F+++     I  Y  LV+++ +  +   +RQ QL+RRGRY EFNL+YD+
Sbjct: 279 SQ----DSAFNFVTSCARAVIPSYLPLVQKHKNADYGNNERQWQLLRRGRYVEFNLIYDR 334

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT FG  T G   ESIL S+P    W
Sbjct: 335 GTKFGLYTPGARYESILMSLPLHARW 360


>gi|104779343|ref|YP_605841.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
 gi|122401160|sp|Q1I2G6|HEM6_PSEE4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|95108330|emb|CAK13024.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
          Length = 303

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 149/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC+  E  +  A           F    W+RD       GGGR   +  GKV EK
Sbjct: 14  DLQDRICSALETEDGGAR----------FVEDAWVRDAG-----GGGRTRVIGEGKVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   ++ C+      Y  YK WCDRYF+
Sbjct: 119 GEEAVWWFGGGFDLTPY-----YGNEEDCVHWHRVAEQACAPFGADVYPRYKAWCDRYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD L+        D  F+F+ A+GD ++  Y  +++R     ++ +
Sbjct: 174 LKHRGEPRGIGGLFFDDLNEWD----FDTCFAFMRAIGDAYVDAYLPIIQRRKDTPYTAK 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|312129506|ref|YP_003996846.1| coproporphyrinogen oxidase [Leadbetterella byssophila DSM 17132]
 gi|311906052|gb|ADQ16493.1| Coproporphyrinogen oxidase [Leadbetterella byssophila DSM 17132]
          Length = 304

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 149/255 (58%), Gaps = 22/255 (8%)

Query: 67  KEDL------GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           KEDL      GGGR   +  G+V EK  V  S V G ++   K  +  +    YF ATG+
Sbjct: 30  KEDLWEHETGGGGRSRVISKGRVIEKGGVNYSEVSGKVTDSLKSLLKLSGDQEYF-ATGV 88

Query: 121 SVIVHPYNPHVPAVHFNIRM--IVTGAYWFGGGIDLTPSLESRRHSYDP-DVIFFHNTLK 177
           S+++HP NP+VP +H N+R   +  G  WFGGG DLTP      H  +P     FH  +K
Sbjct: 89  SIVLHPENPYVPIIHMNVRYFELSDGQCWFGGGTDLTP------HYVEPKQAKLFHERMK 142

Query: 178 EMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS---PEMGGI---DADF 231
             C   A   Y  +K+W D YFY+ HR E+RGIGGIF+D+L  +   P+ G     +  F
Sbjct: 143 AACDASAPEFYPAFKKWADEYFYIRHRHEARGIGGIFYDYLRPNQVIPQTGTTHNREELF 202

Query: 232 SFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGG 291
            F+  VG+ F  +Y  +++ N+   ++ ++++ QLIRRGRYAEFNL++D+GT FG ++ G
Sbjct: 203 QFMQNVGNAFSPVYMEMIQHNHSKAYTSEEKKWQLIRRGRYAEFNLVWDRGTRFGLESNG 262

Query: 292 NVESILASMPPLVAW 306
            +ESIL S+PP   W
Sbjct: 263 RIESILMSLPPQANW 277


>gi|149369450|ref|ZP_01889302.1| coproporphyrinogen III oxidase [unidentified eubacterium SCB49]
 gi|149356877|gb|EDM45432.1| coproporphyrinogen III oxidase [unidentified eubacterium SCB49]
          Length = 300

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 156/286 (54%), Gaps = 30/286 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ+ I +  E+++ +A           F    W R +      GGGR   +  G VFEK 
Sbjct: 12  LQNTITSRLEQIDGKA----------TFEEDIWKRKEG-----GGGRTRVIENGAVFEKG 56

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT---- 143
            V +S V+G L P+   Q  G  K+  F+A GLS+++HP NP VP VH N R        
Sbjct: 57  GVNISEVHGKL-PESMQQYFGV-KDANFFACGLSLVLHPVNPMVPTVHANWRYFEMYNQE 114

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                 WFGGG DLTP      + +D D   FH T K  C +H    Y  YK  CD YFY
Sbjct: 115 GEIVDQWFGGGQDLTPY-----YLFDEDATHFHQTCKTACDKHNPTFYPKYKARCDEYFY 169

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
             HR+E RG+GG+FFD+   S +M   D  ++F++ VGD F++ Y  +V +  +  F++ 
Sbjct: 170 NAHREEGRGLGGLFFDYCKVSEDMQMQDW-YNFVTEVGDSFLEAYCPIVEKRMNLPFTKA 228

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 229 QRDWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|301632139|ref|XP_002945148.1| PREDICTED: coproporphyrinogen-III oxidase, aerobic-like [Xenopus
           (Silurana) tropicalis]
          Length = 314

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 146/286 (51%), Gaps = 24/286 (8%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ+ I    E +E              F    W R  S +   G G    L  G VFE+
Sbjct: 21  DLQARITGALEGVEGSGGAR--------FASDPW-RKGSGEALQGDGITRILEGGHVFER 71

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A V  S V G   P    Q         F A G+S++ HP NP+VP VH N+RMI  G  
Sbjct: 72  AGVGFSHVRGARLPPSATQHRPELAGAPFEAMGVSLVFHPLNPYVPTVHMNVRMITAGQP 131

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG+DLTP      + ++ D + FH    +         Y  +K WCD YFY
Sbjct: 132 GQALACWFGGGMDLTPY-----YGFEEDAVHFHRICHDTLKPFGEGLYLRFKRWCDEYFY 186

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RG+GGIFFD   +     G +   +    VGD F++ Y  +V R     F E+
Sbjct: 187 LKHRDEQRGVGGIFFDDFAAL----GFERSLAMTQDVGDAFLRAYLPIVERRMTLPFGER 242

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRYAEFNL++D+GT+FG ++GG  ESIL SMPPL +W
Sbjct: 243 ERAFQLYRRGRYAEFNLVWDRGTHFGLQSGGRTESILLSMPPLASW 288


>gi|58268026|ref|XP_571169.1| coproporphyrinogen oxidase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57227403|gb|AAW43862.1| coproporphyrinogen oxidase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 336

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 167/306 (54%), Gaps = 33/306 (10%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           ++LQ  I    E++E  A  N    SP   T   +LRD   + + G G    L  G+VFE
Sbjct: 10  KSLQDHIVRTMEQIEAAAPPNEFAPSPAPPT---FLRDAWIRPEGGEGSSCVLADGRVFE 66

Query: 86  KAAVLVSTVYGDLSPDFKDQILG-------TTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
           KA + VS V+G L P  +  +L         T    F+ATGLS+++HP NPHVP VH N 
Sbjct: 67  KAGINVSVVHGKLPPKAQMAMLPDHPSLPEPTGTVPFFATGLSIVIHPRNPHVPTVHLNY 126

Query: 139 RMIV-----TG---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           R        TG   A+WFGGG DLTPS     +  + D + FH TLK  C QH    +  
Sbjct: 127 RYFEIEDPETGKPKAWWFGGGSDLTPS-----YLDEADAVHFHKTLKHACDQHDERYWPD 181

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHL------HSSPEMG-GIDAD--FSFISAVGDCF 241
           +K+ CDRYF + HR E RG+GGIFFD L      H+ P+   G  A+  F F+ +    F
Sbjct: 182 FKQQCDRYFTITHRGECRGLGGIFFDDLTTTSPVHAPPDGAQGPSAEKIFEFVKSASAAF 241

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASM 300
           +  Y  +V ++ +  ++ ++++ Q +RRGRY EFNL+YD+GT FG  T G  +ESIL S+
Sbjct: 242 LPAYVPIVYKHMNDSWTPEEKRWQQLRRGRYVEFNLVYDRGTKFGLNTPGARIESILMSL 301

Query: 301 PPLVAW 306
           P    W
Sbjct: 302 PETARW 307


>gi|260771096|ref|ZP_05880024.1| coproporphyrinogen III oxidase aerobic [Vibrio furnissii CIP
           102972]
 gi|260613985|gb|EEX39176.1| coproporphyrinogen III oxidase aerobic [Vibrio furnissii CIP
           102972]
          Length = 304

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 152/286 (53%), Gaps = 26/286 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC + E ++  A           F    W R+  +K   GGGR   +  G VFE+
Sbjct: 15  SLQDSICQQLEAVDGGA----------TFEEDAWHREPGEKLG-GGGRTRVMRNGHVFEQ 63

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V G   P              F A G+S+++HP NP+VP  H N+R  +    
Sbjct: 64  GGVNFSHVAGQQMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSHANVRFFIAEKE 123

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D   +H   K +C+      Y  +K WCDRYFY
Sbjct: 124 GEAPIWWFGGGFDLTPF-----YPFEQDCHEWHRVAKALCAPFGDEVYAEHKAWCDRYFY 178

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           LPHR+E+RGIGG+FFD L+        +  F +I AVG+ + + Y  +V R     + E+
Sbjct: 179 LPHREETRGIGGLFFDDLNQW----SFEQCFDYIKAVGEGYTQAYLPIVERRKATPYGER 234

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 235 EREFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|75910777|ref|YP_325073.1| coproporphyrinogen III oxidase [Anabaena variabilis ATCC 29413]
 gi|75704502|gb|ABA24178.1| coproporphyrinogen oxidase [Anabaena variabilis ATCC 29413]
          Length = 347

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 147/277 (53%), Gaps = 28/277 (10%)

Query: 53  KIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN 112
           K+  V  +  D  ++ + GGGR   L  G +FE+A V  S V+G   P          + 
Sbjct: 44  KLDGVGQFHEDSWERPEGGGGRSRVLRDGAIFEQAGVNFSEVWGSHLPPSILAQRPEAEG 103

Query: 113 PYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIF 171
             F+ATG S+++HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   
Sbjct: 104 HGFYATGTSLVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAH 158

Query: 172 FHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMG 225
           FH TLK  C +H    Y  +K WCD YFYL HR E+RG+GG+FFD+      L+  P   
Sbjct: 159 FHQTLKGACDEHHPEYYPVFKRWCDEYFYLKHRDETRGVGGLFFDYQDGQGVLYRGPNPK 218

Query: 226 GIDAD----------------FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRR 269
           G  A+                FSF+   G  F+  Y  +V R +   + ++ R  QL RR
Sbjct: 219 GEAANYSNQVGEPAPRDWEDLFSFVQGSGKAFLPAYVPIVERRHGIEYGDRQRNFQLYRR 278

Query: 270 GRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           GRY EFNL+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 279 GRYVEFNLVYDRGTIFGLQTNGRTESILMSLPPLVRW 315


>gi|224044099|ref|XP_002190683.1| PREDICTED: coproporphyrinogen oxidase [Taeniopygia guttata]
          Length = 401

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 149/266 (56%), Gaps = 28/266 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F V  W     ++++ GGG    L  G+VFEKA V VS V G LS +   Q+    K+  
Sbjct: 123 FAVDTW-----ERKEGGGGISCVLQDGEVFEKAGVNVSVVSGLLSEEAARQMRSRGKSLK 177

Query: 115 -------FWATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESR 161
                  F A G+S ++HP NPHVP +HFN R         T  +WFGGG DLTP+    
Sbjct: 178 AKDGKLPFCAMGVSSVIHPKNPHVPTMHFNYRYFEIEEADGTKQWWFGGGTDLTPT---- 233

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
            +  + D I FH TLKE C +H V  Y  YK+WCD YFY+ HR E RGIGGIFFD + S 
Sbjct: 234 -YLNEEDAIHFHKTLKEACDKHDVKLYPKYKKWCDDYFYIKHRGERRGIGGIFFDDMDSP 292

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            +    +  F F+ +     +  Y  +V+++ H  F+ +++  Q +RRGRY EFNL+YD+
Sbjct: 293 SK----EEVFQFVKSCAKAVVPCYIPIVKKHCHDSFTPEEKLWQQLRRGRYVEFNLVYDR 348

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT FG  T G  +ESIL S+P    W
Sbjct: 349 GTKFGLLTPGSRIESILMSLPLTARW 374


>gi|319788386|ref|YP_004147861.1| coproporphyrinogen oxidase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466898|gb|ADV28630.1| Coproporphyrinogen oxidase [Pseudoxanthomonas suwonensis 11-1]
          Length = 311

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 153/288 (53%), Gaps = 28/288 (9%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR--DKSQKEDLGGGRMATLCAGKVF 84
            LQ  IC   E  + +A           F    W R  + +     GGGR   L  G VF
Sbjct: 14  GLQDRICAAIEAADGQAR----------FVEDTWTRPAEAAGGSHAGGGRTRILRDGAVF 63

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV-- 142
           E+A +  S V G   P              + ATG+S++ HP NP++P  H N+R     
Sbjct: 64  EQAGIGFSDVSGSRLPPSASAARPELAGASWRATGVSLVFHPRNPYLPTTHANVRHFQAR 123

Query: 143 ----TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
               T A+WFGGG DLTP      + +D DV+ +H T  ++C+      Y  +K WCD Y
Sbjct: 124 RDGETVAWWFGGGFDLTPF-----YPFDEDVVHWHRTAADLCAPFGADRYERHKRWCDDY 178

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F+L HR E+RG+GG+FFD LH        + DF+++ AVGD F+  Y  +V R     + 
Sbjct: 179 FFLKHRNETRGVGGLFFDDLHED-----FERDFTYLRAVGDGFLDAYLPIVERRKDTPYG 233

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 234 EREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPRVRW 281


>gi|330817837|ref|YP_004361542.1| Coproporphyrinogen oxidase [Burkholderia gladioli BSR3]
 gi|327370230|gb|AEA61586.1| Coproporphyrinogen oxidase [Burkholderia gladioli BSR3]
          Length = 308

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 139/256 (54%), Gaps = 15/256 (5%)

Query: 57  VKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFW 116
             H  R   ++   GGG    L  G  FE+A +  S V GD  P              F 
Sbjct: 36  ATHAWRRGPEERLRGGGCTRILENGAFFERAGIGFSDVSGDALPPSASAARPQLAGRGFE 95

Query: 117 ATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVI 170
           A G+S+++HP NPH P VH N+RM V         +WFGGG+DLTP      + Y+ D  
Sbjct: 96  ALGVSLVLHPRNPHCPTVHMNVRMFVATKAGEAPIFWFGGGMDLTPV-----YGYEEDAR 150

Query: 171 FFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD 230
            FH   ++  +      Y  +K WCD YF+L HR E+RGIGGIFFD L S P   G +  
Sbjct: 151 DFHAACRDALAPFGTEYYPRFKTWCDEYFFLKHRNETRGIGGIFFDDL-SEP---GFERS 206

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG 290
           F+ +  VGD F+  Y  +V R     + E++R+ Q  RRGRY EFNL++D+GT FG ++G
Sbjct: 207 FALMRGVGDAFLAAYLPIVERRRDTPYGEREREFQAYRRGRYVEFNLVFDRGTLFGLQSG 266

Query: 291 GNVESILASMPPLVAW 306
           G  ESIL SMPPL +W
Sbjct: 267 GRTESILMSMPPLASW 282


>gi|330876385|gb|EGH10534.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 304

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTTLEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVVENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP++PHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|307129661|ref|YP_003881677.1| coproporphyrinogen III oxidase [Dickeya dadantii 3937]
 gi|306527190|gb|ADM97120.1| coproporphyrinogen III oxidase [Dickeya dadantii 3937]
          Length = 312

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 151/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  +C + E  +  A                ++ D  Q    GGGR   L  G+VFE+
Sbjct: 15  TLQDDLCRQLELTDGSAT---------------FIEDAWQHASGGGGRSRVLRQGRVFEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V G   P              F A G+S+++HP NP+VP  H NIR  +    
Sbjct: 60  AGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVMHPLNPYVPTSHANIRFFIAEKP 119

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+WCD YF+
Sbjct: 120 GEPAVWWFGGGFDLTPY-----YGFEEDAVHWHQTAFDLCKPFGDDVYPRYKQWCDDYFF 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R     + E+
Sbjct: 175 LKHRNEARGVGGLFFDDLNAP----DFDTSFAFMRAVGEGFRHAYLPIVNRRKDIPWGER 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 231 ERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPLVRW 276


>gi|212538059|ref|XP_002149185.1| coproporphyrinogen III oxidase, putative [Penicillium marneffei
           ATCC 18224]
 gi|210068927|gb|EEA23018.1| coproporphyrinogen III oxidase, putative [Penicillium marneffei
           ATCC 18224]
          Length = 451

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 119/321 (37%), Positives = 163/321 (50%), Gaps = 48/321 (14%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           DD   R R+ ++  +  Q  I  E  +++ +A           F    W R        G
Sbjct: 104 DDSPMRLRM-EKLIKEHQKKITDELSRIDGKA-----------FQADTWTRPNG-----G 146

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLS--------PDFKDQILGTTKNPYFWATGLSVI 123
           GG    L  G VFEKA V +S VYG+L          D K  +     +  F+A GLS++
Sbjct: 147 GGISCVLQDGNVFEKAGVNISIVYGELPRPAIERMRADHKSFVGANVDSLNFFAAGLSLV 206

Query: 124 VHPYNPHVPAVHFNIRMIVTG----------AYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +HP+NPH P VH N R   T            +WFGGG DLTPS     + Y  D   FH
Sbjct: 207 LHPHNPHAPTVHLNYRYFETSDPKDPINGDKNWWFGGGTDLTPS-----YLYPEDCKHFH 261

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS-------PEMGG 226
            T+K++C +H    Y  +K WCD+YFY+PHR E+RGIGGIFFD L ++            
Sbjct: 262 QTIKDVCDRHDSTYYPRFKAWCDKYFYIPHRGEARGIGGIFFDDLDANFLQSSLSSSQNP 321

Query: 227 IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG 286
            +  FSF+S     F+  Y  ++ R     F+ + +Q Q +RRGRY EFNL+YD+GT+FG
Sbjct: 322 QETLFSFVSDALGSFLPSYVPILERRKDMPFTPEQKQWQQLRRGRYVEFNLVYDRGTSFG 381

Query: 287 FKT-GGNVESILASMPPLVAW 306
            +T    VESIL S+P   +W
Sbjct: 382 LRTPNARVESILMSLPRTASW 402


>gi|254515968|ref|ZP_05128028.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR5-3]
 gi|219675690|gb|EED32056.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR5-3]
          Length = 310

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 153/286 (53%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC    +++ +A           F+V+ W R +      GGGR   L  G V EK
Sbjct: 14  GLQDSICEGLAQVDGKAD----------FSVEEWDRPEG-----GGGRSRVLVDGAVLEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
           A V  S V GD  P     +        + A G+S+++HP NP+ P  H N+R+ +    
Sbjct: 59  AGVNFSHVMGDSLPASATAVRPELAGRSYQALGVSLVIHPRNPYAPTSHANVRLFIAEKP 118

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      + +D D + +H T  + C+      Y  YK+WCD YFY
Sbjct: 119 GEEPVWWFGGGYDLTPY-----YGFDEDCVHWHRTAADACAPFGDDVYPRYKKWCDDYFY 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RG+GG+F+D L+S       +  F+F+ A+GD ++  Y  ++ R       ++
Sbjct: 174 LKHRDEPRGVGGLFYDDLNSW----DFETCFAFMRAIGDSYLDAYRPILERRKDTPCGDR 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPLV W
Sbjct: 230 ERQFQLYRRGRYVEFNLVFDRGTLFGLQSNGRTEAILMSLPPLVRW 275


>gi|195117130|ref|XP_002003102.1| GI17730 [Drosophila mojavensis]
 gi|193913677|gb|EDW12544.1| GI17730 [Drosophila mojavensis]
          Length = 386

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 147/266 (55%), Gaps = 29/266 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-- 112
           F V  WLR +      GGG    L  G VFEKA V VS V G L P    Q+    K+  
Sbjct: 110 FKVDRWLRKEG-----GGGVTCVLQDGDVFEKAGVNVSVVTGSLPPAAVQQMRSRGKDLA 164

Query: 113 -----PYFWATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESR 161
                P+F A+G+S ++HP NPHVP +HFN R         +  +WFGGG DLTP     
Sbjct: 165 ENVKLPFF-ASGVSAVIHPRNPHVPTIHFNYRYFEVELPDGSKQWWFGGGTDLTPY---- 219

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
            +  + D   FH TLK  C +H  + Y  +K+WCD YF++ HR ESRGIGGIFFD +   
Sbjct: 220 -YLDESDARHFHKTLKSACDEHNTSYYPKFKKWCDDYFHIKHRNESRGIGGIFFDDIDEP 278

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            + G     F F+++     I  Y  LV+++ +  +  ++R+ QL+RRGRY EFNL+YD+
Sbjct: 279 NQEGA----FKFVTSCARAVIPSYLPLVQKHKNADYGTKEREWQLLRRGRYVEFNLIYDR 334

Query: 282 GTNFGFKT-GGNVESILASMPPLVAW 306
           GT FG  T G   ESIL S+P    W
Sbjct: 335 GTKFGLYTPGARYESILMSLPLHARW 360


>gi|28867410|ref|NP_790029.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968420|ref|ZP_03396563.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato T1]
 gi|301384292|ref|ZP_07232710.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060146|ref|ZP_07251687.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           K40]
 gi|302130419|ref|ZP_07256409.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|38372328|sp|Q88B49|HEM6_PSESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|28850644|gb|AAO53724.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926708|gb|EEB60260.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato T1]
 gi|331017679|gb|EGH97735.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 304

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  ICT  E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICTALEQEDGNAH----------FVEDAWTRPAG-----GGGRTRVVENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP++PHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQWD----FDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|114052330|ref|NP_001040239.1| coproporphirynogen oxidase [Bombyx mori]
 gi|87248475|gb|ABD36290.1| coproporphirynogen oxidase [Bombyx mori]
          Length = 391

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 153/291 (52%), Gaps = 36/291 (12%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           +Q+  C   EK E++  +         FTV  W R +      GGG    L  G+VFEKA
Sbjct: 89  IQAEFCRALEKEEDKEAK---------FTVDRWTRKEG-----GGGITCVLQDGRVFEKA 134

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKN------PYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            V +S V G L P    Q+    KN      P+F A G+S ++HP NP VP +HFN R  
Sbjct: 135 GVNISVVSGKLPPAAIQQMRSRGKNLQNAELPFF-AAGVSAVIHPRNPMVPTIHFNYRYF 193

Query: 142 VTG-----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
                    +WFGGG DLTP      +  + D + FH TLK  C  H  + Y  +K+WCD
Sbjct: 194 EVQDKNGVQWWFGGGTDLTPY-----YLNEDDALHFHLTLKHACDDHDSSYYARFKKWCD 248

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFY+PHR E RG+GGIFFD L +  +     A F+F+++  +  I  Y  LV+++    
Sbjct: 249 DYFYIPHRGERRGVGGIFFDDLDTPNQ----QAAFAFVTSCAEAVIPSYVPLVKKHKDDA 304

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
           +   +RQ Q +RRGRY EFNL+YD+GT  G  T     ESIL S+P    W
Sbjct: 305 YGYHERQWQWLRRGRYVEFNLIYDRGTKLGLHTPEARYESILMSLPLNAKW 355


>gi|32491333|ref|NP_871587.1| coproporphyrinogen III oxidase [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31340160|sp|Q8D1X2|HEM6_WIGBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|25166540|dbj|BAC24730.1| hemF [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 303

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 155/288 (53%), Gaps = 31/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F+NLQ+IIC  F K++ ++          +F    W   K      G GR   L  GKVF
Sbjct: 13  FKNLQNIICNTFSKIDGKS----------LFKEDMWNTKK------GYGRTRILKKGKVF 56

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+ +V  S V+G   P          +N  + A+G+SV+ HP NP+VP  H NIR  +  
Sbjct: 57  EQVSVNFSHVFGKSLPKSSSNKKRDLENCSYQASGISVVSHPKNPYVPTSHLNIRFFLAK 116

Query: 145 ------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      + +  DVI +H   K++C       Y  YK+WCD Y
Sbjct: 117 NKKRKTIWWFGGGFDLTPY-----YGFYQDVIHWHTIAKKICQPFGDDIYFKYKKWCDDY 171

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F++ HR ESRGIGG+FFD L     +    + F F  ++G  +I  Y  +V     + + 
Sbjct: 172 FFIKHRNESRGIGGLFFDDLC----LPDFHSAFLFSKSIGKGYIDAYFPIVNLRKSYSWG 227

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++R  QL RRGRY EFNLL D+GT FG ++ G +ESIL+SMPPLV W
Sbjct: 228 SRERNFQLYRRGRYVEFNLLLDRGTLFGIQSNGRIESILSSMPPLVKW 275


>gi|88860591|ref|ZP_01135228.1| coproporphyrinogen III oxidase [Pseudoalteromonas tunicata D2]
 gi|88817186|gb|EAR27004.1| coproporphyrinogen III oxidase [Pseudoalteromonas tunicata D2]
          Length = 303

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 150/286 (52%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ + +A                ++ D  Q+ + GGGR   +  G V E+
Sbjct: 15  DLQDRICAGLEQADGDAK---------------FVEDAWQRAEGGGGRTRVITNGAVIEQ 59

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA- 145
             V  S V+G   P              F A G+S+++HP NPH+P  H N+R  +    
Sbjct: 60  GGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLVIHPKNPHIPTSHANVRFFIAEKE 119

Query: 146 -----YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +    DV  +H   K +CS      Y  YK+WCD YFY
Sbjct: 120 GEEPIWWFGGGFDLTPF-----YPVLEDVKHWHQVAKNLCSPFGETVYDDYKKWCDEYFY 174

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L++     G D  F+F+ AVG+ F+  Y  ++ +  +   ++ 
Sbjct: 175 LKHRGETRGVGGLFFDDLNTW----GFDKSFAFMQAVGNGFLDAYIPIIEKRKNTPVTQI 230

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 231 QRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|332021316|gb|EGI61691.1| Coproporphyrinogen-III oxidase [Acromyrmex echinatior]
          Length = 400

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 162/308 (52%), Gaps = 40/308 (12%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P+D++ +  +   K    Q+  C   EKLEN    NS       F V  W R +      
Sbjct: 85  PNDMKTKMELLVMK---TQADFCRVLEKLENG---NS-------FKVDRWTRKEG----- 126

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-----PYFWATGLSVIVH 125
           GGG    L  G+VFEKA V VS V G L P+   Q+    K      P+F A G+S ++H
Sbjct: 127 GGGITCVLQDGQVFEKAGVNVSVVTGMLPPNAVQQMKARGKKMEDSVPFF-AAGVSAVIH 185

Query: 126 PYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           P NP +P +HFN R         T  +WFGGG DLTP         + D   FH TLK  
Sbjct: 186 PRNPMIPTIHFNYRYFEVENPDGTTQWWFGGGTDLTPYYLD-----EEDAKHFHKTLKSA 240

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C +H  + Y+ +KEWCD YF + HR E RG+GGIFFD L +  +    +  F F+++  +
Sbjct: 241 CDKHDPSYYSKFKEWCDNYFNIVHRGERRGVGGIFFDDLDTPSQ----NEAFQFVTSCAE 296

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILA 298
             I  Y  LV+++ +  +   +RQ QL+RRGRY EFNL+YD+GT FG  T G   ESIL 
Sbjct: 297 AVIPSYIPLVKKHKNDGYGYHERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILM 356

Query: 299 SMPPLVAW 306
           S+P    W
Sbjct: 357 SLPLNAKW 364


>gi|326472250|gb|EGD96259.1| coproporphyrinogen III oxidase [Trichophyton tonsurans CBS 112818]
 gi|326483304|gb|EGE07314.1| coproporphyrinogen III oxidase [Trichophyton equinum CBS 127.97]
          Length = 433

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 157/306 (51%), Gaps = 45/306 (14%)

Query: 36  FEKLENEAHENSANRSPKI----FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLV 91
            EKL  E  +   +   KI    FT+  W R        GGG    L  G VFEKA V V
Sbjct: 99  MEKLIKEQQKRIIDELSKIDGNAFTIDEWDRPNG-----GGGISCVLQDGNVFEKAGVNV 153

Query: 92  STVYGDL--------SPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
           S VYG L          D K  +     +  F+A GLS+++HP NP  P VH N R   T
Sbjct: 154 SVVYGKLPRPAIEKMRADHKSFVSADVDSLDFFAAGLSLVLHPKNPMAPTVHLNYRFFET 213

Query: 144 G----------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
                       +WFGGG DLTPS     + +  D   FH T+K++C  H  + Y  +K 
Sbjct: 214 SDPKDVLNGKTNWWFGGGTDLTPS-----YLFPEDCEHFHKTIKDVCDMHDPSYYPKFKT 268

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHL------HSSPEMGGIDAD------FSFISAVGDCF 241
           WCD+YFYL HR E+RGIGGIFFD L       SSP+   I         FSF++     F
Sbjct: 269 WCDKYFYLTHRNEARGIGGIFFDDLDTEFIRQSSPDSASISDKEAQERLFSFVTDGLCSF 328

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASM 300
           +  Y  +V++     F+EQ++  Q +RRGRY EFNL++D+GT+FG +T G  +ESIL S+
Sbjct: 329 LPAYVPIVKKRKDMPFTEQEKDWQQLRRGRYVEFNLVHDRGTSFGLRTPGSRIESILMSL 388

Query: 301 PPLVAW 306
           P    W
Sbjct: 389 PRTAKW 394


>gi|254413000|ref|ZP_05026772.1| coproporphyrinogen III oxidase, aerobic [Microcoleus chthonoplastes
           PCC 7420]
 gi|196180164|gb|EDX75156.1| coproporphyrinogen III oxidase, aerobic [Microcoleus chthonoplastes
           PCC 7420]
          Length = 342

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 161/317 (50%), Gaps = 46/317 (14%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
            + R R+ Q   + +Q  IC    +L+                   +  D  Q+E+ GGG
Sbjct: 18  TDSRDRVKQ-FMQQIQDTICDSLAELDGAGQ---------------FQEDSWQREEGGGG 61

Query: 74  RMATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           R   +  G VFE+  V  S V+G  L P    Q      +  F+ATG S+++HP +P++P
Sbjct: 62  RSRVIRDGAVFEQGGVNFSEVWGTQLPPSILTQRPEAAGHG-FYATGTSMVLHPRSPYIP 120

Query: 133 AVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            VH N R    G  +WFGGG DLTP      + +  D   FH TLK  C  H    Y  +
Sbjct: 121 TVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHKTLKTACDNHHSEYYPVF 175

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDH------LHSSP-----------EMGGIDAD---- 230
           K WCD YFYL HRQE+RG+GG+FFD+      L+  P           E+G ++      
Sbjct: 176 KRWCDEYFYLKHRQETRGVGGLFFDYQDGTGELYKGPHPEKAAAIYSKELGAVEPRTWEQ 235

Query: 231 -FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT 289
            F+++   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T
Sbjct: 236 LFAWVQECGHSFLPAYVPIVERRRDMNYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQT 295

Query: 290 GGNVESILASMPPLVAW 306
            G  ESIL S+PPLV W
Sbjct: 296 NGRTESILMSLPPLVRW 312


>gi|301780274|ref|XP_002925555.1| PREDICTED: coproporphyrinogen-III oxidase, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 458

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 166/317 (52%), Gaps = 32/317 (10%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
           C +     D  E R R S  K +    I+ T+ +  +  A  +   R    F+V  W   
Sbjct: 133 CFMAPPVTDLRELRGRPSDMKTKMELLILETQAQVCQALAQVDGGAR----FSVDRW--- 185

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPY-FW 116
             ++++ GGG    L  G VFEKA V +S V+G+LS +   Q      IL T      F 
Sbjct: 186 --ERKEGGGGISCVLQDGHVFEKAGVSISVVHGNLSEEAAKQMRSRGKILKTKDGKLPFS 243

Query: 117 ATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVI 170
           A G+S ++HP NPH P +HFN R            +WFGGG DLTP+  ++      D +
Sbjct: 244 AMGVSSVIHPKNPHAPTIHFNYRYFEIEEADGNKQWWFGGGCDLTPTYLNQE-----DAV 298

Query: 171 FFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD 230
            FH TLKE C QH    Y  +K+WCD YF++ HR E RGIGGIFFD L S  +    +  
Sbjct: 299 HFHRTLKEACDQHGPDLYPKFKKWCDDYFFIVHRGERRGIGGIFFDDLDSPSK----EEV 354

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG-FKT 289
           F F+ +     +  Y  LV++++   F+ Q++  Q +RRGRY EFNLLYD+GT FG F  
Sbjct: 355 FRFVQSCAQAVVPSYIPLVKKHHDESFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTP 414

Query: 290 GGNVESILASMPPLVAW 306
           G  +ESIL S+P    W
Sbjct: 415 GSRIESILMSLPLTARW 431


>gi|71275521|ref|ZP_00651807.1| Coproporphyrinogen oxidase [Xylella fastidiosa Dixon]
 gi|71900168|ref|ZP_00682308.1| Coproporphyrinogen oxidase [Xylella fastidiosa Ann-1]
 gi|170729266|ref|YP_001774699.1| coproporphyrinogen III oxidase [Xylella fastidiosa M12]
 gi|226740909|sp|B0U1G5|HEM6_XYLFM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|71163821|gb|EAO13537.1| Coproporphyrinogen oxidase [Xylella fastidiosa Dixon]
 gi|71730057|gb|EAO32148.1| Coproporphyrinogen oxidase [Xylella fastidiosa Ann-1]
 gi|167964059|gb|ACA11069.1| Coproporphyrinogen oxidase [Xylella fastidiosa M12]
          Length = 305

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 150/285 (52%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E ++ ++H          F   HW     Q+ + GGGR   L  G VFE+A
Sbjct: 14  LQDRICNVVETIDGQSH----------FHEDHW-----QRTEGGGGRTRLLRDGAVFEQA 58

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
           A+  S V G   P              + A G+S++ HP NP VP  H N+R        
Sbjct: 59  AIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNVRYFRAEREG 118

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
              A WFGGG DLTP      + +D DV+ +H   +++C+      Y  +K WCD YF L
Sbjct: 119 KQVAAWFGGGFDLTPF-----YPFDEDVVHWHRVARDLCAPFGDERYAAHKRWCDEYFVL 173

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RG+GG+FFD L         + DF +  AVGD F+  Y  +V R +   + +++
Sbjct: 174 RHRNETRGVGGLFFDDLDKD-----FERDFDYQRAVGDGFLDAYFPIVTRRHDTPYGDRE 228

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 229 RAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 273


>gi|242080897|ref|XP_002445217.1| hypothetical protein SORBIDRAFT_07g006160 [Sorghum bicolor]
 gi|241941567|gb|EES14712.1| hypothetical protein SORBIDRAFT_07g006160 [Sorghum bicolor]
          Length = 347

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 156/306 (50%), Gaps = 36/306 (11%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           +R    +Q+ +C E E +E     N       +F    W R        GGG    L  G
Sbjct: 31  ERMIRRVQADVCAELEAVEGSGTSNGGGGG-ALFREDAWTRPGG-----GGGISRVLQGG 84

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQIL----------GTTKNPY-FWATGLSVIVHPYNPH 130
           +VFEKAAV VS VYG + P+                G    P  F+A G+S ++HP NP 
Sbjct: 85  RVFEKAAVNVSVVYGVMPPEAYRAARPEAAAAAAAGGDKAGPVPFFAAGISSVIHPVNPF 144

Query: 131 VPAVHFNIRMIVTGA----------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
            P +HFN R   T A          +WFGGG DLTPS     +  + D+  FH+  K++C
Sbjct: 145 APTMHFNYRYFETEAPKDAPGAPRQWWFGGGTDLTPS-----YIIEEDIKHFHSVQKQVC 199

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             +  + Y  +K+WCD YFY+ HR E RG+GGIFFD L+   +    +    F +   D 
Sbjct: 200 DSYDPSFYPRFKKWCDDYFYIKHRGERRGVGGIFFDDLNDYDQ----ETLLRFATDCADS 255

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            +  Y  ++ R    LF+E+ +  Q +RRGRY EFNL+YD+GT FG KTGG +ESIL S+
Sbjct: 256 VLPAYIPIIERRKDTLFTEEHKAWQQLRRGRYVEFNLVYDRGTTFGLKTGGRIESILVSL 315

Query: 301 PPLVAW 306
           P    W
Sbjct: 316 PLTARW 321


>gi|78067092|ref|YP_369861.1| coproporphyrinogen III oxidase [Burkholderia sp. 383]
 gi|123567972|sp|Q39E99|HEM6_BURS3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|77967837|gb|ABB09217.1| Coproporphyrinogen oxidase [Burkholderia sp. 383]
          Length = 307

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 142/253 (56%), Gaps = 16/253 (6%)

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R  +++   GGG    L  G+VFE+A +  S V GD  P              F A G
Sbjct: 39  WQRGPAERLR-GGGCTRILEGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALG 97

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +S+++HP NP+ P VH N+RM++         +WFGGG+DLTP      + ++ D   FH
Sbjct: 98  VSLVLHPRNPYCPTVHMNVRMLIATKPGEEPVFWFGGGMDLTPV-----YGFEDDARHFH 152

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            T K+      V  Y  +K+WCD YF+L HR E RGIGGIFFD   S P   G +  F  
Sbjct: 153 QTCKDALDPFGVELYPRFKKWCDEYFFLKHRNEMRGIGGIFFDDF-SEP---GFERSFDM 208

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + +VGD F++ Y  +V R     + E++R  Q  RRGRY EFNL++D+GT FG ++GG  
Sbjct: 209 MQSVGDAFLQAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRT 268

Query: 294 ESILASMPPLVAW 306
           ESIL SMPP+  W
Sbjct: 269 ESILMSMPPVANW 281


>gi|330957380|gb|EGH57640.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 304

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 145/286 (50%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E+ +  AH          F    W R        GGGR   +  G V EK
Sbjct: 14  DLQDRICIALEQEDGNAH----------FIEDAWTRPAG-----GGGRTRVIENGAVIEK 58

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
             V  S V+G   P              F A G+S+++HP+NPHVP  H N+R  +    
Sbjct: 59  GGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAEKE 118

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP      +  + D + +H   +  C+      Y  YK WCD YF+
Sbjct: 119 GEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDVYPRYKAWCDTYFH 173

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  +VRR     ++ Q
Sbjct: 174 LKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLPIVRRRKAAAYTVQ 229

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 230 QREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|126662826|ref|ZP_01733825.1| coproporphyrinogen III oxidase [Flavobacteria bacterium BAL38]
 gi|126626205|gb|EAZ96894.1| coproporphyrinogen III oxidase [Flavobacteria bacterium BAL38]
          Length = 300

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 159/288 (55%), Gaps = 30/288 (10%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           + LQ+ IC   E ++  A           F    W R +      GGGR   +  G+VFE
Sbjct: 10  QTLQNQICEGLETIDGSAK----------FREDVWERPEG-----GGGRTRVIENGQVFE 54

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG- 144
           K  V +S V+G L P+   ++ G  +  +F A GLS+++HP NP VP VH N R      
Sbjct: 55  KGGVNISAVHGKL-PNTMQKMFGVGEADFF-ACGLSLVIHPKNPMVPTVHSNWRYFEMYD 112

Query: 145 ------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                   WFGGG DLTP      + ++ D   FH T K  C +H    Y +YK+ CD Y
Sbjct: 113 ENGNIINQWFGGGQDLTPY-----YLFEEDAKHFHQTCKNACDKHNPEFYPNYKKKCDEY 167

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F+  HR E+RGIGG+FFD+L ++ +M   D  F+F+S VG+ F++ Y  +V +     F+
Sbjct: 168 FWNAHRFEARGIGGLFFDYLKATEQMSMEDW-FNFVSEVGNSFLQAYVPIVEKRKDLSFT 226

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           E  R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 227 EVQRTWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|332705259|ref|ZP_08425340.1| coproporphyrinogen oxidase [Lyngbya majuscula 3L]
 gi|332356002|gb|EGJ35461.1| coproporphyrinogen oxidase [Lyngbya majuscula 3L]
          Length = 344

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 159/316 (50%), Gaps = 46/316 (14%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + R+R+ Q   + LQ  IC    K++                +  +  DK  +++ GGGR
Sbjct: 21  DSRERVKQ-LMQQLQDTICDALVKVDG---------------IGTFREDKWDRDEGGGGR 64

Query: 75  MATLCAGKVFEKAAVLVSTVYG-DLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              +  G V E+  V  S V+G  L P    Q      + +F ATG S+++HP NP+VP 
Sbjct: 65  SRVIRDGSVLEQGGVNFSEVWGKQLPPSILKQRPEAAGHGFF-ATGTSLVLHPRNPYVPT 123

Query: 134 VHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           VH N R    G  +WFGGGIDLTP      + +  D    H  LKE C  H    Y  +K
Sbjct: 124 VHLNYRYFEAGPVWWFGGGIDLTPY-----YPFAEDAAHLHRQLKEACDAHHPEYYPVFK 178

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD---------------- 230
            WCD YFYL HRQE RG+GG+FFD+      L+  P   G  A                 
Sbjct: 179 SWCDEYFYLKHRQEMRGVGGLFFDYQDGTGKLYRGPHQDGPAAAYSEKLGDLEPRSWEDL 238

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG 290
           F+F++   + F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T 
Sbjct: 239 FAFVTTCSEAFLPAYLPIVERRRDMDYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQTN 298

Query: 291 GNVESILASMPPLVAW 306
           G  ESIL S+PPLV W
Sbjct: 299 GRTESILMSLPPLVRW 314


>gi|28197960|ref|NP_778274.1| coproporphyrinogen III oxidase [Xylella fastidiosa Temecula1]
 gi|32129593|sp|Q87FB2|HEM6_XYLFT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|28056020|gb|AAO27923.1| coproporphyrinogen III oxidase, aerobic [Xylella fastidiosa
           Temecula1]
 gi|307579039|gb|ADN63008.1| coproporphyrinogen III oxidase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 305

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 150/285 (52%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E ++ ++H          F   HW     Q+ + GGGR   L  G VFE+A
Sbjct: 14  LQDRICNVVETIDGQSH----------FHQDHW-----QRTEGGGGRTRLLRDGAVFEQA 58

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
           A+  S V G   P              + A G+S++ HP NP VP  H N+R        
Sbjct: 59  AIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNVRYFRAEREG 118

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
              A WFGGG DLTP      + +D DV+ +H   +++C+      Y  +K WCD YF L
Sbjct: 119 KQVAAWFGGGFDLTPF-----YPFDEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVL 173

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RG+GG+FFD L    E      DF +  AVGD F+  Y  +V R +   + +++
Sbjct: 174 RHRNETRGVGGLFFDDLDKDFER-----DFDYQRAVGDGFLDAYFPIVTRRHDTPYGDRE 228

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 229 RAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 273


>gi|21233441|ref|NP_639358.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770405|ref|YP_245167.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|24211744|sp|Q8P3Q0|HEM6_XANCP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|81303648|sp|Q4UP76|HEM6_XANC8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|21115285|gb|AAM43240.1| coproporphyrinogen III oxidase, aerobic [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575737|gb|AAY51147.1| coproporphyrinogen III oxidase, aerobic [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 299

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 148/286 (51%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E ++ +A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAVEAIDGKAR----------FAEDLW-----QRAEGGGGRTRILRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + A G+S++ HP+NPH+P  H N+R       
Sbjct: 58  AGIGFSDVSGARLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANVRYFRAERD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      +  D DV+ +H T + +C+      Y  +K WCD YF+
Sbjct: 118 GEMVAAWFGGGFDLTPF-----YPVDEDVMHWHRTAQALCAPFGEERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R     + E 
Sbjct: 173 LRHRNETRGVGGLFFDDLGQD-----FERDFAYQRAVGDGFLDAYLPIVERRKDTPYGEA 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 ERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPQVRW 273


>gi|194222917|ref|XP_001502354.2| PREDICTED: similar to coproporphyrinogen oxidase [Equus caballus]
          Length = 415

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 145/258 (56%), Gaps = 23/258 (8%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY-------F 115
           D+ ++++ GGG    L  G VFEKA V +S V+G+LS +   Q+    KN         F
Sbjct: 140 DRWERKEGGGGISCVLQDGHVFEKAGVSISVVHGNLSEEAAKQMRSRGKNLKTKDGKLPF 199

Query: 116 WATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDV 169
            A G+S ++HP NPH P +HFN R            +WFGGG DLTP+  ++      D 
Sbjct: 200 SAMGVSSVIHPKNPHAPTIHFNYRYFEVEDADGNKQWWFGGGCDLTPTYLNQE-----DA 254

Query: 170 IFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDA 229
           + FH TLKE C +H    Y  +K+WCD YF++ HR E RGIGGIFFD L S  +    D 
Sbjct: 255 VHFHRTLKEACDRHGPDLYPKFKKWCDEYFFIAHRGERRGIGGIFFDDLDSPSK----DE 310

Query: 230 DFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG-FK 288
            F F+ +     +  Y  LV+++    F+ Q++  Q +RRGRY EFNLLYD+GT FG F 
Sbjct: 311 VFRFVESCAQAVVPSYIPLVKKHRSDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFT 370

Query: 289 TGGNVESILASMPPLVAW 306
            G  +ESIL S+P    W
Sbjct: 371 PGSRIESILMSLPLTARW 388


>gi|86131009|ref|ZP_01049608.1| Coproporphyrinogen III oxidase [Dokdonia donghaensis MED134]
 gi|85818420|gb|EAQ39580.1| Coproporphyrinogen III oxidase [Dokdonia donghaensis MED134]
          Length = 301

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 158/289 (54%), Gaps = 34/289 (11%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           NLQ  I +  E+L+ +A           F   +W R +      GGGR   +  G +FEK
Sbjct: 11  NLQDQITSTLEQLDGKAS----------FQEDNWNRPEG-----GGGRTRVIENGNIFEK 55

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM------ 140
             V  S V+G+L P+   +  G  ++  F+A GLS+++HP +P VP VH N R       
Sbjct: 56  GGVNTSQVHGEL-PEAMQKYFGV-EDANFFACGLSLVLHPKSPMVPTVHANWRYFEMYDK 113

Query: 141 ---IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
              IV    WFGGG DLTP      + +D D   FH T K  C  H    Y  YK  CD 
Sbjct: 114 EGNIVD--QWFGGGQDLTPY-----YLFDEDATHFHQTCKTACDAHDADFYPKYKARCDE 166

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFY  HR E RGIGG+FFD+  ++ E    D  ++F++ VGD F++ Y  +V R     F
Sbjct: 167 YFYNTHRNEGRGIGGLFFDYCKATEERSMQDW-YNFVTTVGDSFLEAYVPIVERRKDTAF 225

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +++ +  Q +RRGRY EFNL++DKGT FG KT G +ESIL S+PP+V W
Sbjct: 226 AKEQKDWQEVRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPVVQW 274


>gi|134111683|ref|XP_775377.1| hypothetical protein CNBE0930 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258036|gb|EAL20730.1| hypothetical protein CNBE0930 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 336

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 166/306 (54%), Gaps = 33/306 (10%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           ++LQ  I    E++E  A  N    SP   T   +LRD   + + G G    L  G+VFE
Sbjct: 10  KSLQDHIVRTMEQIEAAAPPNEFAPSPAPPT---FLRDAWIRPEGGEGSSCVLADGRVFE 66

Query: 86  KAAVLVSTVYGDLSPDFKDQILG-------TTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
           KA + VS V+G L P  +  +L         T    F+ATGLS+++HP NPHVP VH N 
Sbjct: 67  KAGINVSVVHGKLPPKAQMAMLPDHPSLPEPTGTVPFFATGLSIVIHPRNPHVPTVHLNY 126

Query: 139 RMIV-----TG---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           R        TG   A+WFGGG DLTPS     +  + D + FH TLK  C QH    +  
Sbjct: 127 RYFEIEDPETGKPKAWWFGGGSDLTPS-----YLDEADAVHFHKTLKHACDQHDERYWPD 181

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHL------HSSPEMG-GIDAD--FSFISAVGDCF 241
           +K  CDRYF + HR E RG+GGIFFD L      H+ P+   G  A+  F F+ +    F
Sbjct: 182 FKRQCDRYFTITHRGECRGLGGIFFDDLTTTSPVHAPPDGAQGPSAEKIFEFVKSASAAF 241

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASM 300
           +  Y  +V ++ +  ++ ++++ Q +RRGRY EFNL+YD+GT FG  T G  +ESIL S+
Sbjct: 242 LPAYVPIVYKHMNDSWTPEEKRWQQLRRGRYVEFNLVYDRGTKFGLNTPGARIESILMSL 301

Query: 301 PPLVAW 306
           P    W
Sbjct: 302 PETARW 307


>gi|281347149|gb|EFB22733.1| hypothetical protein PANDA_015075 [Ailuropoda melanoleuca]
          Length = 396

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 166/317 (52%), Gaps = 32/317 (10%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
           C +     D  E R R S  K +    I+ T+ +  +  A  +   R    F+V  W   
Sbjct: 72  CFMAPPVTDLRELRGRPSDMKTKMELLILETQAQVCQALAQVDGGAR----FSVDRW--- 124

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ------ILGTTKNPY-FW 116
             ++++ GGG    L  G VFEKA V +S V+G+LS +   Q      IL T      F 
Sbjct: 125 --ERKEGGGGISCVLQDGHVFEKAGVSISVVHGNLSEEAAKQMRSRGKILKTKDGKLPFS 182

Query: 117 ATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVI 170
           A G+S ++HP NPH P +HFN R            +WFGGG DLTP+  ++      D +
Sbjct: 183 AMGVSSVIHPKNPHAPTIHFNYRYFEIEEADGNKQWWFGGGCDLTPTYLNQE-----DAV 237

Query: 171 FFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDAD 230
            FH TLKE C QH    Y  +K+WCD YF++ HR E RGIGGIFFD L S  +    +  
Sbjct: 238 HFHRTLKEACDQHGPDLYPKFKKWCDDYFFIVHRGERRGIGGIFFDDLDSPSK----EEV 293

Query: 231 FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFG-FKT 289
           F F+ +     +  Y  LV++++   F+ Q++  Q +RRGRY EFNLLYD+GT FG F  
Sbjct: 294 FRFVQSCAQAVVPSYIPLVKKHHDESFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTP 353

Query: 290 GGNVESILASMPPLVAW 306
           G  +ESIL S+P    W
Sbjct: 354 GSRIESILMSLPLTARW 370


>gi|307730385|ref|YP_003907609.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1003]
 gi|307584920|gb|ADN58318.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1003]
          Length = 307

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 151/281 (53%), Gaps = 16/281 (5%)

Query: 32  ICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLV 91
           + T  + L+    +       K F    W R   +K   GGG    L  G  FE+A +  
Sbjct: 11  VRTWLQSLQTHIADTLGAFDGKPFATDAWQRTPGEKLR-GGGCTRILEGGNFFERAGIGF 69

Query: 92  STVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG------A 145
           S V GD  P              F A G+S+++HP+NPH P VH N+R+++         
Sbjct: 70  SDVAGDALPGSASAARPQLAGRGFEAMGVSLVLHPHNPHCPTVHMNVRLLIATKAGEEPV 129

Query: 146 YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQ 205
           +WFGGG+DLTP      + Y+ D   FH T ++    +    Y  +K WCD YF+L HR 
Sbjct: 130 FWFGGGMDLTPY-----YGYEEDAQHFHRTCRDALEPYGADLYPSFKRWCDEYFFLKHRN 184

Query: 206 ESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQ 265
           E+RGIGGIFFD  +S+P   G +  F+ + +VG+ F+K Y  ++ +  +  + + +R  Q
Sbjct: 185 EARGIGGIFFDD-YSAP---GFEQSFAMLKSVGEGFLKAYLPIIEKRRNIPYGQAERDFQ 240

Query: 266 LIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 241 AYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVANW 281


>gi|17228146|ref|NP_484694.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
 gi|41017220|sp|Q8YZ37|HEM61_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic 1;
           Short=Coprogen oxidase 1; Short=Coproporphyrinogenase 1
 gi|17129996|dbj|BAB72608.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
          Length = 317

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 143/267 (53%), Gaps = 28/267 (10%)

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           D  ++ + GGGR   L  G +FE+A V  S V+G   P          +   F+ATG S+
Sbjct: 24  DSWERPEGGGGRSRVLRDGAIFEQAGVNFSEVWGSHLPPSILAQRPEAEGHGFYATGTSL 83

Query: 123 IVHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           ++HP NP+VP VH N R    G  +WFGGG DLTP      + +  D   FH TLK  C 
Sbjct: 84  VLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPY-----YPFAEDAAHFHQTLKLACD 138

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDH------LHSSPEMGGIDAD----- 230
           +H    Y  +K WCD YFYL HR E+RG+GG+FFD+      L+  P   G  A+     
Sbjct: 139 EHHPEYYPVFKRWCDEYFYLKHRDETRGVGGLFFDYQDGQGVLYRGPNPKGEAANYSNQV 198

Query: 231 -----------FSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
                      FSFI   G  F+  Y  +V R +   + ++ R  QL RRGRY EFNL+Y
Sbjct: 199 GEPASRDWEDLFSFIQGSGKAFLPAYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVY 258

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 259 DRGTIFGLQTNGRTESILMSLPPLVRW 285


>gi|88802331|ref|ZP_01117858.1| coproporphyrinogen III oxidase [Polaribacter irgensii 23-P]
 gi|88781189|gb|EAR12367.1| coproporphyrinogen III oxidase [Polaribacter irgensii 23-P]
          Length = 300

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 162/290 (55%), Gaps = 34/290 (11%)

Query: 26  ENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFE 85
           ENLQ  I ++ E ++  A                +  D  ++E+ GGGR   +  G VFE
Sbjct: 10  ENLQDQITSKLEAVDGLAK---------------FEEDIWEREEGGGGRTRVIENGGVFE 54

Query: 86  KAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM----- 140
           K  V +S V+G+L    ++Q      N  F+A GLS+++HP NP VP VH N R      
Sbjct: 55  KGGVNISAVHGELPEALRNQFKVAEGN--FFACGLSLVMHPINPFVPTVHANWRYFEMYD 112

Query: 141 ----IVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
               IVT   WFGGG DLTP      + ++ D + FH   K  C  H    Y+ +K+ CD
Sbjct: 113 GAGNIVT--QWFGGGQDLTPY-----YLFEEDAVHFHTVCKSACDLHNTEFYSKFKKTCD 165

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YF+  HR E+RGIGG+FFD+L  + ++  +D  F+F++ +G+ F++ Y  +V +     
Sbjct: 166 AYFWNAHRNEARGIGGLFFDYLKETDDISILDR-FNFVTEIGNSFLESYVPIVEKRKGKE 224

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           F +  +  Q +RRGRY EFNL++D+GT FG KT G +ESIL S+PP+V W
Sbjct: 225 FKKMHKDWQEVRRGRYVEFNLVHDRGTLFGLKTNGRIESILMSLPPIVQW 274


>gi|188993607|ref|YP_001905617.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|226740907|sp|B0RYP5|HEM6_XANCB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167735367|emb|CAP53581.1| Aerobic coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris]
          Length = 299

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 148/286 (51%), Gaps = 31/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC   E ++ +A           F    W     Q+ + GGGR   L  G VFE+
Sbjct: 13  DLQDRICAAVEAIDGKAR----------FAEDLW-----QRAEGGGGRTRILRDGAVFEQ 57

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG-- 144
           A +  S V G   P              + A G+S++ HP+NPH+P  H N+R       
Sbjct: 58  AGIGFSDVSGARLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANVRYFRAERD 117

Query: 145 ----AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
               A WFGGG DLTP      +  D DV+ +H T + +C+      Y  +K WCD YF+
Sbjct: 118 GEMVAAWFGGGFDLTPF-----YPVDEDVMHWHRTAQALCAPFGEERYAAHKRWCDEYFF 172

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R     + E 
Sbjct: 173 LRHRDETRGVGGLFFDDLGQD-----FERDFAYQRAVGDGFLDAYLPIVERRKDTPYGEA 227

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 228 ERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPQVRW 273


>gi|295675991|ref|YP_003604515.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1002]
 gi|295435834|gb|ADG15004.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1002]
          Length = 307

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 143/258 (55%), Gaps = 16/258 (6%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           F    W R   +K   GGG    L  G+ FE+A +  S V GD  P              
Sbjct: 34  FATDAWQRGPGEKLR-GGGVTRILEGGQFFERAGIGFSDVAGDALPGSASAARPQLAGRG 92

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPD 168
           F A G+S+++HP+NPH P VH N+R+++         +WFGGG+DLTP      + Y+ D
Sbjct: 93  FEAMGVSLVLHPHNPHCPTVHMNVRLLIATREGEEPVFWFGGGMDLTPY-----YGYEED 147

Query: 169 VIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGID 228
              FH    +  + +    Y  +K WCD YF+L HR E+RGIGGIFFD   S+P   G  
Sbjct: 148 ARHFHQVCHDALAPYGADLYPSFKRWCDEYFFLKHRNEARGIGGIFFDDF-SAP---GFA 203

Query: 229 ADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFK 288
             F+ + +VG+ F+K Y  ++ R  +  + E +R  Q  RRGRY EFNL++D+GT FG +
Sbjct: 204 QSFAMLKSVGEGFLKAYLPIIERRRNTPYGEAERAFQAYRRGRYVEFNLVFDRGTLFGLQ 263

Query: 289 TGGNVESILASMPPLVAW 306
           +GG  ESIL SMPP+V W
Sbjct: 264 SGGRTESILMSMPPVVNW 281


>gi|120611859|ref|YP_971537.1| coproporphyrinogen III oxidase [Acidovorax citrulli AAC00-1]
 gi|120590323|gb|ABM33763.1| Coproporphyrinogen oxidase [Acidovorax citrulli AAC00-1]
          Length = 323

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 151/303 (49%), Gaps = 29/303 (9%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D  ER R       +LQS I    E +E +            F    W   K+  E L
Sbjct: 17  PPDAAERVRA---YLVDLQSRITNAVESVEGQGGAR--------FLSDAW--SKAPGEPL 63

Query: 71  -GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            G G    L  G+VFE+A    S V G   P    Q         F A G+S++ HP NP
Sbjct: 64  QGDGVTRILEGGRVFERAGCGFSHVRGAALPPSATQHRPELAGAPFEAMGVSLVFHPVNP 123

Query: 130 HVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP VH N+RMI           WFGGG+DLTP      + ++ D + FH + ++     
Sbjct: 124 YVPTVHMNVRMIAAARDGQPPVCWFGGGMDLTPY-----YGFEEDAVHFHRSCRDAVYPF 178

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K WCD YFYL HR E RGIGGIFFD         G D   + + +VGD F+ 
Sbjct: 179 GEGLYLRFKRWCDEYFYLKHRDEQRGIGGIFFDDFSEL----GFDRSLAMMQSVGDAFLG 234

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V+R     F +++R  Q  RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL
Sbjct: 235 AYLPIVQRRQGIYFGDRERSFQCYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPL 294

Query: 304 VAW 306
             W
Sbjct: 295 AGW 297


>gi|256084788|ref|XP_002578608.1| coproporphyrinogen oxidase [Schistosoma mansoni]
 gi|238663987|emb|CAZ34846.1| coproporphyrinogen oxidase [Schistosoma mansoni]
          Length = 386

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 153/292 (52%), Gaps = 37/292 (12%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  +C E EK++ +A           F V  W R        GGG    L  G VFEKA
Sbjct: 93  LQGRLCKEIEKIDRKAK----------FKVDKWERRAG-----GGGISCVLENGDVFEKA 137

Query: 88  AVLVSTVYGDLSPDFKDQI------LGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            V +S + G+LS     ++      +   K   F+A G+S ++HP NP+VP  HFN R  
Sbjct: 138 GVNISVISGNLSGQAVKEMRARHNEIDPNKECKFFACGISSVIHPLNPYVPTTHFNFRYF 197

Query: 142 VTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +W+GGG DLTP      + ++ D   FH  LK  C QH    Y  +K+WC
Sbjct: 198 EVDLGNNRKCWWYGGGADLTPY-----YLFNEDAKHFHEQLKLACDQHDELFYPRFKKWC 252

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E+RGIGGIFFD L  + +    +  FSF+ +  +  I  Y  +V +  H 
Sbjct: 253 DNYFYLTHRGETRGIGGIFFDDLEDTSQ----EKVFSFVKSCAEAIIPAYLPIVEKRRHL 308

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW 306
            ++ ++R+ QL+RRGRY EFNL+YD+GT FG  T    +ESIL S+P    W
Sbjct: 309 KYTNKEREWQLVRRGRYVEFNLIYDRGTKFGLATPEARIESILMSLPRYAQW 360


>gi|182680587|ref|YP_001828747.1| coproporphyrinogen III oxidase [Xylella fastidiosa M23]
 gi|182630697|gb|ACB91473.1| Coproporphyrinogen oxidase [Xylella fastidiosa M23]
          Length = 331

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 150/285 (52%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E ++ ++H          F   HW     Q+ + GGGR   L  G VFE+A
Sbjct: 40  LQDRICNVVETIDGQSH----------FHQDHW-----QRTEGGGGRTRLLRDGAVFEQA 84

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
           A+  S V G   P              + A G+S++ HP NP VP  H N+R        
Sbjct: 85  AIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNVRYFRAEREG 144

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
              A WFGGG DLTP      + +D DV+ +H   +++C+      Y  +K WCD YF L
Sbjct: 145 KQVAAWFGGGFDLTPF-----YPFDEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVL 199

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RG+GG+FFD L         + DF +  AVGD F+  Y  +V R +   + +++
Sbjct: 200 RHRNETRGVGGLFFDDLDKD-----FERDFDYQRAVGDGFLDAYFPIVTRRHDTPYGDRE 254

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 255 RAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 299


>gi|206560749|ref|YP_002231514.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia J2315]
 gi|226740646|sp|B4E5R8|HEM6_BURCJ RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|198036791|emb|CAR52691.1| coproporphyrinogen III oxidase, aerobic [Burkholderia cenocepacia
           J2315]
          Length = 307

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 142/253 (56%), Gaps = 16/253 (6%)

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R  +++   GGG    L  G+VFE+A +  S V GD  P              F A G
Sbjct: 39  WQRGPAERLR-GGGCTRILEGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALG 97

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +S+++HP NP+ P VH N+RM++         +WFGGG+DLTP      + ++ D   FH
Sbjct: 98  VSLVLHPRNPYCPTVHMNVRMLIATKPGEAPVFWFGGGMDLTPV-----YGFEDDARHFH 152

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            T K+      +  Y  +K+WCD YF+L HR E+RGIGGIFFD   S P   G +  F  
Sbjct: 153 QTCKDALDPFGIELYPRFKQWCDEYFFLKHRNETRGIGGIFFDDF-SEP---GFERSFDL 208

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + +VGD F+  Y  +V R     + E++R  Q  RRGRY EFNL++D+GT FG ++GG  
Sbjct: 209 MQSVGDAFLHAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRT 268

Query: 294 ESILASMPPLVAW 306
           ESIL SMPP+  W
Sbjct: 269 ESILMSMPPVANW 281


>gi|107023234|ref|YP_621561.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia AU 1054]
 gi|116690317|ref|YP_835940.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia HI2424]
 gi|105893423|gb|ABF76588.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia AU 1054]
 gi|116648406|gb|ABK09047.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia HI2424]
          Length = 323

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 141/253 (55%), Gaps = 16/253 (6%)

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R  +++   GGG    L  G+VFE+A +  S V GD  P              F A G
Sbjct: 55  WQRGPAERLR-GGGCTRILEGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALG 113

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +S+++HP NP+ P VH N+RM++         +WFGGG+DLTP      + ++ D   FH
Sbjct: 114 VSLVLHPRNPYCPTVHMNVRMLIATKPGEAPVFWFGGGMDLTPV-----YGFEDDARHFH 168

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            T K+         Y  +K+WCD YF+L HR E+RGIGGIFFD   S P   G +  F  
Sbjct: 169 QTCKDALDPFGAELYPRFKQWCDEYFFLKHRNETRGIGGIFFDDF-SEP---GFERSFDM 224

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + +VGD F+  Y  +V R     + E++R  Q  RRGRY EFNL++D+GT FG ++GG  
Sbjct: 225 MQSVGDAFLNAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRT 284

Query: 294 ESILASMPPLVAW 306
           ESIL SMPP+  W
Sbjct: 285 ESILMSMPPVANW 297


>gi|321258905|ref|XP_003194173.1| coproporphyrinogen oxidase [Cryptococcus gattii WM276]
 gi|317460644|gb|ADV22386.1| coproporphyrinogen oxidase, putative [Cryptococcus gattii WM276]
          Length = 340

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 165/313 (52%), Gaps = 43/313 (13%)

Query: 26  ENLQSIICTEFEKLENEAHEN--SANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
           ++LQ  I    E +E  A  N  S + +P  F    W+R +      G G    L  G+V
Sbjct: 10  KSLQDHIVNTMEHIEASAAPNDFSPSTTPPTFLRDAWIRPEG-----GEGSSCVLADGRV 64

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILG--------TTKNPYFWATGLSVIVHPYNPHVPAVH 135
           FEKA + VS V+G L P  +  +L         T   P+F ATGLS+++HP NPHVP VH
Sbjct: 65  FEKAGINVSVVHGKLPPKAQKAMLPDHPSLPEPTATVPFF-ATGLSIVIHPRNPHVPTVH 123

Query: 136 FNIRMI---------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            N R              A+WFGGG DLTPS     +  + D + FH TLK+ C QH   
Sbjct: 124 LNYRYFEIEDPEQPGKPKAWWFGGGSDLTPS-----YLDEADAVHFHKTLKQACDQHDER 178

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHL------HSSPEMG----GIDAD--FSFI 234
            +  +K+ CD+YF + HR E RG+GGIFFD L      H+ P       G  A+  F F+
Sbjct: 179 YWPDFKKQCDKYFTITHRGECRGVGGIFFDDLTTTSPVHAPPPTDSAATGPSAEKIFEFV 238

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNV 293
            +    F+  Y  +V ++ +  ++ ++++ Q +RRGRY EFNL+YD+GT FG  T G  +
Sbjct: 239 KSASSAFLPAYVPIVYKHMNDQWTPEEKRWQQLRRGRYVEFNLVYDRGTKFGLNTPGARI 298

Query: 294 ESILASMPPLVAW 306
           ESIL S+P    W
Sbjct: 299 ESILMSLPETARW 311


>gi|326316865|ref|YP_004234537.1| Coproporphyrinogen oxidase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323373701|gb|ADX45970.1| Coproporphyrinogen oxidase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 323

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 151/303 (49%), Gaps = 29/303 (9%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P D  ER R       +LQS I    E +E +            F    W   K+  E L
Sbjct: 17  PPDAAERVRA---YLVDLQSRITNAIESVEGQGGAR--------FLSDAW--SKAPGEPL 63

Query: 71  -GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            G G    L  G+VFE+A    S V G   P    Q         F A G+S++ HP NP
Sbjct: 64  QGDGITRILEGGRVFERAGCGFSHVRGAALPPSATQHRPELAGAPFEAMGVSLVFHPINP 123

Query: 130 HVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP VH N+RMI           WFGGG+DLTP      + ++ D + FH + ++     
Sbjct: 124 YVPTVHMNVRMIAAARDGQPPVCWFGGGMDLTPY-----YGFEEDAVHFHRSCRDAVYPF 178

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K WCD YFYL HR E RGIGGIFFD         G D   + + +VGD F+ 
Sbjct: 179 GEGLYLRFKRWCDEYFYLKHRDEQRGIGGIFFDDFSEL----GFDRSLAMMQSVGDAFLG 234

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V+R     F +++R  Q  RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL
Sbjct: 235 AYLPIVQRRQGIYFGDRERSFQCYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPL 294

Query: 304 VAW 306
             W
Sbjct: 295 AGW 297


>gi|90855440|dbj|BAE92558.1| coproporphyrinogen oxidase [Danio rerio]
          Length = 449

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 161/314 (51%), Gaps = 49/314 (15%)

Query: 14  IEERKRISQRKFENL----QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
           +E+RK     + E L    QS  C   E+++  +           F V  W R +     
Sbjct: 138 LEQRKDEMSTRMEMLIMETQSAFCRALEQVDGGS-----------FRVDRWSRKEG---- 182

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-------ILGTTKNPYFWATGLSV 122
            GGG    +  GK+FEKA V VS VYG+L+ +   Q       + G      F A G+S 
Sbjct: 183 -GGGISCVMQDGKIFEKAGVNVSVVYGNLTEEAARQMRSRGKILKGKDGKLPFRAMGVSS 241

Query: 123 IVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTP---SLESRRHSYDPDVIFFH 173
           ++HP NPH+P VHFN R         T  +WFGGG DLTP    LE        D   FH
Sbjct: 242 VIHPKNPHIPTVHFNYRYFEIEEADGTKQWWFGGGTDLTPVYIDLE--------DATHFH 293

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            TLKE C +H    Y  +K+WCD YFY+ HR E+RGIGGIFFD L S  +    D  F+F
Sbjct: 294 KTLKEACDKHHPKYYPDFKKWCDNYFYIRHRGETRGIGGIFFDDLDSPDQ----DEVFNF 349

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGN 292
           + +     +  Y  +V ++ +  F+ +++  Q +RRGRY EFNL+YD+G  FG  T G  
Sbjct: 350 VRSCAKTVVPCYLPIVYKHLNDSFTPEEKDWQQVRRGRYVEFNLVYDRGVKFGLATPGSR 409

Query: 293 VESILASMPPLVAW 306
           +ESIL S+P    W
Sbjct: 410 IESILMSLPLTARW 423


>gi|289742223|gb|ADD19859.1| coproporphyrinogen III oxidase CPO/HEM13 [Glossina morsitans
           morsitans]
          Length = 395

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/265 (41%), Positives = 146/265 (55%), Gaps = 28/265 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI------LG 108
           F V  WLR +      GGG    L  G+VFEKA V +S V G L P    Q+      L 
Sbjct: 112 FKVDRWLRPEG-----GGGITCVLQDGEVFEKAGVNISVVTGHLPPSAVQQMRTRGKKLS 166

Query: 109 TTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTPSLESRR 162
             + P+F A G+S ++HP NP VP +HFN R         +  +WFGGG DLTP      
Sbjct: 167 EGERPFF-AAGVSAVIHPRNPMVPTIHFNYRYFEVENNDGSRQWWFGGGTDLTPY----- 220

Query: 163 HSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP 222
           +  + D I FH  LK  C +H +  Y  +K+WCD YF + HR E RG+GGIFFD + S  
Sbjct: 221 YLDEEDAIHFHKALKNACDEHDILYYPKFKKWCDDYFRIEHRNECRGLGGIFFDDIDSPS 280

Query: 223 EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKG 282
           +    +  + F+SA     I  Y  LVRR+ +  + +++RQ QL+RRGRY EFNL+YD+G
Sbjct: 281 Q----EDAYKFVSACAHAVIPSYLPLVRRHKNDEYGDRERQWQLLRRGRYVEFNLIYDRG 336

Query: 283 TNFGFKT-GGNVESILASMPPLVAW 306
           T FG  T G   ESIL S+P    W
Sbjct: 337 TKFGLYTPGARYESILMSLPLTARW 361


>gi|122890967|emb|CAK04614.2| coproporphyrinogen oxidase [Danio rerio]
          Length = 449

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 161/314 (51%), Gaps = 49/314 (15%)

Query: 14  IEERKRISQRKFENL----QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
           +E+RK     + E L    QS  C   E+++  +           F V  W R +     
Sbjct: 138 LEQRKDEMSTRMEMLIMETQSAFCRALEQVDGGS-----------FRVDRWSRKEG---- 182

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-------ILGTTKNPYFWATGLSV 122
            GGG    +  GK+FEKA V VS VYG+L+ +   Q       + G      F A G+S 
Sbjct: 183 -GGGISCVMQDGKIFEKAGVNVSVVYGNLTEEAARQMRSRGKILKGKDGKLPFRAMGVSS 241

Query: 123 IVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTP---SLESRRHSYDPDVIFFH 173
           ++HP NPH+P VHFN R         T  +WFGGG DLTP    LE        D   FH
Sbjct: 242 VIHPKNPHIPTVHFNYRYFEIEEADGTKQWWFGGGTDLTPVYIDLE--------DATHFH 293

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            TLKE C +H    Y  +K+WCD YFY+ HR E+RGIGGIFFD L S  +    D  F+F
Sbjct: 294 KTLKEACDKHHPKYYPDFKKWCDNYFYIRHRGETRGIGGIFFDDLDSPDQ----DEVFNF 349

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGN 292
           + +     +  Y  +V ++ +  F+ +++  Q +RRGRY EFNL+YD+G  FG  T G  
Sbjct: 350 VRSCAKTVVPCYLPIVYKHLNDSFTPEEKDWQQVRRGRYVEFNLVYDRGVKFGLATPGSR 409

Query: 293 VESILASMPPLVAW 306
           +ESIL S+P    W
Sbjct: 410 IESILMSLPLTARW 423


>gi|254247617|ref|ZP_04940938.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia PC184]
 gi|124872393|gb|EAY64109.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia PC184]
          Length = 323

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 141/253 (55%), Gaps = 16/253 (6%)

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R  +++   GGG    L  G+VFE+A +  S V GD  P              F A G
Sbjct: 55  WQRGPAERLR-GGGCTRILEGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALG 113

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +S+++HP NP+ P VH N+RM++         +WFGGG+DLTP      + ++ D   FH
Sbjct: 114 VSLVLHPRNPYCPTVHMNVRMLIATKPGEAPVFWFGGGMDLTPV-----YGFEDDARHFH 168

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            T K+         Y  +K+WCD YF+L HR E+RGIGGIFFD   S P   G +  F  
Sbjct: 169 QTCKDALDPFGAELYPRFKQWCDEYFFLKHRNETRGIGGIFFDDF-SEP---GFERSFDL 224

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + +VGD F+  Y  +V R     + E++R  Q  RRGRY EFNL++D+GT FG ++GG  
Sbjct: 225 MQSVGDAFLNAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRT 284

Query: 294 ESILASMPPLVAW 306
           ESIL SMPP+  W
Sbjct: 285 ESILMSMPPVANW 297


>gi|315044895|ref|XP_003171823.1| coproporphyrinogen III oxidase [Arthroderma gypseum CBS 118893]
 gi|311344166|gb|EFR03369.1| coproporphyrinogen III oxidase [Arthroderma gypseum CBS 118893]
          Length = 434

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 158/306 (51%), Gaps = 45/306 (14%)

Query: 36  FEKLENEAHENSANRSPKI----FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLV 91
            EKL  E  +   +   KI    FT+  W R        GGG    L  G VFEKA V V
Sbjct: 100 MEKLIKEQQKRIIDELAKIDGNSFTIDEWNRPNG-----GGGISCVLQDGNVFEKAGVNV 154

Query: 92  STVYGDLS--------PDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM--- 140
           S VYG L          D K  +     +  F+A GLS+++HP NP  P VH N R    
Sbjct: 155 SVVYGKLPRPAIEKMRADHKSFVSADVDSLDFFAAGLSLVLHPKNPMAPTVHLNYRYFET 214

Query: 141 -----IVTGA--YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
                +V G   +WFGGG DLTPS     + +  D   FH T+K++C +H  + +  +K 
Sbjct: 215 ADPKDVVNGQTNWWFGGGTDLTPS-----YLFPEDCEHFHKTIKDVCDKHDTSYFPQFKA 269

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHL------HSSPEMGGIDAD------FSFISAVGDCF 241
           WCD+YFYLPHR E+RGIGGIFFD L       SSP +            FSF++     F
Sbjct: 270 WCDKYFYLPHRNEARGIGGIFFDDLDTEFIRQSSPHLASTSNKEAQERIFSFVTDGLCSF 329

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASM 300
           +  Y  ++ +     F+EQ +  Q +RRGRY EFNL++D+GT+FG +T G  +ESIL S+
Sbjct: 330 LPSYVPILNKRKDMPFTEQQKDWQQLRRGRYVEFNLVHDRGTSFGLRTPGARIESILMSL 389

Query: 301 PPLVAW 306
           P    W
Sbjct: 390 PRTAKW 395


>gi|9104779|gb|AAF82830.1|AE003856_9 coproporphyrinogen III oxidase, aerobic [Xylella fastidiosa 9a5c]
          Length = 319

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 150/285 (52%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E ++ ++H          F   HW     Q+ + GGGR   L  G VFE+A
Sbjct: 28  LQDRICNVVETIDGQSH----------FHEDHW-----QRTEGGGGRTRLLRDGAVFEQA 72

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
            +  S V G   P              + A G+S++ HP NP VP  H N+R        
Sbjct: 73  GIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNVRYFRAERDG 132

Query: 145 ---AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYL 201
              A WFGGG DLTP      + +D DV+ +H   +++C+      Y  +K WCD YF L
Sbjct: 133 KQVAAWFGGGFDLTPF-----YPFDEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVL 187

Query: 202 PHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQD 261
            HR E+RG+GG+FFD L    E      DF++  AVGD F+  Y  +V R +   + +++
Sbjct: 188 RHRNETRGVGGLFFDDLDKDFER-----DFAYQRAVGDGFLDAYFPIVTRRHDTPYGDRE 242

Query: 262 RQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 243 RAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 287


>gi|332533671|ref|ZP_08409530.1| coproporphyrinogen III oxidase, aerobic [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036835|gb|EGI73296.1| coproporphyrinogen III oxidase, aerobic [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 316

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 147/288 (51%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
           F  LQ  IC   E  +  A                ++ D  Q+ + GGGR      G V 
Sbjct: 13  FMALQDTICQGLEAADGSAK---------------FIEDNWQRAEGGGGRTRVTTNGTVI 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+  V  S V+G   P              F A G+S+++HP NPHVP  H N+R  +  
Sbjct: 58  EQGGVNYSHVFGASMPGSATAHRPELAGRSFHACGVSLVIHPKNPHVPTSHANVRFFIAE 117

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP      +    DV  +H    ++C+      Y  YK WCD Y
Sbjct: 118 KEGEEPIWWFGGGFDLTPF-----YPVLEDVQHWHQVAHDICAPFGSEVYPKYKTWCDEY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+      G +  F+F+ +VG+ F+  Y  ++ R  +  ++
Sbjct: 173 FYLKHRDETRGVGGLFFDDLNEL----GFEQSFAFMQSVGNGFLDAYLPIIERRKNDEYT 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EQ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 229 EQQRDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|187931622|ref|YP_001891606.1| coproporphyrinogen III oxidase [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254800273|sp|B2SGG9|HEM6_FRATM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|187712531|gb|ACD30828.1| coproporphyrinogen III oxidase, aerobic [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 308

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 158/294 (53%), Gaps = 29/294 (9%)

Query: 24  KFEN----LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG-GRMATL 78
           KFE+    LQ  I T  E+     HE +A +    F    W +  +  + L G G    +
Sbjct: 7   KFEDFLTQLQQNITTVLEQ-----HETNAAK----FISDKWQKPDTPDQKLKGYGNSMII 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FEK  V  S V+G   P              F ATGLS+++HP NP VP  H N 
Sbjct: 58  EGGEIFEKGVVAFSRVHGSELPPSATAKRQELAGKSFIATGLSLVIHPRNPFVPTSHANF 117

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ +  A      +WFGGG DLTP      + ++ D I +H T K +C +H    Y  +K
Sbjct: 118 RIFIADADTDNPIWWFGGGFDLTP-----YYPFEEDAIHWHQTAKNICDKHDKTYYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+        D  F+F++   + ++  Y  +V + 
Sbjct: 173 KWCDEYFYLKHRDECRGVGGLFFDDLNDK----SFDECFNFVTDCANSYLDAYIPIVAQR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S++ +  QL RRGRY EFNL++D+GT FG ++GG  ESIL+SMPP+  W
Sbjct: 229 KNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTIFGLQSGGRTESILSSMPPMATW 282


>gi|226939646|ref|YP_002794719.1| coproporphyrinogen III oxidase [Laribacter hongkongensis HLHK9]
 gi|226714572|gb|ACO73710.1| Hem6 [Laribacter hongkongensis HLHK9]
          Length = 304

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 137/251 (54%), Gaps = 15/251 (5%)

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           RD  Q+   GGG    L  G +FE+  V  S V G   P              F A G+S
Sbjct: 35  RDGWQRPAGGGGLSCVLEEGALFERGGVNFSHVQGGALPASATAARPELAGRAFEAMGVS 94

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
           +++HP NP+VP  H N+R+ +  A      +WFGGG+DLTP      +    D + FH  
Sbjct: 95  LVLHPRNPYVPTTHMNVRVFMATAEGQPPVWWFGGGMDLTPY-----YGEAEDAVHFHRV 149

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
            ++  +      Y  YK WCDRYF+L HR E RGIGG+FFD L+      G +  F+   
Sbjct: 150 CRDALAPFGADRYPAYKAWCDRYFFLRHRNEPRGIGGVFFDDLNDL----GFEQSFALTR 205

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           +VGD F++ Y  +V++     F  Q R+ Q IRRGRY EFNL++D+GT FG ++GG  ES
Sbjct: 206 SVGDAFLEAYVPIVQKRQQQPFGAQQREWQAIRRGRYVEFNLVFDRGTLFGLQSGGRTES 265

Query: 296 ILASMPPLVAW 306
           IL SMPP V W
Sbjct: 266 ILMSMPPQVQW 276


>gi|116812896|ref|NP_001035183.2| coproporphyrinogen-III oxidase, mitochondrial [Danio rerio]
 gi|116284175|gb|AAI24460.1| Coproporphyrinogen oxidase [Danio rerio]
          Length = 449

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 161/314 (51%), Gaps = 49/314 (15%)

Query: 14  IEERKRISQRKFENL----QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
           +E+RK     + E L    QS  C   E+++  +           F V  W R +     
Sbjct: 138 LEQRKDEMSTRMEMLIMETQSAFCRALEQVDGGS-----------FRVDRWSRKEG---- 182

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-------ILGTTKNPYFWATGLSV 122
            GGG    +  GK+FEKA V VS VYG+L+ +   Q       + G      F A G+S 
Sbjct: 183 -GGGISCVMQDGKIFEKAGVNVSVVYGNLTEEAARQMRSRGKILKGKDGKLPFRAMGVSS 241

Query: 123 IVHPYNPHVPAVHFNIRMIV------TGAYWFGGGIDLTP---SLESRRHSYDPDVIFFH 173
           ++HP NPH+P VHFN R         T  +WFGGG DLTP    LE        D   FH
Sbjct: 242 VIHPKNPHIPTVHFNYRYFEIEEADGTKQWWFGGGTDLTPVYIDLE--------DATHFH 293

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
            TLKE C +H    Y  +K+WCD YFY+ HR E+RGIGGIFFD L S  +    D  F+F
Sbjct: 294 KTLKEACDKHHPKYYPDFKKWCDNYFYIRHRGETRGIGGIFFDDLDSPDQ----DEVFNF 349

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGN 292
           + +     +  Y  +V ++ +  F+ +++  Q +RRGRY EFNL+YD+G  FG  T G  
Sbjct: 350 VRSCAKTVVPCYLPIVYKHLNDSFTPEEKDWQQVRRGRYVEFNLVYDRGVKFGLATPGSR 409

Query: 293 VESILASMPPLVAW 306
           +ESIL S+P    W
Sbjct: 410 IESILMSLPLTARW 423


>gi|436577|dbj|BAA03840.1| coproporphyrinogen oxidase [Mus musculus]
          Length = 354

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 148/266 (55%), Gaps = 28/266 (10%)

Query: 55  FTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY 114
           FTV  W     ++++ GGG    L  G+VFEKA V +S V+G+LS +  +Q+ G  K   
Sbjct: 76  FTVDRW-----ERKEGGGGITCVLQDGRVFEKAGVSISVVHGNLSEEAANQMRGRGKTLK 130

Query: 115 -------FWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESR 161
                  F A G+S ++HP NP+ P +HFN R            +WFGGG DLTP     
Sbjct: 131 TKDSKLPFTAMGVSSVIHPKNPYAPTMHFNYRYFEVEEADGNTHWWFGGGCDLTP----- 185

Query: 162 RHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS 221
           R+    D + FH TLKE C QH    Y  +K+WCD YF++ HR E RGIGGIFFD L S 
Sbjct: 186 RYLNQEDAVHFHRTLKEACDQHGPDIYPKFKKWCDDYFFIVHRGERRGIGGIFFDDLDSP 245

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            +    +  F F+    +  +  Y  +V+++    ++ +D+  Q +RRGRY EFNLLYD+
Sbjct: 246 SK----EEAFRFVKTCAEAVVPSYVPIVKKHCDDSYTPRDKLWQQLRRGRYVEFNLLYDR 301

Query: 282 GTNFG-FKTGGNVESILASMPPLVAW 306
           GT FG F  G  +ESIL S+P    W
Sbjct: 302 GTKFGLFTPGSRIESILMSLPLTARW 327


>gi|195436991|ref|XP_002066428.1| GK18283 [Drosophila willistoni]
 gi|194162513|gb|EDW77414.1| GK18283 [Drosophila willistoni]
          Length = 393

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 147/263 (55%), Gaps = 24/263 (9%)

Query: 58  KHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN----- 112
           + ++ D+ Q+++ GGG    L  G VFEKA V +S V G L P    Q+    KN     
Sbjct: 115 QKFIVDRWQRKEGGGGITCVLQDGDVFEKAGVNISVVTGWLPPQAVQQMRARGKNLTEGS 174

Query: 113 --PYFWATGLSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHS 164
             P+F A+G+S ++HP NP+VP +HFN R            +WFGGG DLTP     +  
Sbjct: 175 KLPFF-ASGVSAVIHPRNPNVPTIHFNYRYFEVETPDGQKQWWFGGGTDLTPYYLDEK-- 231

Query: 165 YDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM 224
              D + FH TLK  C +H    Y  +K+WCD YF + HR E RGIGGIFFD +    + 
Sbjct: 232 ---DAVHFHKTLKNACDEHDATYYPKFKKWCDEYFRIKHRHECRGIGGIFFDDIDGPNQ- 287

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              DA F+FIS+     I  Y  +V+++ +  +   +RQ QL+RRGRY EFNL+YD+GT 
Sbjct: 288 ---DACFNFISSCARAVIPSYLPIVQKHKNDDYGNNERQWQLLRRGRYVEFNLIYDRGTK 344

Query: 285 FGFKT-GGNVESILASMPPLVAW 306
           FG  T G   ESIL S+P    W
Sbjct: 345 FGLYTPGARYESILMSLPLHARW 367


>gi|146280423|ref|YP_001170576.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri A1501]
 gi|166217811|sp|A4VFI3|HEM6_PSEU5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|145568628|gb|ABP77734.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas stutzeri
           A1501]
 gi|327478639|gb|AEA81949.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri DSM 4166]
          Length = 306

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 153/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  +  A           F    W R           
Sbjct: 1   MNDRTEAVKAYLLDLQDRICAALEVEDGGAR----------FVEDAWTRPGGGGG----- 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP+NP+VP 
Sbjct: 46  RTRVIENGALIEKGGVNFSHVHGDSLPPSASAHRPELAGRSFEALGVSLVIHPHNPYVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKDGEEPVWWFGGGFDLTPY-----YGAEEDCVHWHRVARDACAPFGAEV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YKEWCDRYF++ HR E RG+GG+FFD L+        D  F+F+ AVGD +++ Y  
Sbjct: 161 YPRYKEWCDRYFHIKHRNEPRGVGGLFFDDLNQW----DFDTSFAFMRAVGDAYLQAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     F E++RQ QL+RRGRY E+NL+YD+GT FG ++GG  ESIL S+PP VAW
Sbjct: 217 IVQRRKATPFGERERQFQLLRRGRYVEYNLVYDRGTLFGLQSGGRTESILMSLPPQVAW 275


>gi|77747481|ref|NP_297310.2| coproporphyrinogen III oxidase [Xylella fastidiosa 9a5c]
 gi|13431555|sp|Q9PHC7|HEM6_XYLFA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
          Length = 305

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 150/285 (52%), Gaps = 31/285 (10%)

Query: 28  LQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKA 87
           LQ  IC   E ++ ++H          F   HW     Q+ + GGGR   L  G VFE+A
Sbjct: 14  LQDRICNVVETIDGQSH----------FHEDHW-----QRTEGGGGRTRLLRDGAVFEQA 58

Query: 88  AVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG--- 144
            +  S V G   P              + A G+S++ HP NP VP  H N+R        
Sbjct: 59