BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|241205750|ref|YP_002976846.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859640|gb|ACS57307.1| Coproporphyrinogen oxidase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 303

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/307 (54%), Positives = 207/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKAAARNWFEGLRDTICASFEALEDELEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  V  STVYG+ +PDF+ QI G   +P FWA+G+
Sbjct: 61  SRENG----AGGGGRMSMMEGRVFEKVGVHTSTVYGEFAPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NPHVPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPHVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHSS E GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDEYFFLKHRNEARGIGGIFYDWLHSSEEAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|116253236|ref|YP_769074.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226740924|sp|Q1MDJ5|HEM6_RHIL3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|115257884|emb|CAK08982.1| putative coproporphyrinogen III oxidase, aerobic [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 303

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/307 (53%), Positives = 207/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE +E++     +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKAAARNWFEGLRDTICASFEAIEDDLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  V  STVYG+ +PDF+ QI G   +P FWA+G+
Sbjct: 61  SRENG----AGGGGRMSMMEGRVFEKVGVHTSTVYGEFAPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHSS E GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKTWCDEYFFLKHRNEARGIGGIFYDWLHSSEEAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|110634518|ref|YP_674726.1| coproporphyrinogen III oxidase [Mesorhizobium sp. BNC1]
 gi|123353494|sp|Q11GB4|HEM6_MESSB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110285502|gb|ABG63561.1| coproporphyrinogen oxidase [Chelativorans sp. BNC1]
          Length = 304

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 206/308 (66%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I  G P+D+E +K  ++  FE L+  IC   E LE+E     ++ +P  F    W
Sbjct: 1   MEQPHIPAGLPEDVENKKEAARAWFETLRDKICAALEGLEDELSGPHSSYAPGRFEQTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR +      GGG + ++  G+VFEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LRQEG----AGGGGVMSIMHGRVFEKVGVHTSTVHGEFSPEFRRQIPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVI HP NPHVP VH N RM+VT   WFGGG DLTP L  RR   DPD I FH  ++ +C
Sbjct: 117 SVIAHPQNPHVPTVHMNTRMVVTTRQWFGGGADLTPMLNRRRSQEDPDAIAFHKAMRFVC 176

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +HA VA+Y  +K WC+ YF+LPHR E RGIGGIF+D L S  E GG DADF+F   VG 
Sbjct: 177 ERHAAVADYEKFKNWCEEYFFLPHRNEPRGIGGIFYDWLKSPEENGGWDADFAFTQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +Y  +VR+N++  ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 AFVMVYQHIVRKNFNTNWTEADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           +PP+V WP
Sbjct: 297 LPPVVKWP 304


>gi|209550365|ref|YP_002282282.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226740892|sp|B5ZY73|HEM6_RHILW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|209536121|gb|ACI56056.1| Coproporphyrinogen oxidase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 303

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/307 (53%), Positives = 207/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG P+DIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPEDIEEKKAAARSWFEGLRDTICASFEALEDELEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  V  STV+G+ SPDF+ QI G   +P FWA+G+
Sbjct: 61  SRENG----AGGGGRMSMMEGRVFEKVGVHTSTVHGEFSPDFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTSSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E+RGIGGIF+D LHS+ + GG DADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEARGIGGIFYDWLHSNEDAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FSMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|150396759|ref|YP_001327226.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419]
 gi|226740904|sp|A6U9R1|HEM6_SINMW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150028274|gb|ABR60391.1| Coproporphyrinogen oxidase [Sinorhizobium medicae WSM419]
          Length = 303

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 211/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P DIE +K  ++  FE+L+  IC +FE +E++     ++R    F  K W
Sbjct: 1   MERPQLPQGLPADIERKKAEAKAWFESLRDTICADFEAIEDDLAGPLSDRPAGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD+      GGG   ++  G+VFEK  V  STV+G+ SP+F+DQI G +++P FWA+G+
Sbjct: 61  LRDEGN----GGGGRMSMMEGRVFEKVGVHTSTVFGEFSPEFRDQIPGASEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   D D + FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIPTDADTVLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA+Y  +K+WCD YFYL HR E RG GGIF+D L S  E+GG +ADF+F   VG  
Sbjct: 177 NRHKVADYPKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSDEEIGGWEADFAFTRDVGKA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAIVYPRIVRTNFNMPWTEQDRSEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PPLV WP
Sbjct: 297 PPLVRWP 303


>gi|325293608|ref|YP_004279472.1| Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3]
 gi|325061461|gb|ADY65152.1| Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3]
          Length = 303

 Score =  371 bits (952), Expect = e-101,   Method: Composition-based stats.
 Identities = 160/307 (52%), Positives = 205/307 (66%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M   ++  G P+DIE++K  +Q  F++L+  I T FE LE+E     A++ P  F  K W
Sbjct: 1   MERPSLPKGLPEDIEDKKAAAQAWFQHLRDTIVTSFETLEDELSGPLADQEPGRFVQKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD              +  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LRDNGAGGGGKMS----MMEGRVFEKVGVHTSTVYGEFSPEFRQQIPGAEEDPSFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT ++WFGGG DLTP L  RR   DPD   FH   +  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSHWFGGGADLTPVLGRRRTEQDPDTQLFHRGFEITC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA+Y  YK WCD YF+L HR E RG GGIFFD LH   E GG DA+F+F+  VG  
Sbjct: 177 NRHPVADYPRYKSWCDEYFFLKHRNEPRGTGGIFFDWLHPEEEKGGWDANFAFVQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FNLVYPKIVRSNFNQSWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|227822226|ref|YP_002826197.1| coproporphyrinogen III oxidase [Sinorhizobium fredii NGR234]
 gi|227341226|gb|ACP25444.1| coproporphyrinogen III oxidase, aerobic [Sinorhizobium fredii
           NGR234]
          Length = 491

 Score =  371 bits (952), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/307 (50%), Positives = 208/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +    P DIE++K  ++  FE+L+  IC  FE +E++     ++R P  F  K W
Sbjct: 189 MERPQLPQELPADIEDKKAEAKAWFESLRDSICAAFETIEDDLTGPLSDRPPGRFVGKDW 248

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR++       GG   ++  G+VFEK  V  STV+G+ SP+F++QI G + +P FWA+G+
Sbjct: 249 LREEGAG----GGGRMSMMEGRVFEKVGVHTSTVFGEFSPEFRNQIPGASDDPRFWASGI 304

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD   FH  ++  C
Sbjct: 305 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRLMSDPDTAVFHRAMEITC 364

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA++  +KEWCD YF+L HR E RG GGIF+D LHS  +MGG  ADF+F   VG  
Sbjct: 365 NRHPVADHAKFKEWCDEYFFLKHRNEPRGTGGIFYDWLHSPEDMGGWQADFAFTRDVGKA 424

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 425 FAIVYPKIVRTNFNTPWTEADRDEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 484

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 485 PPVVRWP 491


>gi|190892790|ref|YP_001979332.1| coproporphyrinogen III oxidase [Rhizobium etli CIAT 652]
 gi|226740891|sp|B3PV29|HEM6_RHIE6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|190698069|gb|ACE92154.1| coproporphyrinogen III oxidase protein [Rhizobium etli CIAT 652]
          Length = 303

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 165/307 (53%), Positives = 206/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  +++ FE L+  IC  FE LE+      +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKEAARKWFEGLRDTICASFEALEDGLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G   +P FWA+G+
Sbjct: 61  SRENG----AGGGGRMSMMEGRVFEKVGVHTSTVYGEFSPEFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E RGIGGIF+D LHSS E GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIFYDWLHSSDETGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|163761618|ref|ZP_02168689.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
 gi|162281214|gb|EDQ31514.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
          Length = 303

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 209/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + +G PDDIEE+K  ++  FE+L+  IC  FE LE+EA    +      F    W
Sbjct: 1   MERPNLPVGLPDDIEEKKTKAREWFEHLRDQICESFETLEDEAEHPQSPGEAGRFERTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD+      GGG   ++  G++FEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 61  LRDEG----AGGGGTMSIMKGRLFEKVGVHTSTVHGEFSPEFRKQIPGAEEDPKFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NPHVP VH N RM+VT + WFGGG DLTP L++RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPVNPHVPTVHMNTRMVVTSSQWFGGGADLTPVLDNRRTQTDPDTLLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +HAVA+Y  +K WC+ YFYLPHR E RGIGGIF+D LH++ + GG DAD +F   VG  
Sbjct: 177 RRHAVADYPKFKAWCEEYFYLPHRDEPRGIGGIFYDWLHTADDKGGWDADLAFTQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N+   +SE++R EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S+
Sbjct: 237 FNVVYPKIVRSNFMKPWSEEERTEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSL 296

Query: 301 PPLVAWP 307
           PP+V +P
Sbjct: 297 PPVVMYP 303


>gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040750|gb|ACT57546.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 307

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW
Sbjct: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL
Sbjct: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC
Sbjct: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC
Sbjct: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM
Sbjct: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300

Query: 301 PPLVAWP 307
           PPLVAWP
Sbjct: 301 PPLVAWP 307


>gi|327188341|gb|EGE55558.1| coproporphyrinogen III oxidase protein [Rhizobium etli CNPAF512]
          Length = 303

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 163/307 (53%), Positives = 205/307 (66%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG PDDIEE+K  ++  FE L+  IC  FE LE+      +++ P  F  K W
Sbjct: 1   MERPELPIGLPDDIEEKKEAARTWFEGLRDTICASFEALEDGLEGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G   +P FWA+G+
Sbjct: 61  SRENG----AGGGGRMSMMEGRVFEKVGVHTSTVYGEFSPEFRAQIPGAKDDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  Y+ WCD YF+L HR E RGIGGIF+D LHSS + GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYRAWCDDYFFLKHRNEPRGIGGIFYDWLHSSEDSGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|254503192|ref|ZP_05115343.1| coproporphyrinogen III oxidase, aerobic [Labrenzia alexandrii
           DFL-11]
 gi|222439263|gb|EEE45942.1| coproporphyrinogen III oxidase, aerobic [Labrenzia alexandrii
           DFL-11]
          Length = 318

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/302 (51%), Positives = 205/302 (67%), Gaps = 8/302 (2%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLE---NEAHENSANRSPKIFTVKHWLRDKS 65
             P+ IE++K  +   F++L+  IC  FEKLE    E +   ++     F    W R  S
Sbjct: 22  PIPEGIEDKKLTASAWFKDLRDQICAAFEKLEDDIGELNGPISDLPAGRFERTPWERTDS 81

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG M+ +  G+VFEK  V +STV+G+ SP+F+ QI G +++P FWA+G+S+I H
Sbjct: 82  SGAKGGGGVMS-MMHGRVFEKVGVHISTVHGEFSPEFRGQIPGASEDPRFWASGISLIAH 140

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P NP+VPAVH N RM+VT   WFGGG DLTP L+ RR   DPD + FH+ +K  C  HAV
Sbjct: 141 PQNPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDDRRTQDDPDTVAFHDAMKAACEPHAV 200

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  YK+WCD YF+L HR E RGIGGIF+D+LHS    G  +AD +F   VG  F+K+Y
Sbjct: 201 ADYPAYKDWCDEYFFLKHRNEPRGIGGIFYDYLHS----GDWNADLAFTKDVGRAFLKVY 256

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P LVR+NY + +++  R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+SMPP+V 
Sbjct: 257 PELVRKNYENSWTDAQREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSMPPVVK 316

Query: 306 WP 307
           WP
Sbjct: 317 WP 318


>gi|15889523|ref|NP_355204.1| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
 gi|22653788|sp|Q8UD80|HEM6_AGRT5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15157401|gb|AAK87989.1| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
          Length = 303

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/307 (51%), Positives = 205/307 (66%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P+DIE++K ++Q  F++L+  I   FE LE+E     +++ P  F  K W
Sbjct: 1   MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LRD  +           +  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+GL
Sbjct: 61  LRDNGEGGGGKMS----MMEGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGL 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT ++WFGGG DLTP L  RR   DPD   FH   +  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H +A+Y  YK WCD YF+L HR E RG GGIFFD LH   E GG DA+F+F+  VG  
Sbjct: 177 NRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIFFDWLHPDEEKGGWDANFTFVQDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|307302700|ref|ZP_07582456.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti BL225C]
 gi|307318548|ref|ZP_07597982.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti AK83]
 gi|306895888|gb|EFN26640.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti AK83]
 gi|306903064|gb|EFN33655.1| Coproporphyrinogen oxidase [Sinorhizobium meliloti BL225C]
          Length = 326

 Score =  367 bits (943), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/307 (51%), Positives = 212/307 (69%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P DIE++K  ++  FE+L+  IC  FE +E+E     ++R    F  K W
Sbjct: 24  MERPQLPQGLPADIEDKKAAAKAWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDW 83

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR++       GG   ++  G+VFEK  V  STV+G+ SP+F++QI G +++P FWA+G+
Sbjct: 84  LREEGAG----GGGRMSMMEGRVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGI 139

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C
Sbjct: 140 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIAC 199

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA++  +K+WCD YFYL HR E RG GGIF+D L S+ E+GG DADF+F   VG  
Sbjct: 200 NRHPVADHAKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSAEELGGWDADFAFTRDVGKA 259

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 260 FALVYPRIVRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 319

Query: 301 PPLVAWP 307
           PPLV WP
Sbjct: 320 PPLVRWP 326


>gi|15965580|ref|NP_385933.1| coproporphyrinogen III oxidase [Sinorhizobium meliloti 1021]
 gi|22653790|sp|Q92PD8|HEM6_RHIME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15074761|emb|CAC46406.1| Probable coproporphyrinogen III oxidase, aerobic protein
           [Sinorhizobium meliloti 1021]
          Length = 303

 Score =  367 bits (943), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/307 (51%), Positives = 212/307 (69%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G P DIE++K  ++  FE+L+  IC  FE +E+E     ++R    F  K W
Sbjct: 1   MERPQLPQGLPADIEDKKAAAKAWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           LR++       GG   ++  G+VFEK  V  STV+G+ SP+F++QI G +++P FWA+G+
Sbjct: 61  LREEGAG----GGGRMSMMEGRVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           ++H VA++  +K+WCD YFYL HR E RG GGIF+D L S+ E+GG DADF+F   VG  
Sbjct: 177 NRHPVADHAKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSAEELGGWDADFAFTRDVGKA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++EQDR EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FALVYPRIVRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PPLV WP
Sbjct: 297 PPLVRWP 303


>gi|328542785|ref|YP_004302894.1| Coproporphyrinogen III oxidase, aerobic [polymorphum gilvum
           SL003B-26A1]
 gi|326412531|gb|ADZ69594.1| Coproporphyrinogen III oxidase, aerobic [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  366 bits (940), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 158/302 (52%), Positives = 202/302 (66%), Gaps = 8/302 (2%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAH---ENSANRSPKIFTVKHWLRDKS 65
             PD IE +K  +   FE+L+  IC+ FE LE+E        +++    F    W R  +
Sbjct: 12  PVPDAIETKKITAATWFEDLRDRICSAFETLEDEIGARGGPLSDKPAGRFVRTPWERTDA 71

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG M+ L  G+VFEK  V VSTV+G  SP+F+ QI G +++P FWA+G+S+I H
Sbjct: 72  SGAKGGGGVMS-LMHGRVFEKVGVHVSTVHGAFSPEFRGQIPGASEDPRFWASGISLIAH 130

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            +NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  +K  C+ HA 
Sbjct: 131 LHNPHVPAVHMNTRMVVTSRQWFGGGADLTPVLDARRTQEDPDTVAFHAAMKAACAPHAC 190

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  YK WCD YF+LPHR E RGIGGIF+D+LHS       DADF+F   VG  F+ +Y
Sbjct: 191 ADYDRYKAWCDEYFFLPHRNEPRGIGGIFYDYLHS----RDWDADFAFTRDVGLAFLDVY 246

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P LVR N+   +SE +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+S+PP+V 
Sbjct: 247 PRLVRANFEKPWSEAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSLPPVVK 306

Query: 306 WP 307
           WP
Sbjct: 307 WP 308


>gi|86358648|ref|YP_470540.1| coproporphyrinogen III oxidase [Rhizobium etli CFN 42]
 gi|123511225|sp|Q2K5S3|HEM6_RHIEC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|86282750|gb|ABC91813.1| coproporphyrinogen III oxidase protein [Rhizobium etli CFN 42]
          Length = 303

 Score =  366 bits (939), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 164/307 (53%), Positives = 206/307 (67%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    + IG P+DIEE+K  ++  FE L+  IC  FE LE+E     +++ P  F  K W
Sbjct: 1   MERPELPIGLPEDIEEKKTAARNWFEGLRDTICASFEALEDELQGPLSDQEPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R++       GG   ++  G+VFEK  V  STV+G+ SPDF  QI G  ++P FWA+G+
Sbjct: 61  SREEGAG----GGGRMSMMEGRVFEKVGVHTSTVHGEFSPDFSAQIPGAKEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT + WFGGG DLTP L  RR   D D   FH  ++  C
Sbjct: 117 SLIAHPVNPNVPAVHMNTRMVVTSSRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIAC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             HAVA+Y  YK WCD YF+L HR E RGIGGIF+D LHSS E GG +ADF+F   VG  
Sbjct: 177 RNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIFYDWLHSSEEAGGWNADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++ L++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|114704760|ref|ZP_01437668.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
 gi|114539545|gb|EAU42665.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
          Length = 302

 Score =  365 bits (938), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 209/308 (67%), Gaps = 7/308 (2%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G PD+IE +K  ++  FE L+  IC  FE LE +AH       P  F    W
Sbjct: 1   MERENLPEGLPDNIEMKKATARAWFEALRDRICAVFEDLE-KAHGEETGLEPGRFERTEW 59

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            RD     + GGG + ++  G+VFEK  V  STV+G+ S +F+  I G  ++P FWA+G+
Sbjct: 60  HRD-----NEGGGGVMSMMHGRVFEKVGVHTSTVHGEFSEEFRKNIPGAEEDPTFWASGI 114

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP+VPAVH N RM+VT   WFGGG DLTP+LE RR   DPD   FH  L+ +C
Sbjct: 115 SLIGHLRNPNVPAVHMNTRMVVTTRQWFGGGADLTPTLERRRTQEDPDTRAFHKALQFVC 174

Query: 181 SQHAV-ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H+  A+Y   KEWCD YFYLPHRQE+RG+GGIF+D+LHSS E+GG DADF+F   VG 
Sbjct: 175 DRHSKVADYGRLKEWCDEYFYLPHRQETRGVGGIFYDYLHSSDEVGGWDADFAFTRDVGK 234

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            FI +YP ++++N    ++E DR+EQL+RRGRY E+NLLYD+GT FG KTGGNV+SIL+S
Sbjct: 235 AFIVVYPHIIKQNVGQPYTEADREEQLVRRGRYVEYNLLYDRGTLFGLKTGGNVQSILSS 294

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 295 MPPVVKWP 302


>gi|90418299|ref|ZP_01226211.1| coproporphyrinogen oxidase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337971|gb|EAS51622.1| coproporphyrinogen oxidase [Aurantimonas manganoxydans SI85-9A1]
          Length = 437

 Score =  364 bits (935), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 206/308 (66%), Gaps = 7/308 (2%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M   T+  G P+DIE +K  +Q  FE L+  IC  FE++E+   E      P  F    W
Sbjct: 136 MERPTLPEGLPEDIETKKATAQAWFEALRDRICKVFEEIEDGFGEE-TGLEPGRFEQTEW 194

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+      L      ++  G+VFEK  V  STV+G+ SP+F+ QI G  ++P FWA+G+
Sbjct: 195 SRENEGGGGL-----MSMMHGRVFEKVGVHTSTVHGEFSPEFRKQIPGAEEDPTFWASGI 249

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP+VPAVH N RM+VT   WFGGG DLTP+L+ RR   D D + FH  L+ +C
Sbjct: 250 SLIAHMRNPNVPAVHMNTRMVVTTRQWFGGGADLTPTLDRRRIDDDRDTLAFHKALQFVC 309

Query: 181 SQHA-VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H+ VA+Y  +KEWCD YFYLPHR E+RG+GGIF+D LHSS E GG DADF+F   VG 
Sbjct: 310 DRHSGVADYAKFKEWCDTYFYLPHRNEARGVGGIFYDWLHSSDEAGGWDADFAFTRDVGK 369

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +YP +VR+N    F+E DR+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+S
Sbjct: 370 AFLVVYPHIVRQNVVQPFTEADREEQLIRRGRYVEYNLLYDRGTLFGLKTGGNVNSILSS 429

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 430 MPPVVKWP 437


>gi|326405433|ref|YP_004285515.1| coproporphyrinogen III oxidase [Acidiphilium multivorum AIU301]
 gi|325052295|dbj|BAJ82633.1| coproporphyrinogen III oxidase [Acidiphilium multivorum AIU301]
          Length = 307

 Score =  364 bits (935), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 132/307 (42%), Positives = 175/307 (57%), Gaps = 6/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MN  +         E  K  +   F  L+  IC  FE +E+      A+R+P  F    W
Sbjct: 7   MNDRSAPNPPAPAHEALKPAASEWFRTLRDRICAAFEAIEDAHGGMLADRAPGRFARTPW 66

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R    +  L GG   +L  G+VFEK  V +S V G  SPDF   I G  ++P FWA G+
Sbjct: 67  TRAPDGQNRLEGGGEMSLMRGRVFEKVGVNISVVGGAFSPDFAKNIPGAAEDPRFWAAGI 126

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S++ H ++P VPA H N RMIVT   WFGGG DLTP       +   D   FH+  +  C
Sbjct: 127 SLVAHMHSPRVPAAHMNTRMIVTTKGWFGGGGDLTPLQPGTAAA-KEDAALFHDAFRAAC 185

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            ++    Y  + +WCD YFYLPHR E+RG GGIF+D+L + P     +  F+F   VG  
Sbjct: 186 DRYDPDYYPRFSKWCDEYFYLPHRGETRGAGGIFYDYLETEP-----ELHFAFTRDVGLA 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F++ YP++VRR     ++ ++R+ QL+RRGRY EFNLLYD+GT FG KTGGN E+IL SM
Sbjct: 241 FLESYPAIVRRRMDEAWTPEEREAQLVRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSM 300

Query: 301 PPLVAWP 307
           PP V WP
Sbjct: 301 PPEVKWP 307


>gi|148261926|ref|YP_001236053.1| coproporphyrinogen III oxidase [Acidiphilium cryptum JF-5]
 gi|146403607|gb|ABQ32134.1| coproporphyrinogen oxidase [Acidiphilium cryptum JF-5]
          Length = 307

 Score =  364 bits (935), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 132/307 (42%), Positives = 175/307 (57%), Gaps = 6/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MN  +         E  K  +   F  L+  IC  FE +E+      A+R+P  F    W
Sbjct: 7   MNDRSAPNPPAPAHEALKPAASEWFRTLRDRICAAFEAIEDAHGGMLADRAPGRFARTPW 66

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R    +  L GG   +L  G+VFEK  V +S V G  SPDF   I G  ++P FWA G+
Sbjct: 67  TRAPDGQNRLEGGGEMSLMRGRVFEKVGVNISVVGGAFSPDFAKNIPGAAEDPRFWAAGI 126

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S++ H ++P VPA H N RMIVT   WFGGG DLTP       +   D   FH+  +  C
Sbjct: 127 SLVAHMHSPRVPAAHMNTRMIVTTKGWFGGGGDLTPLQPGTAAA-KEDAALFHDAFRAAC 185

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            ++    Y  + +WCD YFYLPHR E+RG GGIF+D+L + P     +  F+F   VG  
Sbjct: 186 DRYDPDYYPRFSKWCDEYFYLPHRGETRGAGGIFYDYLETEP-----ERHFAFTRDVGLA 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F++ YP++VRR     ++ ++R+ QL+RRGRY EFNLLYD+GT FG KTGGN E+IL SM
Sbjct: 241 FLESYPAIVRRRMDEAWTPEEREAQLVRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSM 300

Query: 301 PPLVAWP 307
           PP V WP
Sbjct: 301 PPEVKWP 307


>gi|288962014|ref|YP_003452324.1| coproporphyrinogen III oxidase [Azospirillum sp. B510]
 gi|288914294|dbj|BAI75780.1| coproporphyrinogen III oxidase [Azospirillum sp. B510]
          Length = 291

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 142/294 (48%), Positives = 182/294 (61%), Gaps = 10/294 (3%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  +   F+ L+  ICT FE LE E     A+  P  F  K W R   +  + GGG
Sbjct: 8   IEDRKARAAAWFKELRDRICTAFEALEEELTGTHADLPPGRFERKSWTRPDHEGGEGGGG 67

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G+VFEK  V +STV+G  SP+F+  I G  +   FWA+G+S++ H  +P VPA
Sbjct: 68  TMSVMK-GRVFEKVGVNISTVHGTFSPEFRATIPGAAETGEFWASGISLVAHMRSPLVPA 126

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
            H N R IVT   WFGGG DLTP +   R     D   FH  L+  C +H    Y  YKE
Sbjct: 127 THMNTRHIVTTKGWFGGGADLTPMVADDR-----DTADFHAGLRAACDRHDPDYYPRYKE 181

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCDRYF+LPHR E+RG+GGIF+D L S    G  +ADF+F   VG  F+  Y +LVRR+ 
Sbjct: 182 WCDRYFHLPHRGEARGVGGIFYDQLAS----GDWEADFAFTRDVGASFLDSYVTLVRRHM 237

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +  ++ + R+ QLIRRGRY EFNLLYD+GT FG KTGGN E+IL S+PP V WP
Sbjct: 238 NRPWTAEQREHQLIRRGRYVEFNLLYDRGTTFGLKTGGNTEAILMSLPPEVKWP 291


>gi|154252687|ref|YP_001413511.1| coproporphyrinogen III oxidase [Parvibaculum lavamentivorans DS-1]
 gi|154156637|gb|ABS63854.1| Coproporphyrinogen oxidase [Parvibaculum lavamentivorans DS-1]
          Length = 304

 Score =  363 bits (933), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 144/307 (46%), Positives = 191/307 (62%), Gaps = 6/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           +      +   D   ERK  ++  F  L+ +IC EFEKLE+E     A+R    F    W
Sbjct: 4   LQRNVPAMDKTDGTTERKARAESWFRELRDLICAEFEKLEDELTGTFADRPAGRFERTPW 63

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R    +++ GG     +  G+VFEK  V +STV+G+ S DF+ Q+ G  ++P FWA+G+
Sbjct: 64  KRGDGSRDEGGGEMS--VMHGRVFEKVGVHISTVHGEFSEDFRKQMQGAEEDPRFWASGI 121

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP VPAVH N R + T   WFGGG DLTP L+ +R    PD + FH   K  C
Sbjct: 122 SLIAHMQNPRVPAVHMNTRHVYTTKSWFGGGGDLTPVLDVQRRDDHPDTVDFHAAYKRAC 181

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +H    Y  +K+WCD YF+LPHR E RG GGIF+DH +S    G  + DF+F   VG  
Sbjct: 182 DRHDADYYPKFKKWCDEYFFLPHRNEPRGTGGIFYDHHNS----GDWEKDFAFTQDVGRA 237

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+++YP LVRR+ +  ++E +R+EQL+RRGRY EFNLLYD+GT FG KTGGNV SIL+SM
Sbjct: 238 FLEIYPELVRRHMNEAWTEAEREEQLVRRGRYVEFNLLYDRGTVFGLKTGGNVNSILSSM 297

Query: 301 PPLVAWP 307
           PP V WP
Sbjct: 298 PPAVKWP 304


>gi|118591956|ref|ZP_01549351.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
 gi|118435599|gb|EAV42245.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
          Length = 308

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 158/302 (52%), Positives = 204/302 (67%), Gaps = 8/302 (2%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLE---NEAHENSANRSPKIFTVKHWLRDKS 65
             PD IE++K  +   F+ L+  IC  FE LE    E     A++    F    W R  S
Sbjct: 12  PIPDGIEDKKATAPAWFKELRDRICKSFEDLEDEIGELSGPLADQPAGRFERTPWERTDS 71

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG M+ +  G+VFEKA V +STV+G+ SP+F+ QI G +++P FWA+G+S+IVH
Sbjct: 72  TGAKGGGGVMS-MMHGRVFEKAGVHISTVHGEFSPEFRGQIPGASEDPRFWASGISLIVH 130

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD I FH  ++  C  HA+
Sbjct: 131 PQNPHVPAVHMNTRMVVTTRQWFGGGADLTPVLDARRTQDDPDTIAFHEAMRSACDAHAI 190

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  YK WCD YF+L HR E+RGIGGIF+D+L+S    G  + DF+F   VG  F+ +Y
Sbjct: 191 ADYDAYKAWCDDYFFLKHRNEARGIGGIFYDYLNS----GTWEDDFAFTKDVGLAFLNIY 246

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P LVRRN+   +S+ +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SIL+SMPP+V 
Sbjct: 247 PELVRRNFQKSWSDAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASILSSMPPVVK 306

Query: 306 WP 307
           WP
Sbjct: 307 WP 308


>gi|222086615|ref|YP_002545149.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
 gi|254800264|sp|B9J7B2|HEM6_AGRRK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|221724063|gb|ACM27219.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
          Length = 303

 Score =  360 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 163/307 (53%), Positives = 211/307 (68%), Gaps = 4/307 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +    P+DIE++K  +Q  F++L+  +C EFE+LE+E     ++++P  F  K W
Sbjct: 1   MERPNLPKELPEDIEDKKEAAQGWFQSLRDALCAEFEQLEDELAGPLSDQTPGRFVAKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       GGG   ++  G+VFEK  +  STVYG+ SPDF+ QI G  ++P FWA+GL
Sbjct: 61  QRE----NGEGGGGRMSMMEGRVFEKVGIHTSTVYGEFSPDFRSQIPGAEEDPRFWASGL 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VP VH N RM+VT + WFGGG DLTP L  RR   D D + FH  ++ +C
Sbjct: 117 SLIAHPVNPNVPTVHMNTRMVVTTSQWFGGGCDLTPMLNRRRTQEDTDSVLFHRAMQIVC 176

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
            +H VA+Y  YK WCD YFYL HR ESRGIGGIFFD LHS+ E GG DADF+F   VG  
Sbjct: 177 DRHKVADYQRYKAWCDEYFYLKHRNESRGIGGIFFDWLHSTEEAGGWDADFAFTRDVGRA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F  +YP +VR N++  ++E+DR EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+S+
Sbjct: 237 FSMVYPRIVRSNFNETWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSL 296

Query: 301 PPLVAWP 307
           PP+V WP
Sbjct: 297 PPVVRWP 303


>gi|27377592|ref|NP_769121.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
 gi|41017187|sp|Q89SC2|HEM6_BRAJA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|27350737|dbj|BAC47746.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
          Length = 316

 Score =  360 bits (924), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 153/295 (51%), Positives = 195/295 (66%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE L+  IC  FE+LE++A +         FT   W R        GGG
Sbjct: 27  IEDRKTRARAWFEALRDDICASFERLEDDAPQGLYPGEAGRFTRTPWQRTDHSGAAGGGG 86

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPHVPA
Sbjct: 87  VMSMMS-GRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPRFWASGISLIAHLRNPHVPA 145

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC-SQHAVANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR   D D I FH  +KE C   + VA+Y  YK
Sbjct: 146 VHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDADSIAFHAAMKEACVQPNGVADYDKYK 205

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR+E+RGIGGIF+D   S    G  DAD +F   VG  F+K+YP +VRRN
Sbjct: 206 KWCDEYFYLPHRKEARGIGGIFYDWHDS----GDWDADLAFTQDVGRAFLKIYPDIVRRN 261

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++  DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV+SIL+S+PP V WP
Sbjct: 262 FASAWTAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSLPPEVKWP 316


>gi|239832432|ref|ZP_04680761.1| coproporphyrinogen III oxidase [Ochrobactrum intermedium LMG 3301]
 gi|239824699|gb|EEQ96267.1| coproporphyrinogen III oxidase [Ochrobactrum intermedium LMG 3301]
          Length = 304

 Score =  358 bits (920), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 210/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +QR FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MQRDEIPAIIPADIEEKKQAAQRWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D+ +    GGG + ++  G+VFEK  V VSTVYG+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDEGR----GGGGVMSIMHGRVFEKVGVHVSTVYGEFSPEFRKQIPGAEEDPRYWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT   WFGGG DLTP L+ RR   DPD + FH   + +C
Sbjct: 117 SLIAHPQNPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDRRRTQDDPDTLAFHKAFRFIC 176

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E+RGIGGIF+D LHS  E GG DADF++   VG 
Sbjct: 177 DKHKEIVDYQRVKEWCDEYFFLPHRNEARGIGGIFYDWLHSPEEKGGWDADFAYTRDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  +++ DR EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 GFSVVYPHLVRQNFNKDWTDADRNEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 297 MPPVVKWP 304


>gi|222149360|ref|YP_002550317.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
 gi|254800265|sp|B9JZ61|HEM6_AGRVS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|221736344|gb|ACM37307.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
          Length = 304

 Score =  357 bits (917), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 210/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +  G PDDIE +K  ++  FE+L+  IC  FE LE+E     ++R+P  FT K W
Sbjct: 1   MQRPILPKGLPDDIEVKKATARAWFESLRDQICRSFEALEDELTGPLSDRAPGRFTPKDW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R++       GG   ++  G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+
Sbjct: 61  QREEGLG----GGGRMSMMNGRVFEKVGVHTSTVHGEFSPEFRKQMPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NPHVPAVH N RM+VT + WFGGG DLTP L+ RR   D D + FH  L+  C
Sbjct: 117 SLIAHSCNPHVPAVHMNTRMVVTTSQWFGGGADLTPVLDRRRTQDDADTVAFHAALEAAC 176

Query: 181 SQHAV-ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           + H   A+Y HYK WC+ YF+LPHRQE RGIGGIFFD LH+  +     A+F+F+  VG 
Sbjct: 177 AAHPDVADYPHYKAWCEEYFFLPHRQEPRGIGGIFFDWLHAGEKFDLWAANFAFVQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVRRN++  ++E+DR+EQL+RRGRY EFNLLYD+GT FG KTGGNVESIL+S
Sbjct: 237 QFAAVYPDLVRRNFNTPWTEEDREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSS 296

Query: 300 MPPLVAWP 307
           +PPLV WP
Sbjct: 297 LPPLVRWP 304


>gi|153008946|ref|YP_001370161.1| coproporphyrinogen III oxidase [Ochrobactrum anthropi ATCC 49188]
 gi|226740886|sp|A6WZC8|HEM6_OCHA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|151560834|gb|ABS14332.1| Coproporphyrinogen oxidase [Ochrobactrum anthropi ATCC 49188]
          Length = 304

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 210/308 (68%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +QR FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MQRDEIPAIIPTDIEEKKQAAQRWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D+ +    GGG + ++  G+VFEK  V VSTVYG+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDEGR----GGGGVMSIMHGRVFEKVGVHVSTVYGEFSPEFRKQIPGAEEDPRYWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH   + +C
Sbjct: 117 SLIAHPQNPNVPAVHMNTRMVVTTRQWFGGGADLTPVLDNRRTQDDPDTLAFHKAFRFIC 176

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   K+WCD YF+LPHR E+RG GGIF+D LHS  E GG DADF++   VG 
Sbjct: 177 EKHKDIVDYQRVKDWCDEYFFLPHRNEARGTGGIFYDWLHSPDEKGGWDADFAYTRDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  +++ DR EQLIRRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 237 GFSVVYPHLVRQNFNKDWTDADRNEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNSILSS 296

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 297 MPPVVKWP 304


>gi|302383839|ref|YP_003819662.1| coproporphyrinogen oxidase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194467|gb|ADL02039.1| Coproporphyrinogen oxidase [Brevundimonas subvibrioides ATCC 15264]
          Length = 295

 Score =  357 bits (916), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 177/305 (58%), Gaps = 10/305 (3%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +    +   D ++ +K  ++  FE L++ I    E+LE+ A  +     P  F    W R
Sbjct: 1   MSQAPLPDADPLDLKKTETRAWFEELRNRIHARLEQLEDSAPADLFPGEPGRFVRTPWSR 60

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
            +     +G           +FEK  V VSTV+G    D+   + G  ++P F+ATG+S+
Sbjct: 61  HEGGGGVMGMMHGR------LFEKVGVHVSTVHGTFPADYAKSVPGAEEDPRFYATGISL 114

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           I HP +P VPAVH N R I T   WFGGG DLTP L+  R    PD + FH  ++  C  
Sbjct: 115 ICHPVSPKVPAVHMNTRFIATTKSWFGGGADLTPVLDVERTQEAPDTVAFHAGMRSPCDA 174

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A Y  YK+WCD YF LPHR E RGIGGIF+DH  S    G  D DF+F   VG  FI
Sbjct: 175 HDPAWYPKYKQWCDEYFMLPHRNEMRGIGGIFYDHHDS----GDYDKDFAFTRDVGMAFI 230

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y ++V R     +++ +R+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP
Sbjct: 231 DTYAAIVERRMSEAWTDDEREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPP 290

Query: 303 LVAWP 307
           +V WP
Sbjct: 291 VVKWP 295


>gi|92118712|ref|YP_578441.1| coproporphyrinogen III oxidase [Nitrobacter hamburgensis X14]
 gi|91801606|gb|ABE63981.1| coproporphyrinogen oxidase [Nitrobacter hamburgensis X14]
          Length = 295

 Score =  357 bits (916), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 151/294 (51%), Positives = 191/294 (64%), Gaps = 6/294 (2%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           ++ K  ++  FE L+  IC  FEKLE++A  +    S   F    W R     +  GGG 
Sbjct: 7   DDHKTRARAWFEQLRDDICAAFEKLEDDAPASLYPGSAGRFVRTPWERTDHTGQPGGGGV 66

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
           M+ +  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPH+PAV
Sbjct: 67  MS-MMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAEADPKFWASGISLIAHMRNPHIPAV 125

Query: 135 HFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV-ANYTHYKE 193
           H N R +VT   WFGGG DLTP L  RR   D D + FH  +K  C  HA  A+Y  YK 
Sbjct: 126 HMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDADSVAFHAAMKSACDAHAAIADYDKYKT 185

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+LPHR E+RGIGGIF+D   S    G  DAD +F   VG   +K+YP LVRRN+
Sbjct: 186 WCDEYFHLPHRNEARGIGGIFYDWHDS----GDWDADLAFTQDVGRALLKVYPELVRRNF 241

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +  ++  DR+EQLIRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 242 NTPWTAADREEQLIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|154246889|ref|YP_001417847.1| coproporphyrinogen III oxidase [Xanthobacter autotrophicus Py2]
 gi|154160974|gb|ABS68190.1| Coproporphyrinogen oxidase [Xanthobacter autotrophicus Py2]
          Length = 315

 Score =  356 bits (914), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 154/295 (52%), Positives = 192/295 (65%), Gaps = 2/295 (0%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +EER+  ++  FE+LQ  I   FE LENEA       +P  F    W R        GGG
Sbjct: 22  LEERRSRARCWFEDLQGRIIAAFEALENEADAALYAGAPGRFARTPWSRTDHTGAPGGGG 81

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            MA +  G++FEK  V  STV+G+ +P+F+ QI G  ++P FWA+G+S+I H  NPHVPA
Sbjct: 82  TMALMR-GRLFEKVGVHTSTVFGEFAPEFRSQIPGAAEDPRFWASGISLIAHMANPHVPA 140

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R +VT   WFGGG DLTP L+ RR   DPD + FH  +   C+ H VA+Y  YK 
Sbjct: 141 VHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTVAFHAAMAGACTAHTVADYARYKT 200

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHS-SPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           WCD YF+L HR E RGIGGIF+D+L S S   G  D DF+F   VG  F+ +YP LVR N
Sbjct: 201 WCDDYFFLKHRNEMRGIGGIFYDYLDSASSGTGTWDNDFAFTRDVGLAFLDIYPKLVRAN 260

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               +S  DR+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 261 MGQPWSAADREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPVVKWP 315


>gi|329850307|ref|ZP_08265152.1| coproporphyrinogen 3 oxidase, aerobic [Asticcacaulis biprosthecum
           C19]
 gi|328840622|gb|EGF90193.1| coproporphyrinogen 3 oxidase, aerobic [Asticcacaulis biprosthecum
           C19]
          Length = 294

 Score =  356 bits (913), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 136/298 (45%), Positives = 184/298 (61%), Gaps = 10/298 (3%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             + + +R+  +   F +L+  IC  FE LE+EA  +  + +   F    W R +    +
Sbjct: 7   STETLTDRQTAAAAWFRSLRDQICAAFEALEDEAPASLYDGNAGRFVRTPWDRAEGGGGE 66

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
           +       +  G++FEK  V +STV+G  SP+F   I G  ++P F+ATG+S+I H +NP
Sbjct: 67  MS------IMKGRLFEKVGVHISTVHGTFSPEFAKSIPGAAEDPRFFATGISLIAHMHNP 120

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           HVPAVH N R I T   WFGGG DLTP + + RH   PD + FHN  K+ C +     Y 
Sbjct: 121 HVPAVHMNTRFITTTTDWFGGGADLTPLMAADRHQDAPDAVAFHNAFKDACDRFDPTYYE 180

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YF+LPHR E RG+GGIF+DHL+S    G  D DF+F  AVG  F+  YP +V
Sbjct: 181 RFKAWCDEYFHLPHRNEPRGVGGIFYDHLNS----GDHDTDFAFTQAVGQAFLATYPQIV 236

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R      +SE +R+ QL++RGRY EFNLLYD+GT FG KTGGNV SI++SMPP+V WP
Sbjct: 237 RDRLSQAWSEDEREAQLVQRGRYVEFNLLYDRGTLFGLKTGGNVASIMSSMPPVVKWP 294


>gi|17986750|ref|NP_539384.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225627991|ref|ZP_03786027.1| coproporphyrinogen III oxidase [Brucella ceti str. Cudo]
 gi|237815943|ref|ZP_04594940.1| coproporphyrinogen III oxidase [Brucella abortus str. 2308 A]
 gi|17982377|gb|AAL51648.1| coproporphyrinogen iii oxidase, aerobic [Brucella melitensis bv. 1
           str. 16M]
 gi|225617154|gb|EEH14200.1| coproporphyrinogen III oxidase [Brucella ceti str. Cudo]
 gi|237789241|gb|EEP63452.1| coproporphyrinogen III oxidase [Brucella abortus str. 2308 A]
          Length = 340

 Score =  356 bits (913), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 202/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 38  MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 97

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 98  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 152

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 153 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 212

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 213 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 272

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 273 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 332

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 333 MPPVVKWP 340


>gi|114328386|ref|YP_745543.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
 gi|114316560|gb|ABI62620.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
          Length = 299

 Score =  355 bits (912), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 135/292 (46%), Positives = 180/292 (61%), Gaps = 8/292 (2%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAH--ENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           K  ++  FE+L+  IC  FE +E++        +  P  F  + W R  S     GGG M
Sbjct: 14  KSAARLWFESLRDRICAAFEAIEDDLPPAAPFGDLPPGRFERQPWDRPTSDGSPGGGGVM 73

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
           + +  G+VFEK  V VSTV+G+ S DF+ QI G   +P FWA+G+S++ H  +PHVPAVH
Sbjct: 74  SVMR-GRVFEKVGVNVSTVWGEFSEDFRRQIPGAEHDPRFWASGISLVAHMRSPHVPAVH 132

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
            N RM+VT   WFGGG DLTP       +   D   FH + +  C  H  A Y  +K+WC
Sbjct: 133 MNTRMLVTTKGWFGGGGDLTPMFLDTPETA-EDRESFHASYRAACDAHDPALYPKFKQWC 191

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+LPHR E RG+GGIFFDH ++    G  + DF F   VG+ F+ +YP++VRR    
Sbjct: 192 DEYFFLPHRGEPRGVGGIFFDHHNT----GNAEEDFHFTRDVGEAFLNVYPAIVRRRMER 247

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            ++E +R  QL+RRGRY EFNLL+D+GT FG +TGGN E+IL SMPP V WP
Sbjct: 248 PWTEAERHHQLVRRGRYVEFNLLHDRGTLFGLRTGGNTEAILMSMPPEVRWP 299


>gi|315498162|ref|YP_004086966.1| coproporphyrinogen oxidase [Asticcacaulis excentricus CB 48]
 gi|315416174|gb|ADU12815.1| Coproporphyrinogen oxidase [Asticcacaulis excentricus CB 48]
          Length = 304

 Score =  355 bits (911), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 147/305 (48%), Positives = 189/305 (61%), Gaps = 8/305 (2%)

Query: 6   IEIGCP---DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
             +  P   D +  R++ +   F +L+  IC  FE LE+ A E     +P  FT K W R
Sbjct: 5   APLSAPLSADTLTTRQQAAAVWFRSLRDRICAAFEALEDAAPETLYGPTPGRFTRKPWTR 64

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
             ++  D GGG M+ +  G++FEK  V +STV+G  SPDF   I G  ++P F+ATG+S+
Sbjct: 65  SDAEHGDGGGGEMS-MMHGRLFEKVGVHISTVHGTFSPDFAKSIPGAAEDPRFFATGISL 123

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           I H +NPHVPAVH N R I T   WFGGG DLTP L + R    P    FH   +  C  
Sbjct: 124 IAHMWNPHVPAVHMNTRFINTTQSWFGGGADLTPLLAADRREDAPQAKAFHAAFEATCDH 183

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
            A   Y  +K WCD YF+LPHR E RGIGGIF+DHL++    G  +ADF+F  AVG+ F+
Sbjct: 184 FAPDYYARFKRWCDEYFFLPHRNEPRGIGGIFYDHLNT----GDHEADFAFTRAVGETFL 239

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
            +YP LV       ++E +R +QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP
Sbjct: 240 DIYPRLVSERSEVTWTEGERDQQLIQRGRYVEFNLLYDRGTLFGLKTGGNVESILSSMPP 299

Query: 303 LVAWP 307
            V WP
Sbjct: 300 AVKWP 304


>gi|306843104|ref|ZP_07475726.1| coproporphyrinogen III oxidase [Brucella sp. BO2]
 gi|306844549|ref|ZP_07477138.1| coproporphyrinogen III oxidase [Brucella sp. BO1]
 gi|306275160|gb|EFM56916.1| coproporphyrinogen III oxidase [Brucella sp. BO1]
 gi|306286709|gb|EFM58262.1| coproporphyrinogen III oxidase [Brucella sp. BO2]
          Length = 303

 Score =  355 bits (911), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 158/308 (51%), Positives = 203/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  ICT +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICTSYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNV +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|260462578|ref|ZP_05810785.1| Coproporphyrinogen oxidase [Mesorhizobium opportunistum WSM2075]
 gi|259031774|gb|EEW33043.1| Coproporphyrinogen oxidase [Mesorhizobium opportunistum WSM2075]
          Length = 299

 Score =  355 bits (910), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 157/303 (51%), Positives = 208/303 (68%), Gaps = 5/303 (1%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS 65
           + +G P DIEE+K  ++  FE L+  IC  FE++E +     A+ +P  F    W RD+ 
Sbjct: 1   MPLGLPADIEEKKMKARLWFEALRERICGAFEQIEQDLQGPLASWAPGRFEKTPWERDQG 60

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           +    GGG   ++  G+VFEK  V  STVYG+ SP+F+ QI G  ++P FWA+G+S+I H
Sbjct: 61  K----GGGGTMSMMHGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGISLIAH 116

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-A 184
           P+NP+VPAVH N RM+VT ++WFGGG DLTP L+ RR   DPD I FH  ++  C ++  
Sbjct: 117 PWNPNVPAVHMNTRMVVTSSHWFGGGADLTPVLDRRRTQDDPDSIAFHRAMQFACEKNAG 176

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
           VA+Y  +K WCD YFYLPHR E RG GGIFFD+LHS    GG +ADF+F+  VG  F+ +
Sbjct: 177 VADYPKFKTWCDEYFYLPHRNEPRGTGGIFFDYLHSGEAAGGWNADFNFVQDVGRSFLVV 236

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LVR N++  +++ DR EQLIRRGRY EFNLL+D+GT FG KTGGNV SIL+S+PP V
Sbjct: 237 YGHLVRANFNENWTDGDRDEQLIRRGRYVEFNLLHDRGTIFGLKTGGNVASILSSLPPEV 296

Query: 305 AWP 307
            WP
Sbjct: 297 RWP 299


>gi|256369966|ref|YP_003107477.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
 gi|256000129|gb|ACU48528.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
          Length = 303

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 202/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKRKDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|23502415|ref|NP_698542.1| coproporphyrinogen III oxidase [Brucella suis 1330]
 gi|62290435|ref|YP_222228.1| coproporphyrinogen III oxidase [Brucella abortus bv. 1 str. 9-941]
 gi|82700358|ref|YP_414932.1| coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|161619494|ref|YP_001593381.1| coproporphyrinogen III oxidase [Brucella canis ATCC 23365]
 gi|189024663|ref|YP_001935431.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|225853029|ref|YP_002733262.1| coproporphyrinogen III oxidase [Brucella melitensis ATCC 23457]
 gi|254689735|ref|ZP_05152989.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|254694224|ref|ZP_05156052.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|254697879|ref|ZP_05159707.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254704802|ref|ZP_05166630.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|254708216|ref|ZP_05170044.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|254710586|ref|ZP_05172397.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|254714769|ref|ZP_05176580.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|254717830|ref|ZP_05179641.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|254730770|ref|ZP_05189348.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|256032080|ref|ZP_05445694.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|256045172|ref|ZP_05448071.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114123|ref|ZP_05454877.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160276|ref|ZP_05457970.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|256255481|ref|ZP_05461017.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|256257988|ref|ZP_05463524.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|256263491|ref|ZP_05466023.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260169215|ref|ZP_05756026.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|260546969|ref|ZP_05822708.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260565229|ref|ZP_05835713.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|260565955|ref|ZP_05836425.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|260755267|ref|ZP_05867615.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260758488|ref|ZP_05870836.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260762313|ref|ZP_05874656.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884282|ref|ZP_05895896.1| coproporphyrinogen 3 oxidase [Brucella abortus bv. 9 str. C68]
 gi|261214531|ref|ZP_05928812.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|261219676|ref|ZP_05933957.1| coproporphyrinogen 3 oxidase [Brucella ceti M13/05/1]
 gi|261222688|ref|ZP_05936969.1| coproporphyrinogen 3 oxidase [Brucella ceti B1/94]
 gi|261315720|ref|ZP_05954917.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M163/99/10]
 gi|261318158|ref|ZP_05957355.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis B2/94]
 gi|261322565|ref|ZP_05961762.1| coproporphyrinogen 3 oxidase [Brucella ceti M644/93/1]
 gi|261755496|ref|ZP_05999205.1| coproporphyrinogen 3 oxidase [Brucella suis bv. 3 str. 686]
 gi|261758727|ref|ZP_06002436.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|265989189|ref|ZP_06101746.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M292/94/1]
 gi|265991603|ref|ZP_06104160.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995441|ref|ZP_06107998.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 3 str. Ether]
 gi|265998652|ref|ZP_06111209.1| coproporphyrinogen 3 oxidase [Brucella ceti M490/95/1]
 gi|294852867|ref|ZP_06793540.1| coproporphyrinogen III oxidase [Brucella sp. NVSL 07-0026]
 gi|297248820|ref|ZP_06932538.1| coproporphyrinogen III oxidase, aerobic [Brucella abortus bv. 5
           str. B3196]
 gi|54037274|sp|P63851|HEM6_BRUSU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|54041269|sp|P63850|HEM6_BRUME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|75496448|sp|Q57BW7|HEM6_BRUAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123547584|sp|Q2YS10|HEM6_BRUA2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740642|sp|B2S710|HEM6_BRUA1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740643|sp|A9M6L4|HEM6_BRUC2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800266|sp|C0REI6|HEM6_BRUMB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|23348402|gb|AAN30457.1| coproporphyrinogen III oxidase, aerobic [Brucella suis 1330]
 gi|62196567|gb|AAX74867.1| HemF, coproporphyrinogen III oxidase [Brucella abortus bv. 1 str.
           9-941]
 gi|82616459|emb|CAJ11522.1| Coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|161336305|gb|ABX62610.1| Coproporphyrinogen oxidase [Brucella canis ATCC 23365]
 gi|189020235|gb|ACD72957.1| Coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|225641394|gb|ACO01308.1| Coproporphyrinogen oxidase [Brucella melitensis ATCC 23457]
 gi|260096019|gb|EEW79896.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260151297|gb|EEW86391.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|260155473|gb|EEW90553.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|260668806|gb|EEX55746.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260672745|gb|EEX59566.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675375|gb|EEX62196.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260873810|gb|EEX80879.1| coproporphyrinogen 3 oxidase [Brucella abortus bv. 9 str. C68]
 gi|260916138|gb|EEX82999.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|260921272|gb|EEX87925.1| coproporphyrinogen 3 oxidase [Brucella ceti B1/94]
 gi|260924765|gb|EEX91333.1| coproporphyrinogen 3 oxidase [Brucella ceti M13/05/1]
 gi|261295255|gb|EEX98751.1| coproporphyrinogen 3 oxidase [Brucella ceti M644/93/1]
 gi|261297381|gb|EEY00878.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis B2/94]
 gi|261304746|gb|EEY08243.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M163/99/10]
 gi|261738711|gb|EEY26707.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|261745249|gb|EEY33175.1| coproporphyrinogen 3 oxidase [Brucella suis bv. 3 str. 686]
 gi|262553276|gb|EEZ09110.1| coproporphyrinogen 3 oxidase [Brucella ceti M490/95/1]
 gi|262766554|gb|EEZ12343.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 3 str. Ether]
 gi|263002387|gb|EEZ14962.1| coproporphyrinogen 3 oxidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093514|gb|EEZ17548.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661386|gb|EEZ31647.1| coproporphyrinogen 3 oxidase [Brucella pinnipedialis M292/94/1]
 gi|294821456|gb|EFG38455.1| coproporphyrinogen III oxidase [Brucella sp. NVSL 07-0026]
 gi|297175989|gb|EFH35336.1| coproporphyrinogen III oxidase, aerobic [Brucella abortus bv. 5
           str. B3196]
 gi|326409569|gb|ADZ66634.1| Coproporphyrinogen III oxidase [Brucella melitensis M28]
 gi|326539273|gb|ADZ87488.1| coproporphyrinogen oxidase [Brucella melitensis M5-90]
          Length = 303

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 202/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|256061602|ref|ZP_05451743.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261325609|ref|ZP_05964806.1| coproporphyrinogen 3 oxidase [Brucella neotomae 5K33]
 gi|261301589|gb|EEY05086.1| coproporphyrinogen 3 oxidase [Brucella neotomae 5K33]
          Length = 303

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 201/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I H  NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHLQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|163843804|ref|YP_001628208.1| coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|163674527|gb|ABY38638.1| Coproporphyrinogen oxidase [Brucella suis ATCC 23445]
          Length = 303

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 201/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFVFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|85714276|ref|ZP_01045264.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
 gi|85698723|gb|EAQ36592.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
          Length = 295

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 149/295 (50%), Positives = 192/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++  K  ++  FE L+  IC+ FEKLE++A  +    S   F    W R     +  GGG
Sbjct: 6   LDNHKTRARSWFEQLRDDICSAFEKLEDDAPASLYPGSAGRFVRTPWERTDHTGQPGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPH+PA
Sbjct: 66  VMS-MMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPNFWASGISLIAHMRNPHIPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV-ANYTHYK 192
           VH N R +VT   WFGGG DLTP L  RR   DPD + FH  +K  C  HA  A Y  YK
Sbjct: 125 VHMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDPDSVAFHAAMKSACDAHAAIAPYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E+RGIGGIF+D   S    G  DAD +F   VG   +++YP +VR N
Sbjct: 185 TWCDEYFYLPHRKEARGIGGIFYDWHDS----GDWDADLAFTQDVGRALLRVYPEIVRSN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           ++  ++  DR+EQ+IRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FNTPWTAADREEQVIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|254719583|ref|ZP_05181394.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|265984591|ref|ZP_06097326.1| coproporphyrinogen 3 oxidase [Brucella sp. 83/13]
 gi|306837928|ref|ZP_07470788.1| coproporphyrinogen III oxidase [Brucella sp. NF 2653]
 gi|264663183|gb|EEZ33444.1| coproporphyrinogen 3 oxidase [Brucella sp. 83/13]
 gi|306407016|gb|EFM63235.1| coproporphyrinogen III oxidase [Brucella sp. NF 2653]
          Length = 303

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 202/308 (65%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPTDIEEKKQAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFIRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA+G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   K+WCD YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKDWCDEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGNV +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVNTILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|254470296|ref|ZP_05083700.1| coproporphyrinogen III oxidase, aerobic [Pseudovibrio sp. JE062]
 gi|211960607|gb|EEA95803.1| coproporphyrinogen III oxidase, aerobic [Pseudovibrio sp. JE062]
          Length = 303

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 153/308 (49%), Positives = 206/308 (66%), Gaps = 8/308 (2%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLE---NEAHENSANRSPKIFTVKH 59
           +   +   P D+E++K+ +   F  L+  ICT FE+LE    E     A++    F    
Sbjct: 1   MSDSQNTLPADLEDKKKEASAWFTQLRDNICTAFEQLEEEVGEQDGPLADQPAGRFERTP 60

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R        GGG M+ L  G+VFEK  V VSTV+G+ SP+F+DQI G +++P FWA+G
Sbjct: 61  WERTDHSGGHGGGGVMS-LMHGRVFEKVGVHVSTVHGEFSPEFRDQIPGASEDPRFWASG 119

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           +S+I H +NP+VPAVH N RM+VT   WFGGG DLTP L +RR   DPD + FH  +K  
Sbjct: 120 ISLIAHMHNPNVPAVHMNTRMVVTTKQWFGGGADLTPVLSARRTQEDPDTVEFHEAMKAA 179

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C  H  A+Y H+K+WCD YFYLPHR+E+RGIGGIF+D  ++    G  +AD +F  +VG+
Sbjct: 180 CVDHPGADYDHFKKWCDEYFYLPHRKEARGIGGIFYDRHNT----GDWNADLAFTKSVGN 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +YP LVR+N+   ++ + R+EQL+RRGRY EFNLLYD+GT FG KTGGNV SIL+S
Sbjct: 236 AFLDIYPKLVRKNFLTPWTLEQREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVSSILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|298292456|ref|YP_003694395.1| coproporphyrinogen oxidase [Starkeya novella DSM 506]
 gi|296928967|gb|ADH89776.1| Coproporphyrinogen oxidase [Starkeya novella DSM 506]
          Length = 297

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 152/299 (50%), Positives = 193/299 (64%), Gaps = 5/299 (1%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKE 68
             P DIE RK+ ++  FE L++ IC  FEKLE+EA +     +P  F    W R      
Sbjct: 4   AIPADIEARKQAARAWFEELRNRICACFEKLEDEASDALYPGAPGRFERTPWQRTDHSGG 63

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
             GGG MA +  G++FEK  V  STV+G+ +P+F+ QI G  ++P F ATG+S+I H  N
Sbjct: 64  PGGGGTMAVMR-GRLFEKVGVHCSTVHGEFAPEFRQQIPGAEEDPRFHATGISLIAHMTN 122

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N R +VT   WFGGG DLTP L++RR   DPD + FH  ++  C      +Y
Sbjct: 123 PHVPAVHMNTRFVVTSKAWFGGGADLTPVLDARRTQEDPDSVAFHAAMRGACESRPHIDY 182

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             YK WCD YF+LPHR E+RGIGGIF+D L S    G  + DF F  AVG  F+ +YP L
Sbjct: 183 GRYKAWCDEYFFLPHRGEARGIGGIFYDWLDS----GDWEGDFHFTKAVGLAFLDVYPRL 238

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           VR N    +   +R+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 239 VRANADTPWGMAEREEQLVRRGRYVEFNLLYDRGTLFGLKTGGNVDSILSSMPPVVKWP 297


>gi|315122467|ref|YP_004062956.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495869|gb|ADR52468.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 307

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 237/306 (77%), Positives = 268/306 (87%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MNL  IE+G PD+IEE KR +QRKFENLQSIIC EFEKLENE   NS+N   +IF  KHW
Sbjct: 1   MNLGKIELGLPDNIEEWKRRAQRKFENLQSIICAEFEKLENELTGNSSNIPSEIFKSKHW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           +RDKS+K DLGGG MATL  GKVFEKAAVLVSTVYGDLS +F+DQI GT ++PYFWA GL
Sbjct: 61  VRDKSKKNDLGGGHMATLYGGKVFEKAAVLVSTVYGDLSVNFRDQIPGTLQSPYFWAAGL 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVI HPYNPHVPA+HFNIRMIVTGAYWFGGGIDLTP LESRR   DPDV+FFH++LK++ 
Sbjct: 121 SVIAHPYNPHVPAIHFNIRMIVTGAYWFGGGIDLTPFLESRRQLDDPDVMFFHDSLKKIF 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           +QH VA+Y HYKEWCD+YFYLPHR+E+RG+GGIFFD+LHS  E+GGIDADFSF+SAVGDC
Sbjct: 181 AQHTVADYNHYKEWCDQYFYLPHREEARGVGGIFFDYLHSKQEIGGIDADFSFVSAVGDC 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+ LYP LVRRNY   F++Q+RQEQLIRRGRY EFNLLYDKGTNFGFKTGGNVESILASM
Sbjct: 241 FVTLYPLLVRRNYRRSFTKQERQEQLIRRGRYVEFNLLYDKGTNFGFKTGGNVESILASM 300

Query: 301 PPLVAW 306
           PP+VAW
Sbjct: 301 PPMVAW 306


>gi|148559586|ref|YP_001259425.1| coproporphyrinogen III oxidase [Brucella ovis ATCC 25840]
 gi|148370843|gb|ABQ60822.1| coproporphyrinogen III oxidase, aerobic [Brucella ovis ATCC 25840]
          Length = 303

 Score =  351 bits (901), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 200/308 (64%), Gaps = 6/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I    P DIEE+K+ +Q  FE L+  IC  +E+LE+E     ++R P  F    W
Sbjct: 1   MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            +D           + ++  G+VFEK  V VSTV+G+ SP+F+ QI G  ++P +WA G+
Sbjct: 61  QKDDGNGG-----GVMSIMHGRVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWAGGI 115

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP NP+VPAVH N RMIVT   WF GG DLTP L+ RR   DPD + FH   + +C
Sbjct: 116 SLIAHPQNPNVPAVHMNTRMIVTTRQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFIC 175

Query: 181 SQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            +H    +Y   KEWC  YF+LPHR E RGIGGIF+D LHS  E GG D+DF+F   VG 
Sbjct: 176 EKHKDIVDYQRLKEWCYEYFFLPHRDEPRGIGGIFYDWLHSPEEKGGWDSDFAFTRDVGR 235

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F  +YP LVR+N++  ++E DR EQLIRRGRY EFNLLYD+GT FG KTGGN+ +IL+S
Sbjct: 236 GFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNMNAILSS 295

Query: 300 MPPLVAWP 307
           MPP+V WP
Sbjct: 296 MPPVVKWP 303


>gi|167644667|ref|YP_001682330.1| coproporphyrinogen III oxidase [Caulobacter sp. K31]
 gi|189028099|sp|B0T8D1|HEM6_CAUSK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167347097|gb|ABZ69832.1| Coproporphyrinogen oxidase [Caulobacter sp. K31]
          Length = 290

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 138/300 (46%), Positives = 183/300 (61%), Gaps = 10/300 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +    D++ +K  ++  FE+L+  IC EFE+LE+EA  +     P  F  K W R+    
Sbjct: 1   MTDTSDLDGKKATARAWFESLRDQICAEFERLEDEAPTDLYAGEPGRFVRKPWDREAGGG 60

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
             +       +  G++FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  
Sbjct: 61  GVMS------MMHGRLFEKVGVHVSTVFGTFTPEMAKNMPGADEDPRFFATGISLIAHMR 114

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           +P VPAVH N R I T   WFGGG DLTP L  +R    PD I FH   +  C  H    
Sbjct: 115 SPRVPAVHMNTRFIATTKSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYQRACDAHDPTW 174

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           +  YK WCD YF+LPHR E RGIGGIF+DH  S    G    DF+F   VG  F+++YP+
Sbjct: 175 HAKYKAWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWAKDFAFTQDVGRAFLEIYPT 230

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           LVRR     +S ++R++QL++RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 231 LVRRRMGETWSAEEREQQLVQRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPEVKWP 290


>gi|148253793|ref|YP_001238378.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. BTAi1]
 gi|146405966|gb|ABQ34472.1| coproporphyrinogen oxidase [Bradyrhizobium sp. BTAi1]
          Length = 295

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 157/295 (53%), Positives = 197/295 (66%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE+L+  IC  FE+LE+EA      R P  F    W R        GGG
Sbjct: 6   IEDRKARARAWFESLRDQICAAFEQLEDEAPAALYPRQPGRFVRTPWQRTDHSGAPGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M  +   ++FEK  V  STV+G+ +P+F+ QI G +++P FWA+G+S+I H ++PHVPA
Sbjct: 66  VMGMMHG-RLFEKVGVHCSTVHGEFAPEFRSQIPGASEDPRFWASGISLIAHLWSPHVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR+  DPD + FH  L+  C  H  VA Y  YK
Sbjct: 125 VHMNTRFVVTTKAWFGGGADLTPVLDRRRNQEDPDTLAFHAALQGACDAHATVAPYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E RGIGGIF+DH  S    G  +AD +F   VG  F+K+YP LVRRN
Sbjct: 185 RWCDEYFYLPHRKEPRGIGGIFYDHHDS----GDWEADLAFTQDVGRAFLKVYPELVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FGAAWTEADREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPPEVKWP 295


>gi|319781861|ref|YP_004141337.1| coproporphyrinogen oxidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167749|gb|ADV11287.1| Coproporphyrinogen oxidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 304

 Score =  349 bits (896), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 152/308 (49%), Positives = 204/308 (66%), Gaps = 5/308 (1%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    I  G P DIE++K  ++  FE L+  IC  FE++E +     A+ SP  F    W
Sbjct: 1   MERPEIPAGLPADIEQKKMKARLWFEALRERICATFEQIEQDLGGPLASWSPGRFEKTPW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            RD+ +          ++  G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+
Sbjct: 61  ERDEGRGGGG----TMSMMHGRVFEKVGVHTSTVHGEFSPEFRKQMPGAEEDPRFWASGI 116

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I HP+NP+VPAVH N RM+VT + WFGGG DLTP L+ RR   DPD + FH  ++  C
Sbjct: 117 SLIAHPWNPNVPAVHMNTRMVVTSSQWFGGGADLTPVLDRRRTQDDPDTVAFHRAMQFAC 176

Query: 181 SQH-AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
            ++ AVA+Y  +K WCD YFYL HR E RG GGIFFD LHS  + GG +ADF+F+  VG 
Sbjct: 177 EKNVAVADYPKFKAWCDEYFYLSHRNELRGTGGIFFDWLHSGEDKGGWNADFNFVQDVGR 236

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+ +Y  LVR N++  +++ DR EQLIRRGRY EFNLL+D+GT FG KTGGNV +IL+S
Sbjct: 237 AFLVVYGHLVRANFNENWTDGDRDEQLIRRGRYVEFNLLHDRGTIFGLKTGGNVAAILSS 296

Query: 300 MPPLVAWP 307
           +PP V WP
Sbjct: 297 LPPEVRWP 304


>gi|254293108|ref|YP_003059131.1| coproporphyrinogen III oxidase [Hirschia baltica ATCC 49814]
 gi|254041639|gb|ACT58434.1| Coproporphyrinogen oxidase [Hirschia baltica ATCC 49814]
          Length = 297

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 146/299 (48%), Positives = 190/299 (63%), Gaps = 7/299 (2%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
            P+ +E RK +++  FENLQS I   FE+LE EA           F +  W R +  ++ 
Sbjct: 5   SPEQMESRKSVAKAWFENLQSDIIARFEQLEEEASPPLYKGIAGKFEITPWKRGQDGEDL 64

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-GTTKNPYFWATGLSVIVHPYN 128
            GG     +  G++FEK  V  STVYG+ S +F+ QI      +  FWA+G+S+I H +N
Sbjct: 65  GGGN--MAIMKGRLFEKVGVHTSTVYGEFSEEFRKQIPGAEENDGKFWASGISLIAHMHN 122

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N RMI T   WFGGG DLTP +E +RH  +PD I FH  +K  C  H  A+Y
Sbjct: 123 PHVPAVHMNTRMICTSKSWFGGGADLTPLMEVQRHQDNPDAIAFHAAMKAACDAHEGADY 182

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K+WCD YFYLPHR+E RG GGIF+D   +    G  DAD +F   VG+ F  +YP++
Sbjct: 183 ARFKDWCDEYFYLPHREEPRGTGGIFYDRHDT----GNWDADLAFTKDVGEAFAAIYPTI 238

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           VR   +  ++E DR  QLI+RGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 239 VRNRMNQSWNEADRDAQLIQRGRYVEFNLLYDRGTTFGLKTGGNVKSILSSMPPVVKWP 297


>gi|294085753|ref|YP_003552513.1| coproporphyrinogen III oxidase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665328|gb|ADE40429.1| coproporphyrinogen III oxidase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 286

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 131/296 (44%), Positives = 175/296 (59%), Gaps = 16/296 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
             ++++K+ +   F +L+  IC  FE +E++      +     F  K W R      + G
Sbjct: 7   TSLDDKKQAATAWFASLRDQICARFESIEDQYTGAP-DLESGRFARKTWNR------EGG 59

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG + ++  G+VFEK  V +STV+G  S +F+D+I G      FWA G+S++ H  NPHV
Sbjct: 60  GGGVMSIMHGRVFEKVGVNISTVHGVFSDEFRDKIPGAETTGDFWAAGISLVAHMRNPHV 119

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PA H N R I T   WFGGG DLTP L       + +   FH  ++  C  H    Y  Y
Sbjct: 120 PAAHMNTRFITTSKSWFGGGGDLTPLLPD-----EINAAKFHLAMQSACDAHDPDYYPKY 174

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YFYLPHR E RG GGIF+D+L S    G  DADF+F   VG  F   Y ++V  
Sbjct: 175 KKWCDDYFYLPHRDEPRGAGGIFYDNLDS----GNWDADFAFTRDVGIAFKDGYSAIVEA 230

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           + +  +S+ +R EQL+RRGRY EFNLLYD+GT FG KTGGN+E+IL SMPP V WP
Sbjct: 231 SMNQPWSDAERHEQLVRRGRYVEFNLLYDRGTLFGLKTGGNIEAILMSMPPQVRWP 286


>gi|163795182|ref|ZP_02189150.1| coproporphyrinogen III oxidase [alpha proteobacterium BAL199]
 gi|159179580|gb|EDP64109.1| coproporphyrinogen III oxidase [alpha proteobacterium BAL199]
          Length = 293

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 132/294 (44%), Positives = 175/294 (59%), Gaps = 17/294 (5%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSP-KIFTVKHWLRDKSQKEDLGGG 73
           +  +  +Q  F +L+  IC  FE LE+       ++ P   FT K W RD       GGG
Sbjct: 16  DAERAEAQAWFASLRDQICAAFEALEDAYDGPLRDQHPAGRFTRKTWDRD------GGGG 69

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
              +L  G+VFEK  V +STV+G+ S +F+  I G  ++P F+A+G+S++ H  +P VPA
Sbjct: 70  GTMSLMHGRVFEKVGVNISTVHGEFSEEFRASIPGAAEDPRFFASGISLVAHLRSPRVPA 129

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           VH N R I T   WFGGG DLTP +       D D   FH   +  C  H  A Y  +K 
Sbjct: 130 VHMNTRHIATTKSWFGGGADLTPMVPD-----DTDTRDFHAAFQAACDAHDPAYYPRFKA 184

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+L HR E RG+GGIF+D++      G    D +F   VG  F+ +YPSLV R+ 
Sbjct: 185 WCDEYFFLKHRNEPRGVGGIFYDYVD-----GDFATDLAFTRDVGLAFLDVYPSLVERHM 239

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
              +++ +RQ QL+RRGRY EFNLLYD+GT FG KTGGNVE+IL S+PP VAWP
Sbjct: 240 SEPWTDAERQHQLVRRGRYVEFNLLYDRGTLFGLKTGGNVEAILMSLPPEVAWP 293


>gi|258541901|ref|YP_003187334.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632979|dbj|BAH98954.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636036|dbj|BAI02005.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639091|dbj|BAI05053.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642145|dbj|BAI08100.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645200|dbj|BAI11148.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648255|dbj|BAI14196.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651308|dbj|BAI17242.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654299|dbj|BAI20226.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 304

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 130/292 (44%), Positives = 178/292 (60%), Gaps = 11/292 (3%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPK-----IFTVKHWLRDKSQKEDLGGGRM 75
           +++ FE+L+  IC  FE +E++A + ++   P       F  K W R        GGG M
Sbjct: 19  ARQWFESLRDKICAAFEAIEDDAVKQNSPVLPGHEAAGRFERKSWNRLNEDGSPGGGGVM 78

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
           + +  G+VFEK  V VSTV G  +P+F   I G  ++P+F+ATG+S++ H  +P VPA H
Sbjct: 79  SVM-HGRVFEKVGVNVSTVQGTFTPEFAATIPGAAEDPHFFATGISLVAHMCSPLVPAAH 137

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN RMI+T   WFGGG D+TP       + D D   FH    + C+ H    Y  +K WC
Sbjct: 138 FNTRMIITTKGWFGGGGDITPMFPESAEAQD-DAARFHAAFAQACNAHDPEYYPRFKAWC 196

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D+YFYLPHR E RG+GGIF+D L+S    G +  DF+F   VG  F+K YP ++R     
Sbjct: 197 DKYFYLPHRNEPRGLGGIFYDRLNS----GDVQEDFAFTKDVGLAFLKSYPEIIRSRMME 252

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            ++ + R+ QLIRRGRY EFNL++D+GT FG KTGG+ E+IL SMPP V WP
Sbjct: 253 PWTPEQREAQLIRRGRYVEFNLVHDRGTLFGLKTGGHTEAILMSMPPEVKWP 304


>gi|114569285|ref|YP_755965.1| coproporphyrinogen III oxidase [Maricaulis maris MCS10]
 gi|114339747|gb|ABI65027.1| coproporphyrinogen oxidase [Maricaulis maris MCS10]
          Length = 318

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 186/305 (60%), Gaps = 8/305 (2%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +         DI  ++  +   FE+L+  IC EFE LE EA           F  + W R
Sbjct: 22  MTHTPASAATDI--QRESATCWFEDLRDQICAEFESLEQEAPGALYPGEAGKFEREAWTR 79

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
                ++  GG    +  G++FEK  V VS V G+ S  F+ QI G  ++P F+ATG+S+
Sbjct: 80  GDGSSDE--GGGTMAMMRGRLFEKVGVHVSAVQGEFSEAFRQQIPGAAEDPRFFATGVSL 137

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           I H ++PHVPAVH N R I T  +WFGGG+DLTP L+  R+   PD I FH   K  C +
Sbjct: 138 IAHMWSPHVPAVHMNTRFITTTQWWFGGGMDLTPVLDRARNQRHPDAIDFHAACKAACDE 197

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    +  +K+WCD YFYLPHR E RGIGGIF+D  ++    G  DADFSF   VG  F+
Sbjct: 198 HGDDFHARFKKWCDEYFYLPHRDEPRGIGGIFYDRHNT----GDWDADFSFTRDVGLAFL 253

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
            +YP +VRR     ++ +DR+EQLIRRGRYAEFNLL+D+GT FG +TGGNV+SIL+SMPP
Sbjct: 254 DIYPKIVRRRMGETWTPKDREEQLIRRGRYAEFNLLHDRGTKFGLETGGNVKSILSSMPP 313

Query: 303 LVAWP 307
              WP
Sbjct: 314 EAKWP 318


>gi|312114062|ref|YP_004011658.1| coproporphyrinogen oxidase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219191|gb|ADP70559.1| Coproporphyrinogen oxidase [Rhodomicrobium vannielii ATCC 17100]
          Length = 315

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 157/304 (51%), Positives = 201/304 (66%), Gaps = 6/304 (1%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRD 63
           T  +            ++  F +L++ IC EFE++E+E      A+  P  F  K W R 
Sbjct: 17  TSPLDNSGPFHPEMSKARVWFASLRNDICNEFERIEDELKSGPHASLPPGRFEKKPWRRT 76

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
               ED GGG MA L  G+VFEK  V VSTV+G+ +P+F+ QI G+ ++P F A+G+S+I
Sbjct: 77  DHTGEDGGGGTMAML-HGRVFEKVGVHVSTVHGEFAPEFRAQIPGSEEDPRFRASGISLI 135

Query: 124 VHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
            H  NP+VP VH N R IVT  +WFGGG DLTP L  RR   DPDV+ FH   +  C +H
Sbjct: 136 AHMRNPNVPTVHLNTRFIVTSKWWFGGGSDLTPMLSKRRRVEDPDVLDFHAAFRSACLKH 195

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
            VA+Y+ YKEWCD YFYLPHRQE+RG+GGIF+D+ +S    G  DADF+F   VG  F+ 
Sbjct: 196 PVADYSRYKEWCDEYFYLPHRQEARGLGGIFYDYHNS----GDWDADFAFTQDVGRAFLA 251

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
           + P L+R N H  +SE DR EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+
Sbjct: 252 VVPKLIRANMHTPWSEADRDEQLVRRGRYVEFNLLYDRGTVFGLKTGGNVDSILSSMPPV 311

Query: 304 VAWP 307
           V WP
Sbjct: 312 VKWP 315


>gi|295687831|ref|YP_003591524.1| coproporphyrinogen oxidase [Caulobacter segnis ATCC 21756]
 gi|295429734|gb|ADG08906.1| Coproporphyrinogen oxidase [Caulobacter segnis ATCC 21756]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 139/300 (46%), Positives = 183/300 (61%), Gaps = 10/300 (3%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +    D++ +K  ++  FE+L+  IC EFE+LE+EA  +    +P  F  K W R+    
Sbjct: 1   MSTEQDLDAKKARARAWFESLRDQICAEFERLEDEAPADLYPGAPGRFEKKPWSREAGGG 60

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
             +G           +FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  
Sbjct: 61  GVMGMMHGR------LFEKVGVHVSTVHGTFTPEMAKNMPGADEDPRFFATGVSLIAHMT 114

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           NP VPAVH N R I T   WFGGG DLTP L  +R    PD I FH   +  C ++    
Sbjct: 115 NPRVPAVHMNTRFIATTKTWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYQRACDKYDPTW 174

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           +  YK WCD YF+LPHR E RGIGGIF+DH  S    G  + DF+F   VG  F+++YP+
Sbjct: 175 HAKYKAWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWERDFAFTQDVGRAFLEIYPT 230

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           LVRR     ++  +RQ+QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 231 LVRRRMGEAWTADERQQQLIQRGRYVEFNLLYDRGTTFGLKTGGNVESILSSMPPTVKWP 290


>gi|254559258|ref|YP_003066353.1| Coproporphyrinogen III oxidase, aerobic [Methylobacterium
           extorquens DM4]
 gi|254266536|emb|CAX22300.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens DM4]
          Length = 307

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 149/310 (48%), Positives = 191/310 (61%), Gaps = 9/310 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN---SANRSPKIFTVK 58
           +     +  PDD+   K  +   F  L+  I    E LE EA       A +    F   
Sbjct: 3   DATASPLPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKT 62

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R        GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+AT
Sbjct: 63  PWQRTDHSGAPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFAT 121

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S+IVHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E
Sbjct: 122 GISLIVHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQQDPDTQFFHACLRE 181

Query: 179 MCSQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
            C +HA A +Y  YK WCD YF+L HR E RGIGGIF+D+  +    G   AD ++   V
Sbjct: 182 ACEKHAPAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWT----GDPQADLAYTRDV 237

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G  F+K YP +VRRN    ++E DR++Q +RRGRY EFNLLYD+GT FG KTGGNV SIL
Sbjct: 238 GGAFLKAYPEIVRRNLAQAWTEADREQQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASIL 297

Query: 298 ASMPPLVAWP 307
           +S+PP V WP
Sbjct: 298 SSLPPTVRWP 307


>gi|240137247|ref|YP_002961716.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens AM1]
 gi|240007213|gb|ACS38439.1| Coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Methylobacterium extorquens AM1]
          Length = 307

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 150/310 (48%), Positives = 191/310 (61%), Gaps = 9/310 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN---SANRSPKIFTVK 58
           +     +  PDD+   K  +   F  L+  I    E LE EA       A +    F   
Sbjct: 3   DATASPLPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKT 62

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R        GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+AT
Sbjct: 63  PWQRTDHSGAPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFAT 121

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S+IVHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E
Sbjct: 122 GISLIVHPWNPNVPTVHMNTRFVVTTKTWFGGGADLTPVLDRRRTQEDPDTQFFHACLRE 181

Query: 179 MCSQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
            C +HA A +Y  YK WCD YF+L HR E RGIGGIF+D+  +    G   AD ++   V
Sbjct: 182 ACEKHAPAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWT----GDPQADLAYTRDV 237

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G  F+K YP +VRRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL
Sbjct: 238 GGAFLKAYPEIVRRNLAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASIL 297

Query: 298 ASMPPLVAWP 307
           +S+PP V WP
Sbjct: 298 SSLPPTVRWP 307


>gi|75676805|ref|YP_319226.1| coproporphyrinogen III oxidase [Nitrobacter winogradskyi Nb-255]
 gi|74421675|gb|ABA05874.1| coproporphyrinogen oxidase [Nitrobacter winogradskyi Nb-255]
          Length = 300

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 152/295 (51%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E+RK  ++  FE L+  IC+ FEKLE++A  +    S   F    W R     +  GGG
Sbjct: 11  LEDRKARARSWFEQLRDDICSAFEKLEDDAPASLYPGSAGRFVRTPWERTDHTGKPGGGG 70

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I H  NPH+PA
Sbjct: 71  VMS-MMHGRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPNFWASGISLIAHMRNPHIPA 129

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA-NYTHYK 192
           VH N R +VT   WFGGG DLTP L  RR   DPD + FH  +K  C  HA    Y  YK
Sbjct: 130 VHMNTRFVVTTKAWFGGGGDLTPVLMRRRTQEDPDSVAFHAAMKAACDAHAAIAPYDKYK 189

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR+E+RGIGGIF+D   S    G  +AD +F   VG   +K+YP LVRRN
Sbjct: 190 TWCDEYFHLPHRKEARGIGGIFYDWHDS----GDWNADLAFTQDVGRALLKVYPELVRRN 245

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++  DR+EQLIRRGRYAEFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 246 FSTPWTAADREEQLIRRGRYAEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 300


>gi|162147842|ref|YP_001602303.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542462|ref|YP_002274691.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786419|emb|CAP56001.1| putative coproporphyrinogen 3 oxidase, aerobic [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530139|gb|ACI50076.1| Coproporphyrinogen oxidase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 300

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 135/308 (43%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSA---NRSPKIFTVKH 59
           +       P D+   K  +   FE L+  IC  FE++E +A    A   + +P  F    
Sbjct: 1   MPETRAPVPHDLL--KAEASTWFEGLRDRICAAFERIEQDADSVQALPGHAAPGAFQRTA 58

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R        GGG ++ +  G+VFEK  V VSTV G  SP+F+  I G  ++P F+ATG
Sbjct: 59  WDRTNDDGTPGGGGVISLMR-GRVFEKVGVNVSTVEGTFSPEFRASIPGAAEDPRFFATG 117

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           +S++ H  NP VPA HFN R+IVT   WFGGG D+TP       +   D   FH   +  
Sbjct: 118 ISLVAHMCNPLVPAAHFNTRLIVTTQGWFGGGGDITPMFPDSAEAQA-DAARFHAGFRAA 176

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C +H    Y  +KEWCDRYF+LPHR E+RG+GGIF+D L+S    G   ADF+F   VG 
Sbjct: 177 CDRHDPTYYPRFKEWCDRYFFLPHRGEARGLGGIFYDRLNS----GDEAADFAFTRDVGL 232

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F++ YP++VR      ++   R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S
Sbjct: 233 AFLETYPAIVRHRMGERWTAHQREAQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMS 292

Query: 300 MPPLVAWP 307
           +PP V WP
Sbjct: 293 LPPEVRWP 300


>gi|84685223|ref|ZP_01013122.1| coproporphyrinogen III oxidase, aerobic [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666955|gb|EAQ13426.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           HTCC2654]
          Length = 296

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 119/304 (39%), Positives = 167/304 (54%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKE 68
             D ++++K  +   F +L+  I   FE LE+ +     A  +P  F VK   R      
Sbjct: 1   MTDMMDDQKARASAWFRDLRDQIVAAFEALEDSQTTGPFAENAPGRFEVKSTTRTSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V +STVYG L    +  +      G   +P FWA+G+S++
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISTVYGVLGEAAQKSMAARGVPGIEADPSFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T  A+WFGGG DL P +E     YD D   FH  +K  C  
Sbjct: 121 AHMQNPHSPAVHMNTRMFWTPGAWWFGGGADLNPCIE-----YDEDTAHFHAAMKAGCDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A Y  YK W D YFY+PHR+ +RG+GGIF+D  ++    G  +ADF+F   VG  F+
Sbjct: 176 HDPAYYDRYKAWADEYFYIPHRRRARGVGGIFYDDHNT----GDWEADFAFTQDVGRAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  +  +     +   D+  QL+ RG YAE+NL+YD+GT FG  T  + +++L S+PP
Sbjct: 232 PAFLPVTEKRRDTPWDAADKDTQLVHRGLYAEYNLVYDRGTKFGLATSHDPDAVLMSLPP 291

Query: 303 LVAW 306
           L  W
Sbjct: 292 LAKW 295


>gi|146339023|ref|YP_001204071.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
 gi|146191829|emb|CAL75834.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 157/295 (53%), Positives = 200/295 (67%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           IE+RK  ++  FE+L+  IC  FE+LE EA  +   R+   F    W R        GGG
Sbjct: 6   IEDRKARARAWFESLRDQICAAFERLEEEAPADLYPRASAHFVRTPWERTDHGGGHGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +   ++FEK  V  STV+G+ +P+F+ QI G +++P FWA+G+S+I H ++PHVPA
Sbjct: 66  VMSMMHG-RLFEKVGVHCSTVHGEFAPEFRSQIPGASEDPRFWASGISLIAHLWSPHVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR+  DPD + FH  +K  C  HA VA+Y  YK
Sbjct: 125 VHMNTRFVVTTKSWFGGGADLTPVLDRRRNQEDPDTVAFHAAMKGACDAHAAVASYDKYK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYLPHR+E RGIGGIF+DH  S    G  DAD +F   VG  F+K+YP LVRRN
Sbjct: 185 RWCDEYFYLPHRKEPRGIGGIFYDHHDS----GNWDADLAFTQDVGRAFLKVYPDLVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   ++E DR+EQLIRRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V WP
Sbjct: 241 FSAPWTEADREEQLIRRGRYVEFNLLYDRGTTFGLKTGGNVDSILSSMPPEVKWP 295


>gi|296115116|ref|ZP_06833757.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978217|gb|EFG84954.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 303

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 134/298 (44%), Positives = 183/298 (61%), Gaps = 10/298 (3%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANR-----SPKIFTVKHWLRDKSQKED 69
           +  K  ++  F+NL+  IC  FE++E++A  + A       +P  F    W R  ++   
Sbjct: 11  DAMKEAARTWFKNLRDRICAAFEQIEDDAARDDAPTLGARTAPGRFERTSWTRGANEDGS 70

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGG + +L  G+VFEK  V VSTV G  SP+F+  I G  ++P F+ATG+S++ H  +P
Sbjct: 71  PGGGGVISLMRGRVFEKVGVNVSTVSGTFSPEFRHTIPGAAEDPRFFATGISLVAHMCSP 130

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            VPA HFN RMIVT   WFGGG D+TP       +   D   FH+  +  C +H    Y 
Sbjct: 131 LVPAAHFNTRMIVTTEGWFGGGGDITPMFPKSAEAIA-DAARFHDGFRTACERHDPEYYP 189

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            ++EWCD+YFYLPHR E+RG+GGIF+D LHS    G  +ADF+F   VG  F++ YP +V
Sbjct: 190 RFREWCDKYFYLPHRDEARGLGGIFYDRLHS----GDANADFAFTRDVGLGFLETYPDIV 245

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R      ++   R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S+PP V WP
Sbjct: 246 RGRMMEPWTPDQREAQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSLPPEVRWP 303


>gi|218528718|ref|YP_002419534.1| coproporphyrinogen III oxidase [Methylobacterium chloromethanicum
           CM4]
 gi|218521021|gb|ACK81606.1| Coproporphyrinogen oxidase [Methylobacterium chloromethanicum CM4]
          Length = 307

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 150/310 (48%), Positives = 192/310 (61%), Gaps = 9/310 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN---SANRSPKIFTVK 58
           +     +  PDD+   K  +   F  L+  I    E LE EA       A +    F   
Sbjct: 3   DATASPLPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEATGPFHPDAPKEAGTFEKT 62

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R        GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+AT
Sbjct: 63  PWQRTDHSGAPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFAT 121

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S+IVHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E
Sbjct: 122 GISLIVHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTQFFHACLRE 181

Query: 179 MCSQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
            C +HA A +Y  YK WCD YF+L HR E RGIGGIF+D+  +    G   AD ++   V
Sbjct: 182 ACEKHAPAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWT----GDPQADLAYTRDV 237

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G  F+K YP +VRRN+   ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL
Sbjct: 238 GGAFLKAYPEIVRRNFAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASIL 297

Query: 298 ASMPPLVAWP 307
           +S+PP V WP
Sbjct: 298 SSLPPTVRWP 307


>gi|23011790|ref|ZP_00052048.1| COG0408: Coproporphyrinogen III oxidase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 307

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 148/305 (48%), Positives = 185/305 (60%), Gaps = 9/305 (2%)

Query: 7   EIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSP---KIFTVKHWLRD 63
            +  PDD+   K  +   F  L+  I    E LE+EA       +P     F    W R 
Sbjct: 8   PLPSPDDLAALKSEAGAWFATLRDRIVAALETLEDEAEGPFDPDAPAEAGRFIKTPWQRT 67

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                  GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+I
Sbjct: 68  DHSGAPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLI 126

Query: 124 VHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           VHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD   FH  L+E C  H
Sbjct: 127 VHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQEDPDTQHFHACLREACEAH 186

Query: 184 AVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           A A NY  YK WCD YF+L HR E RGIGGIF+D+  +           +F   VG  F+
Sbjct: 187 APAANYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGEPQAD----LAFTRDVGQAFL 242

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           K YP +VRRN    ++E DR EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+S+PP
Sbjct: 243 KAYPEIVRRNLARAWTEADRLEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSLPP 302

Query: 303 LVAWP 307
            V WP
Sbjct: 303 TVRWP 307


>gi|163850113|ref|YP_001638156.1| coproporphyrinogen III oxidase [Methylobacterium extorquens PA1]
 gi|163661718|gb|ABY29085.1| Coproporphyrinogen oxidase [Methylobacterium extorquens PA1]
          Length = 307

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 151/310 (48%), Positives = 192/310 (61%), Gaps = 9/310 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN---SANRSPKIFTVK 58
           +     +  PDD+   K  +   F  L+  I T  E LE EA       A +    F   
Sbjct: 3   DATASPLPSPDDLAALKSEAGAWFSTLRDRIVTALETLEAEATGPFHPDAPKEAGTFEKT 62

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R        GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+AT
Sbjct: 63  PWQRTDHSGTPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFAT 121

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S+IVHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E
Sbjct: 122 GISLIVHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQEDPDTQFFHACLRE 181

Query: 179 MCSQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
            C +HA A +Y  YK WCD YF+L HR E RGIGGIF+D+  +    G   AD ++   V
Sbjct: 182 ACEKHAPAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYHWT----GDPQADLAYTRDV 237

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G  F+K YP +VRRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL
Sbjct: 238 GGAFLKAYPEIVRRNLAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASIL 297

Query: 298 ASMPPLVAWP 307
           +S+PP V WP
Sbjct: 298 SSLPPTVRWP 307


>gi|300024038|ref|YP_003756649.1| coproporphyrinogen oxidase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525859|gb|ADJ24328.1| Coproporphyrinogen oxidase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 302

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 161/296 (54%), Positives = 199/296 (67%), Gaps = 3/296 (1%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHE--NSANRSPKIFTVKHWLRDKSQKEDLG 71
           +E+ K  ++  FE L+  I   FEKLE    E       +P  F    W R  +   D G
Sbjct: 8   LEQHKAQARAWFERLRDDIVAAFEKLEAGLPETAPHGGDAPGRFVATPWPRKDAAGNDGG 67

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG M+ L  G+VFEKA V  STVYG+ SP+F+ QI G  ++P FWA+G+S+IVHP NP+V
Sbjct: 68  GGVMSML-HGRVFEKAGVHTSTVYGEFSPEFRKQIPGAEESPAFWASGISLIVHPRNPNV 126

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N RMIVT  +WFGGG DLTP L+ RR   D D + FH  +   C+ H+VA+Y   
Sbjct: 127 PAVHMNTRMIVTSKWWFGGGADLTPVLDKRRTQSDADTMAFHAAMYGACAPHSVADYQKL 186

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           KEWCD YF+LPHR E+RGIGGIF+DHL  +   GG DA F+F   VG  F  +YP LVR 
Sbjct: 187 KEWCDEYFFLPHRNEARGIGGIFYDHLTPADAEGGWDAAFAFTQDVGKAFASVYPMLVRG 246

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           NY   +SE+ R+EQLIRRGRY E+NLLYD+GT FG KTGGNVESIL+SMPP+V WP
Sbjct: 247 NYSMPYSEEQREEQLIRRGRYVEYNLLYDRGTMFGLKTGGNVESILSSMPPVVKWP 302


>gi|113968381|ref|YP_732174.1| coproporphyrinogen III oxidase [Shewanella sp. MR-4]
 gi|114045546|ref|YP_736096.1| coproporphyrinogen III oxidase [Shewanella sp. MR-7]
 gi|122944260|sp|Q0HPA0|HEM6_SHESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123327055|sp|Q0I0R6|HEM6_SHESR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|113883065|gb|ABI37117.1| Coproporphyrinogen oxidase [Shewanella sp. MR-4]
 gi|113886988|gb|ABI41039.1| Coproporphyrinogen oxidase [Shewanella sp. MR-7]
          Length = 302

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 116/292 (39%), Positives = 155/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   E+L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLEQLDGQAS----------FAADSWTRTEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K +C       Y  YK+W
Sbjct: 114 FIAHKDGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTAKNLCLPFGDDIYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|304393675|ref|ZP_07375603.1| coproporphyrinogen III oxidase, aerobic [Ahrensia sp. R2A130]
 gi|303294682|gb|EFL89054.1| coproporphyrinogen III oxidase, aerobic [Ahrensia sp. R2A130]
          Length = 304

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 148/306 (48%), Positives = 200/306 (65%), Gaps = 4/306 (1%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           +  ++  G PDDIE +K  ++  FE L+  IC  FE +E++     +++    F    W 
Sbjct: 3   DRHSLPPGLPDDIEGKKATARAWFEELRDDICARFEAIEDDVKGPFSDKDAGRFEFTPWH 62

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           RD+ +      G       G+VFEK  V  STV+G+ SP+F+ Q+ G  ++P FWA+G+S
Sbjct: 63  RDEGKGGGGVMGM----MTGRVFEKVGVHCSTVHGEFSPEFRAQMPGGNEDPRFWASGVS 118

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +I HP NP+VPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  ++  C+
Sbjct: 119 LIAHPQNPNVPAVHMNTRMVVTSTQWFGGGGDLTPVLDARRTQTDPDTVDFHKAMEAACN 178

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H VA+Y  +K WCD YF+L HR E RG+GGIF D+LHS  +    DA+F+FI  +G  F
Sbjct: 179 AHDVADYDEFKAWCDEYFHLSHRDEPRGVGGIFCDYLHSGEKHDMWDANFAFIQDIGREF 238

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
             +YP+LVRRN    ++E+ R EQLIRRGRY EFNLL D+GT FG KTGGNV SIL+SMP
Sbjct: 239 ADIYPALVRRNMETPWTEEQRDEQLIRRGRYVEFNLLQDRGTIFGLKTGGNVNSILSSMP 298

Query: 302 PLVAWP 307
           P+V +P
Sbjct: 299 PVVKFP 304


>gi|299134643|ref|ZP_07027835.1| Coproporphyrinogen oxidase [Afipia sp. 1NLS2]
 gi|298590453|gb|EFI50656.1| Coproporphyrinogen oxidase [Afipia sp. 1NLS2]
          Length = 295

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 150/295 (50%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ RK  ++  FE L+  IC  FE+LE+E   +        F  K W R        GGG
Sbjct: 6   LDSRKTSARAWFEKLRDDICASFEQLEDEVPASLYGDQAGRFVRKPWERTDHTGAPGGGG 65

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M+ +  G++FEK  V  STV+G+ +P+F+ QI G + +P FWA+G+S+I HP+NP+VPA
Sbjct: 66  VMSMMR-GRLFEKVGVHCSTVFGEFAPEFRAQIPGASDDPRFWASGISLIAHPWNPNVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYTHYK 192
           VH N R +VT   WFGGG DLTP L+ RR   DPD + FH   ++ C  H  VA Y  +K
Sbjct: 125 VHMNTRFVVTTKRWFGGGADLTPVLDRRRTQEDPDTVSFHEAFRKACHAHTAVAPYDKFK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR+E RGIGGIF+D L S    G  +ADF+F   VG  F  +YP LVRRN
Sbjct: 185 KWCDDYFFLAHRKEPRGIGGIFYDWLES----GDWNADFAFTQDVGRAFAAIYPELVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   + + DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FETPWQDADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|188579915|ref|YP_001923360.1| coproporphyrinogen III oxidase [Methylobacterium populi BJ001]
 gi|179343413|gb|ACB78825.1| Coproporphyrinogen oxidase [Methylobacterium populi BJ001]
          Length = 307

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 147/310 (47%), Positives = 190/310 (61%), Gaps = 9/310 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPK---IFTVK 58
           +     +  PDD+   K  +   F  L+  I    E LE+EA       +PK    F   
Sbjct: 3   DATASPLPSPDDLAALKSEAGAWFSTLRDRIVAALETLEDEATGPFHPDAPKQAGRFEKT 62

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R        GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+AT
Sbjct: 63  PWQRTDHSGTPGGGGVMAMLK-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFAT 121

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S+IVHP+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD  FFH  L+E
Sbjct: 122 GISLIVHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRTQDDPDTQFFHACLRE 181

Query: 179 MCSQHAVA-NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
            C  HA A +Y  +K WCD YF+L HR E RGIGGIF+D+  +           ++   V
Sbjct: 182 ACEAHAPAVDYERFKAWCDEYFHLKHRNEPRGIGGIFYDYHWTGEPQAD----LAYTRDV 237

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G  F+K YP +VRRN+   ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL
Sbjct: 238 GGAFLKAYPEIVRRNFAQAWTEADREEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASIL 297

Query: 298 ASMPPLVAWP 307
           +S+PP V WP
Sbjct: 298 SSLPPTVRWP 307


>gi|90019674|ref|YP_525501.1| coproporphyrinogen III oxidase [Saccharophagus degradans 2-40]
 gi|123278083|sp|Q21PU0|HEM6_SACD2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|89949274|gb|ABD79289.1| Coproporphyrinogen oxidase [Saccharophagus degradans 2-40]
          Length = 303

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 116/295 (39%), Positives = 150/295 (50%), Gaps = 30/295 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K+  +    NLQ  IC     ++ +          + F    W R      + GGGR   
Sbjct: 6   KQAVKAYLLNLQDKICQVLAAVDGK----------ETFVEDSWQR-----PEGGGGRSRV 50

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G V EK  V  S V+G   P              F A G+S+++HP NPHVP  H N
Sbjct: 51  LTNGAVIEKGGVNFSHVHGSSMPASATAHRPELAGRSFEAMGVSLVIHPNNPHVPTSHAN 110

Query: 138 IRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R  +         +WFGGG DLTP   +     D D   +HNT K  C+      Y  Y
Sbjct: 111 VRFFIAEKEGAEPVWWFGGGYDLTPYYGN-----DEDCRHWHNTAKAACAPFGEDKYPRY 165

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YFYL HR E RG+GG+FFD L+      G D  F+F+ AVGD + + Y  +V R
Sbjct: 166 KKWCDEYFYLKHRDEPRGVGGLFFDDLNE----LGFDQSFAFMQAVGDSYTQAYVPIVER 221

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                +++  R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 222 RKDEPYNQAQRDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|117918500|ref|YP_867692.1| coproporphyrinogen III oxidase [Shewanella sp. ANA-3]
 gi|166217819|sp|A0KR67|HEM6_SHESA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|117610832|gb|ABK46286.1| coproporphyrinogen III oxidase [Shewanella sp. ANA-3]
          Length = 302

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 116/292 (39%), Positives = 154/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   E+L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLEQLDGQAS----------FAADSWTRTEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K +C       Y  YK+W
Sbjct: 114 FIAHKDGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTAKNLCLPFGDDVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|83859588|ref|ZP_00953108.1| coproporphyrinogen III oxidase [Oceanicaulis alexandrii HTCC2633]
 gi|83851947|gb|EAP89801.1| coproporphyrinogen III oxidase [Oceanicaulis alexandrii HTCC2633]
          Length = 299

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 182/305 (59%), Gaps = 6/305 (1%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +        D + +R++ ++  FE+L+  IC+ FE LE  A           F +  W+R
Sbjct: 1   MSANAKPSEDVLADRRQRAKAWFESLRDRICSAFEALEAAADPTLYPGEAGRFELTPWVR 60

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
               +E  GG        G++FEK  V VSTV+G+ SP+F  ++ G   +P F+ATG+S+
Sbjct: 61  GDGAQELGGGVMGM--MHGRLFEKVGVHVSTVFGEFSPEFAARVRGAETDPRFFATGISL 118

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           I H  NPHVPAVH N R I T   WFGGG+DL P+ + +R    PD   FH   K  C  
Sbjct: 119 IAHMRNPHVPAVHMNTRFITTTLSWFGGGMDLNPTQDYQRDKSFPDSKAFHAAAKSACDA 178

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  + Y  + +WCD YF+L HR E RG GGIF+DHL S    G  +ADF+F   VG+ F+
Sbjct: 179 HDPSYYPRFTDWCDEYFWLKHRNEPRGTGGIFYDHLDS----GDHEADFAFTRDVGEAFL 234

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             YP +V+      +SE DR+EQL+RRGRYAEFNLLYD+GT FG +TGGN+ SIL+SMPP
Sbjct: 235 SAYPEIVKTRMGQSWSEDDREEQLVRRGRYAEFNLLYDRGTKFGLETGGNINSILSSMPP 294

Query: 303 LVAWP 307
              WP
Sbjct: 295 HARWP 299


>gi|170744119|ref|YP_001772774.1| coproporphyrinogen III oxidase [Methylobacterium sp. 4-46]
 gi|168198393|gb|ACA20340.1| Coproporphyrinogen oxidase [Methylobacterium sp. 4-46]
          Length = 299

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 147/302 (48%), Positives = 194/302 (64%), Gaps = 7/302 (2%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN--SANRSPKIFTVKHWLRDKS 65
           I    D++  +  +   F  L+  IC  FE LE+EA         +P  F    W R   
Sbjct: 3   IDASLDLDALRARATDWFATLRDRICAAFEALESEAAGPFHPEAEAPGRFVRTPWERTDH 62

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG MA L  G+VFEKA V VS V+G+ +P+F+ QI G  ++P F+ATG+S+I H
Sbjct: 63  SGAPGGGGVMAMLR-GRVFEKAGVHVSAVHGEFAPEFRIQIPGAAEDPRFFATGISLIAH 121

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P+NP+VP VH N R++VT   WFGGG DLTP L+ RR   DPD + FH  L+  C++H  
Sbjct: 122 PWNPNVPTVHMNTRLVVTTKAWFGGGADLTPVLDRRRTQEDPDSVAFHEALRRACARHPG 181

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  Y+ WCD YF+L HR E RGIGGIF+D+  S    G  +AD +    VG+ F+++Y
Sbjct: 182 ADYARYRTWCDEYFHLKHRNEPRGIGGIFYDYHWS----GDPEADLALTRDVGEAFLEVY 237

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P++VRRN    ++E DR+EQ +RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V 
Sbjct: 238 PAIVRRNLSQPWTEADRREQQVRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPTVR 297

Query: 306 WP 307
           WP
Sbjct: 298 WP 299


>gi|127514657|ref|YP_001095854.1| coproporphyrinogen III oxidase [Shewanella loihica PV-4]
 gi|126639952|gb|ABO25595.1| Coproporphyrinogen oxidase [Shewanella loihica PV-4]
          Length = 303

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 117/299 (39%), Positives = 159/299 (53%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +    +LQ  IC   E+L+ EA           F    W R++      GGG
Sbjct: 1   MKPDATQVKAFLLDLQQRICEGLEQLDGEA----------KFVADSWEREEG-----GGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               L  GKVFE+A V  S V G   P              F A G+S+++HP NP+VP 
Sbjct: 46  TSRVLTKGKVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP        ++ DV+ +H + K +C       
Sbjct: 106 THANVRFFIAEKEGADPVWWFGGGFDLTPYYP-----FEEDVVAWHQSAKALCEPFGEDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+LPHR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+K Y  
Sbjct: 161 YPKYKKWCDEYFFLPHRNETRGVGGLFFDDLNEP----GFENSFAFMQAVGEGFLKAYAP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V +     + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 217 IVEKRKETAYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|158425127|ref|YP_001526419.1| coproporphyrinogen III oxidase [Azorhizobium caulinodans ORS 571]
 gi|158332016|dbj|BAF89501.1| coproporphyrinogen III oxidase [Azorhizobium caulinodans ORS 571]
          Length = 299

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 146/297 (49%), Positives = 185/297 (62%), Gaps = 5/297 (1%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
             ++E RK  ++  FE LQ  I   FE+LE+EA           F    W R        
Sbjct: 8   TAELERRKAEARAWFEALQGRIIAAFEQLEDEASPALYGEKAGRFVRTPWDRTDHTGAPG 67

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GG     +  G++FEK  V  STV+G+ +P+F+ QI G  ++P FWA+G+S+I H  NPH
Sbjct: 68  GG-GTMAMMHGRLFEKVGVHTSTVFGEFAPEFRGQIPGAAEDPRFWASGISLIAHMANPH 126

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R +VT   WFGGG DLTP L++RR   DPD   FH   ++ C  HAVA+Y  
Sbjct: 127 VPAVHMNTRFVVTTKSWFGGGADLTPVLDTRRTQDDPDTRAFHAAFEKACGAHAVADYGR 186

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK WCD YF+L HR E RGIGGIF+D L+S    G   AD +F   VG  F+ +YP LVR
Sbjct: 187 YKAWCDEYFFLKHRNEMRGIGGIFYDWLNS----GDFGADLAFTREVGTTFLDIYPRLVR 242

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            N    + E +R+EQL+RRGRY EFNLLYD+GT FG KTGGN+ SIL+SMPP+V WP
Sbjct: 243 ANMARPWDETEREEQLVRRGRYVEFNLLYDRGTIFGLKTGGNIASILSSMPPVVKWP 299


>gi|16124761|ref|NP_419325.1| coproporphyrinogen III oxidase [Caulobacter crescentus CB15]
 gi|221233477|ref|YP_002515913.1| coproporphyrinogen III oxidase [Caulobacter crescentus NA1000]
 gi|21542087|sp|Q9AAT8|HEM6_CAUCR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800267|sp|B8GZX1|HEM6_CAUCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|13421687|gb|AAK22493.1| coproporphyrinogen III oxidase, aerobic [Caulobacter crescentus
           CB15]
 gi|220962649|gb|ACL94005.1| coproporphyrinogen III oxidase [Caulobacter crescentus NA1000]
          Length = 290

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 138/295 (46%), Positives = 179/295 (60%), Gaps = 10/295 (3%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D++ +K  ++  FE+L+  IC  FE+LE+EA  +    +P  F  K W R       +G 
Sbjct: 6   DLDTKKAAARAWFESLRDQICAAFEQLEDEAPADLYPGAPGRFAKKAWDRPAGGGGVMGM 65

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
                     +FEK  V VSTV+G  +P+    + G  ++P F+ATG+S+I H  NP VP
Sbjct: 66  MHGR------LFEKVGVHVSTVFGTFTPEMAKTMPGAAEDPRFFATGISLIAHMTNPRVP 119

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R I T   WFGGG DLTP L  +R    PD I FH   K  C ++    +  YK
Sbjct: 120 AVHMNTRFIATTKSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYKRACDKYDPEWHPKYK 179

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+LPHR E RGIGGIF+DH  S    G    DF+F   VG  F+++YP+LVRR 
Sbjct: 180 AWCDEYFFLPHRNEPRGIGGIFYDHHDS----GDWARDFAFTQDVGRAFLEIYPTLVRRR 235

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++  +R++QLI+RGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 236 MGEAWTADEREQQLIQRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPAVKWP 290


>gi|330993449|ref|ZP_08317384.1| Coproporphyrinogen-III oxidase [Gluconacetobacter sp. SXCC-1]
 gi|329759479|gb|EGG75988.1| Coproporphyrinogen-III oxidase [Gluconacetobacter sp. SXCC-1]
          Length = 302

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 134/295 (45%), Positives = 182/295 (61%), Gaps = 11/295 (3%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSAN-----RSPKIFTVKHWLRDKSQKEDLGG 72
           K  ++  FE+L+  IC+ FE++E+EA    +       +P  F    W R        GG
Sbjct: 14  KDTARAWFESLRDRICSAFEQIEDEAAAAGSPTLPGKEAPGRFIRTPWERTNDDGTPGGG 73

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G ++ +  G+VFEK  V VSTV G+ SP F+D I G  ++P F+ATG+S++ H  +P VP
Sbjct: 74  GVISLMR-GRVFEKVGVNVSTVSGEFSPGFRDSIPGAAQDPRFFATGISLVAHMCSPLVP 132

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMI+T   WFGGG D+TP       +   D   FH+  +  C +H    Y  ++
Sbjct: 133 AAHFNTRMIITTQGWFGGGGDITPMFPESAEAI-SDAARFHDGFRLACEKHDPDYYPRFR 191

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCDRYFYLPHR E RG+GGIF+D L++    G +DADF+F   VG  F++ YP +VR  
Sbjct: 192 EWCDRYFYLPHRNEPRGLGGIFYDRLNT----GDLDADFAFTRDVGLGFLETYPDIVRGR 247

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++E  R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL S+PP V WP
Sbjct: 248 MMEPWTEAQRKAQLVRRGRYVEFNLLHDRGTIFGLKTGGNTEAILMSLPPEVHWP 302


>gi|262166820|ref|ZP_06034557.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus VM223]
 gi|262026536|gb|EEY45204.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus VM223]
          Length = 305

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 114/298 (38%), Positives = 158/298 (53%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
              K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR
Sbjct: 4   NIDKQAVKNFLLQLQDQICQQLEAADGQAQ----------FIEDAWQREPGEK-LGGGGR 52

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  
Sbjct: 53  TRVMRDGAVFEQGGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTS 112

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R            +WFGGG DLTP        +  D  ++H T K +C+  +   Y
Sbjct: 113 HANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDCQYWHQTAKNLCAPFSAEIY 167

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +
Sbjct: 168 NEHKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPI 223

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 224 VEKRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|227080292|ref|YP_002808843.1| coproporphyrinogen III oxidase [Vibrio cholerae M66-2]
 gi|298501237|ref|ZP_07011036.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MAK 757]
 gi|254800279|sp|C3LPC8|HEM6_VIBCM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|227008180|gb|ACP04392.1| coproporphyrinogen III oxidase [Vibrio cholerae M66-2]
 gi|297540109|gb|EFH76171.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MAK 757]
          Length = 305

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 114/298 (38%), Positives = 157/298 (52%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
              K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR
Sbjct: 4   NIDKQAVKNFLLQLQDQICQQLEAADGQAQ----------FIEDAWQREPGEK-LGGGGR 52

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  
Sbjct: 53  TRVMRDGAVFEQGGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTS 112

Query: 135 HFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R  +         +WFGGG DLTP        +  D   +H T K +C+      Y
Sbjct: 113 HANVRYFIAEKEGEDPIWWFGGGFDLTPFYP-----FVEDCQLWHQTAKNLCAPFGAEIY 167

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +
Sbjct: 168 NEHKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPI 223

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 224 VEKRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|157959868|ref|YP_001499902.1| coproporphyrinogen III oxidase [Shewanella pealeana ATCC 700345]
 gi|189028107|sp|A8GYI0|HEM6_SHEPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157844868|gb|ABV85367.1| Coproporphyrinogen oxidase [Shewanella pealeana ATCC 700345]
          Length = 304

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 117/294 (39%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
            + +    +LQ+ IC   E L+  A           F    W R++      GGG+   L
Sbjct: 7   TLVKAFLLDLQNRICNGLEALDGAAQ----------FAEDSWKREEG-----GGGQSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP NPH+P  H N+
Sbjct: 52  TGGAVFEQAGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPKNPHIPTTHANV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        Y  DV+ +H + K +C       Y  YK
Sbjct: 112 RFFIAHKEGADPVWWFGGGFDLTPYYP-----YLEDVVEWHQSAKSLCEPFGEEVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+LPHR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+  Y  +V R 
Sbjct: 167 QWCDEYFWLPHRNETRGVGGLFFDDLNK----QGFEQSFAFMQAVGNGFLTAYAPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 RDTEYGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|262273072|ref|ZP_06050889.1| coproporphyrinogen III oxidase aerobic [Grimontia hollisae CIP
           101886]
 gi|262222828|gb|EEY74136.1| coproporphyrinogen III oxidase aerobic [Grimontia hollisae CIP
           101886]
          Length = 307

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 120/312 (38%), Positives = 158/312 (50%), Gaps = 36/312 (11%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M    +           K   +R   +LQ  IC   EK +  A           F    W
Sbjct: 1   MENPNLPEQV------DKEAVKRFLLSLQDTICAALEKEDGSA----------TFQEDAW 44

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R        GGG+   +  G VFE+A V  S V+GD  P              F A G+
Sbjct: 45  ERT-----AGGGGKSRVMRDGAVFEQAGVNFSHVFGDKMPGSATAHRPELAGRSFEAMGV 99

Query: 121 SVIVHPYNPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S++VHP NPHVP  H N+R            +WFGGG DLTP         + D I +H 
Sbjct: 100 SLVVHPKNPHVPTSHANVRFFIAEKEGEAPVWWFGGGFDLTPFYP-----VEEDCIHWHQ 154

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           T K +C+      Y  +K WCDRYF+LPHR E+RG+GG+FFD L+      G DA F +I
Sbjct: 155 TAKSLCAPFGGHVYAEHKAWCDRYFFLPHRNETRGVGGLFFDDLNQW----GFDASFGYI 210

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
            AVG+ ++  Y  +V++     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  E
Sbjct: 211 KAVGEGYLDAYLPIVQKRKTTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTE 270

Query: 295 SILASMPPLVAW 306
           SIL SMPPLV W
Sbjct: 271 SILMSMPPLVRW 282


>gi|126172294|ref|YP_001048443.1| coproporphyrinogen III oxidase [Shewanella baltica OS155]
 gi|152998588|ref|YP_001364269.1| coproporphyrinogen III oxidase [Shewanella baltica OS185]
 gi|166217816|sp|A3CYL1|HEM6_SHEB5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217817|sp|A6WHB7|HEM6_SHEB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|125995499|gb|ABN59574.1| Coproporphyrinogen oxidase [Shewanella baltica OS155]
 gi|151363206|gb|ABS06206.1| Coproporphyrinogen oxidase [Shewanella baltica OS185]
          Length = 302

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 117/292 (40%), Positives = 157/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLQALDGQA----------RFAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|258626122|ref|ZP_05720973.1| coproporphyrinogen III oxidase, aerobic [Vibrio mimicus VM603]
 gi|262172820|ref|ZP_06040498.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus MB-451]
 gi|258581648|gb|EEW06546.1| coproporphyrinogen III oxidase, aerobic [Vibrio mimicus VM603]
 gi|261893896|gb|EEY39882.1| coproporphyrinogen III oxidase aerobic [Vibrio mimicus MB-451]
          Length = 305

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 116/298 (38%), Positives = 157/298 (52%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
              K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR
Sbjct: 4   NIDKQAVKSFLLQLQDQICQQLEAADGQAQ----------FIEDAWQREPGEK-LGGGGR 52

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  
Sbjct: 53  TRVMRDGAVFEQGGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTS 112

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R            +WFGGG DLTP        +  D  F+H T K +C+      Y
Sbjct: 113 HANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDCQFWHQTAKNLCAPFGAEIY 167

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F++I AVG+ + + Y  +
Sbjct: 168 NEHKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGEGYTQAYVPI 223

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 224 VEKRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|304412741|ref|ZP_07394344.1| Coproporphyrinogen oxidase [Shewanella baltica OS183]
 gi|307305794|ref|ZP_07585540.1| Coproporphyrinogen oxidase [Shewanella baltica BA175]
 gi|304348951|gb|EFM13366.1| Coproporphyrinogen oxidase [Shewanella baltica OS183]
 gi|306911287|gb|EFN41713.1| Coproporphyrinogen oxidase [Shewanella baltica BA175]
          Length = 302

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 117/292 (40%), Positives = 157/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|315265388|gb|ADT92241.1| Coproporphyrinogen oxidase [Shewanella baltica OS678]
          Length = 302

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 117/292 (40%), Positives = 157/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|307944161|ref|ZP_07659502.1| coproporphyrinogen III oxidase, aerobic [Roseibium sp. TrichSKD4]
 gi|307772507|gb|EFO31727.1| coproporphyrinogen III oxidase, aerobic [Roseibium sp. TrichSKD4]
          Length = 304

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 154/296 (52%), Positives = 201/296 (67%), Gaps = 10/296 (3%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEA---HENSANRSPKIFTVKHWLRDKS 65
             PD IE++K+ +   FE+L++ IC  FEKLE+E        ++R    F    W R  S
Sbjct: 12  PIPDQIEDKKKTAAAWFEDLRNQICASFEKLEDEITDRSGPMSDREAGRFVRTPWERTDS 71

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG M+ L  G+VFEK  V +STV+G+ SP+F+ QI G  ++P FWA+G+S+I H
Sbjct: 72  TGAKGGGGVMS-LMHGRVFEKVGVHISTVHGEFSPEFRGQIPGANEDPRFWASGISLIAH 130

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            +NPHVPAVH N RM+VT   WFGGG DLTP L++RR   DPD + FH  +++ CS H V
Sbjct: 131 MHNPHVPAVHMNTRMVVTTRQWFGGGADLTPVLDARRTQTDPDTVAFHKAMEDACSPHDV 190

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  YK+WCD YFYL HR E+RGIGGIF+D+L+S    G  DADF+F   VG  F+K+Y
Sbjct: 191 ADYPAYKKWCDEYFYLKHRDEARGIGGIFYDYLNS----GSWDADFAFTQDVGRAFLKIY 246

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           P LVR N+   +S+ +R+EQLIRRGRY E+NLLYD+GT FG KTGGNV SI   +P
Sbjct: 247 PELVRANFEKPWSDAEREEQLIRRGRYVEYNLLYDRGTIFGLKTGGNVASI--CLP 300


>gi|159043227|ref|YP_001532021.1| coproporphyrinogen III oxidase [Dinoroseobacter shibae DFL 12]
 gi|157910987|gb|ABV92420.1| coproporphyrinogen 3 oxidase [Dinoroseobacter shibae DFL 12]
          Length = 297

 Score =  341 bits (875), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 118/306 (38%), Positives = 169/306 (55%), Gaps = 17/306 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKE 68
             +D  ERK  +   F  L+  I   FE LE+ +     A+ +P  F V    R      
Sbjct: 1   MTEDFTERKARASAWFRTLRDEIVAAFEALEDTQTEGPFADLAPGRFEVTETTRASDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STVYG        +   +  + G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISTVYGALAPRAQAAMAARKGVPGMDTDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P +E        D   FH  L++ C 
Sbjct: 121 VAHMRNPHAPAVHMNTRMFWTPQTWWFGGGSDLNPCIE-----KPEDTADFHKVLQDYCD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
           +H  A Y  YK W D YF++PHR  +RG+GGIF+D  ++    G  +ADF+F   VG  F
Sbjct: 176 KHDPALYPKYKAWADEYFFVPHRGRARGVGGIFYDDRNT----GDWEADFAFTQDVGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  +  +  RN +  +++ D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAFLPVTERNRNLPWTDADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDATAVLMSLP 291

Query: 302 PLVAWP 307
           P   WP
Sbjct: 292 PEAKWP 297


>gi|294053800|ref|YP_003547458.1| Coproporphyrinogen oxidase [Coraliomargarita akajimensis DSM 45221]
 gi|293613133|gb|ADE53288.1| Coproporphyrinogen oxidase [Coraliomargarita akajimensis DSM 45221]
          Length = 305

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 116/296 (39%), Positives = 151/296 (51%), Gaps = 30/296 (10%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           +  + +    +LQ  IC   E  +  A           F    W R      + GGGR  
Sbjct: 5   QSELVRNYLLSLQDSICKALEAEDGSA----------TFHEDSWER-----PEGGGGRSR 49

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            L  G +FEKA +  S V+G   P              F A G+S+++HP NPHVP  H 
Sbjct: 50  VLADGAIFEKAGINFSDVHGKGLPPSATAARPQLAGAAFRAMGVSLVIHPQNPHVPTTHM 109

Query: 137 NIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP    +      D I +H T K  C       Y  
Sbjct: 110 NVRYFEASPTEGEPVWWFGGGFDLTPYYGQKA-----DAIHWHQTAKAACDPFGTELYPR 164

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K+ CD YFYLPHR E+RGIGGIFFD  ++    GG D  F+F+ +VGD F+  Y  +V 
Sbjct: 165 FKQTCDDYFYLPHRNEARGIGGIFFDDFNA----GGFDQAFAFMQSVGDHFVPAYQPIVA 220

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     F++ +RQ QL RRGRY EFNL+YD+GT FG ++ G  ESIL S+PPLV W
Sbjct: 221 RRKEQPFTDAERQFQLYRRGRYVEFNLVYDRGTIFGLQSKGRTESILMSLPPLVRW 276


>gi|217971253|ref|YP_002356004.1| coproporphyrinogen III oxidase [Shewanella baltica OS223]
 gi|254800277|sp|B8E3K7|HEM6_SHEB2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|217496388|gb|ACK44581.1| Coproporphyrinogen oxidase [Shewanella baltica OS223]
          Length = 302

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 118/292 (40%), Positives = 156/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQNRICAGLQALDGQA----------RFAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+      G D  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQE----GFDQSFSFMQAVGNGFLTAYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|209966675|ref|YP_002299590.1| coproporphyrinogen III oxidase [Rhodospirillum centenum SW]
 gi|209960141|gb|ACJ00778.1| coproporphyrinogen III oxidase, aerobic [Rhodospirillum centenum
           SW]
          Length = 309

 Score =  341 bits (874), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 134/300 (44%), Positives = 180/300 (60%), Gaps = 11/300 (3%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQ---- 66
           D + +RK  ++  F+ L+  IC  FE LE++ A    A   P  F    W R        
Sbjct: 15  DVLADRKARAEAWFQGLRDRICAAFEALEDDLADGPHAGLPPGRFERTAWDRPGHGDGPH 74

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
               GGG M+ +  G+VFEK  V VSTV+G  S +F+  I G  ++  FWA+G+S++ H 
Sbjct: 75  AAPGGGGVMSVMR-GRVFEKVGVNVSTVFGTFSEEFRGSIPGAAESGGFWASGISLVAHM 133

Query: 127 YNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            +P VPAVH N R +VT   WFGGG DLTP     R +   D   FH  LK  C  H   
Sbjct: 134 RSPLVPAVHMNTRHLVTSHAWFGGGADLTPMFLDTRETA-EDKADFHAALKAACDAHGPD 192

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  + +WCDRYF+LPHR E RG+GGIF+D   +    G  +ADF+F  AVG+ F+++YP
Sbjct: 193 FYARFSDWCDRYFFLPHRNEPRGVGGIFYDGHDT----GDWEADFAFTRAVGEAFLEVYP 248

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            LVRR  H  ++E  R+ QL RRGRYAEFNL++D+GT FG KTGGN+++I+ S+PP V W
Sbjct: 249 RLVRRRMHLPWTEAQREHQLHRRGRYAEFNLIHDRGTLFGLKTGGNIDAIMMSLPPEVKW 308


>gi|261213221|ref|ZP_05927503.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC341]
 gi|260837495|gb|EEX64198.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC341]
          Length = 305

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 115/298 (38%), Positives = 158/298 (53%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
              K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR
Sbjct: 4   NIDKQAVKSFLLQLQDQICQQLEAADGQAQ----------FIEDAWQREPGEK-LGGGGR 52

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  
Sbjct: 53  TRVMRGGAVFEQGGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYVPTS 112

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R            +WFGGG DLTP        +  D  F+H+T K +C+      Y
Sbjct: 113 HANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDCQFWHHTAKNLCAPFGADIY 167

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +
Sbjct: 168 NQHKVWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPI 223

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 224 VEKRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|212632973|ref|YP_002309498.1| coproporphyrinogen III oxidase [Shewanella piezotolerans WP3]
 gi|226740901|sp|B8CHB9|HEM6_SHEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|212554457|gb|ACJ26911.1| Coproporphyrinogen III oxidase, aerobic [Shewanella piezotolerans
           WP3]
          Length = 304

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 119/292 (40%), Positives = 153/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +     LQ+ IC   E L+  A           F    W R++      GGG+   L  
Sbjct: 9   VKAFLLELQNNICNGLEALDGVAS----------FKEDSWKREEG-----GGGQSRVLTG 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           GKVFE+A V  S V G   P              F A G+S+++HP NPH+P  H N+R 
Sbjct: 54  GKVFEQAGVNFSHVMGASMPASATAHRPELAGRNFEAMGVSLVIHPNNPHIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        Y  DV+ +H + K +C       Y  YK+W
Sbjct: 114 FIAHKEGTDPIWWFGGGFDLTPYYP-----YLEDVVSWHQSAKALCEPFGDETYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+      G D  F F+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFWLPHRNETRGVGGLFFDDLNK----QGFDKSFDFMQAVGNGFLTAYAPIVERRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEYGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|120552990|ref|YP_957341.1| coproporphyrinogen III oxidase [Marinobacter aquaeolei VT8]
 gi|120322839|gb|ABM17154.1| Coproporphyrinogen oxidase [Marinobacter aquaeolei VT8]
          Length = 308

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 115/294 (39%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC   E ++ +A           F    W R      + GGG    L
Sbjct: 8   QAVKDYLIGLQERICQRLEAVDGQAS----------FIRDSWQR-----PEGGGGISRVL 52

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S V G+  P              + A G+S+++HP NP+VP  H N+
Sbjct: 53  ADGGVIEKGGVNFSHVMGETMPASATAHRPHLAGAPWQAMGVSLVIHPNNPYVPTSHANV 112

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         YWFGGG DLTP      + ++ D + +H T K  C     + Y  YK
Sbjct: 113 RFFIATPEDSAPVYWFGGGYDLTPY-----YGFEEDCVHWHRTAKAACQPFGDSVYADYK 167

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HRQE RG+GG+FFD  ++    G  D DF+F+ AVGD +I+ Y  +VRR 
Sbjct: 168 RWCDDYFYLKHRQEPRGVGGLFFDDYNT----GDFDRDFAFMQAVGDSYIEAYEPIVRRR 223

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 224 MDQPWGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 277


>gi|120596863|ref|YP_961437.1| coproporphyrinogen III oxidase [Shewanella sp. W3-18-1]
 gi|146291141|ref|YP_001181565.1| coproporphyrinogen III oxidase [Shewanella putrefaciens CN-32]
 gi|166217818|sp|A4Y1D3|HEM6_SHEPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217820|sp|A1RDY8|HEM6_SHESW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|120556956|gb|ABM22883.1| Coproporphyrinogen oxidase [Shewanella sp. W3-18-1]
 gi|145562831|gb|ABP73766.1| Coproporphyrinogen oxidase [Shewanella putrefaciens CN-32]
          Length = 302

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 117/292 (40%), Positives = 156/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLIDLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+      G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQD----GFEQSFSFMQAVGNGFLTAYAPIVERRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|56750864|ref|YP_171565.1| coproporphyrinogen III oxidase [Synechococcus elongatus PCC 6301]
 gi|62510573|sp|Q5N3S5|HEM6_SYNP6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|56685823|dbj|BAD79045.1| coproporphyrinogen III oxidase [Synechococcus elongatus PCC 6301]
          Length = 342

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 112/329 (34%), Positives = 154/329 (46%), Gaps = 48/329 (14%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           NL T+ +   D     +   ++  + LQ  IC   E L+              F    W 
Sbjct: 7   NLTTVPVPPSDS----RERVKQFMQTLQDEICAGLEALDG----------GGQFREDSWE 52

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R      + GGGR   +  G VFE+  V  S V+G+  P              ++ATG S
Sbjct: 53  R-----PEGGGGRSRVIREGNVFEQGGVNFSEVWGEKLPPSILAQYPEAAGHGYFATGTS 107

Query: 122 VIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP NP++P VH N R       +WFGGG DLTP        +  D   FH++ K  C
Sbjct: 108 MVLHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAKHFHSSFKAAC 162

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG-------------- 226
            +H    Y  +K WCD YF+L HR E+RGIGGIFFD+     ++                
Sbjct: 163 DRHYPQFYDVFKLWCDEYFFLKHRGETRGIGGIFFDYQDGRGDLYNKGPAPSGPAGQKAA 222

Query: 227 ---------IDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNL 277
                     +  F+F    G  F+  Y  +V R     + +++RQ QL RRGRY EFNL
Sbjct: 223 EVGIVSDLNWEKLFAFAQDCGRTFLPAYSPIVERRKDTPWGDRERQFQLYRRGRYVEFNL 282

Query: 278 LYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 283 VYDRGTIFGLQTNGRTESILMSLPPLVRW 311


>gi|315125144|ref|YP_004067147.1| coproporphyrinogen III oxidase [Pseudoalteromonas sp. SM9913]
 gi|315013657|gb|ADT66995.1| coproporphyrinogen III oxidase [Pseudoalteromonas sp. SM9913]
          Length = 305

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +  F  LQ  IC   E  + +A           F    W R++      GGGR   +
Sbjct: 7   KQVKAYFMALQDTICQGLEAADGKAQ----------FVEDSWQREEG-----GGGRTRVI 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NPH+P  H N+
Sbjct: 52  TNGNVIEQGGVNYSHVFGASMPGSATAHRPELAGRSFHACGVSLVIHPKNPHIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV+ +H    ++C       Y  YK
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----VLEDVVHWHQVAHDVCQPFGDDVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ +VG+ F+  Y  ++ R 
Sbjct: 167 KWCDEYFYLKHRDETRGVGGLFFDDLNE----LGFEQSFAFMQSVGNGFLDAYVPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 223 KNDKYTEQQRDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|24371638|ref|NP_715680.1| coproporphyrinogen III oxidase [Shewanella oneidensis MR-1]
 gi|41017197|sp|Q8EKQ2|HEM6_SHEON RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24345397|gb|AAN53125.1|AE015455_6 coproporphyrinogen III oxidase, aerobic [Shewanella oneidensis
           MR-1]
          Length = 302

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 115/292 (39%), Positives = 153/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC   E+L+ +A           F    W R +      GGG    L  
Sbjct: 9   VKAFLLDLQHRICAGLEQLDGQAS----------FAADSWTRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H + K +C       Y  YK+W
Sbjct: 114 FIAHKDGAEPVWWFGGGFDLTPYYP-----FEEDVREWHQSAKNLCQPFGDDVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G D  F F+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFDKSFDFMQAVGNGFLTAYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TDYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|329890252|ref|ZP_08268595.1| coproporphyrinogen 3 oxidase, aerobic [Brevundimonas diminuta ATCC
           11568]
 gi|328845553|gb|EGF95117.1| coproporphyrinogen 3 oxidase, aerobic [Brevundimonas diminuta ATCC
           11568]
          Length = 326

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 135/297 (45%), Positives = 177/297 (59%), Gaps = 10/297 (3%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P  + ER+  ++  FE L+  I   FE LE+ A        P  F    W R +     +
Sbjct: 40  PALMIERRERARVWFETLRDKIHAGFEALEDAAPAELFAGEPGRFVRTPWDRKEGGGGVM 99

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           G           +FEK  V  STV+G    D+   + G  ++P F+ATG+S+I HP +P 
Sbjct: 100 GMMSGR------LFEKVGVHCSTVHGTFPADYAKNVPGAEEDPRFYATGISLICHPVSPR 153

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R+I T   WFGGG DLTP L++ R    PD + FH  +K  C     + +  
Sbjct: 154 VPAVHMNTRLISTTKTWFGGGGDLTPVLDADRRDDHPDTVDFHAAMKGACDAFDPSWHAK 213

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK+WCD YF+LPHR E RG GG+F+DH  S    G  + DF+F  AVG+ F+K+Y  +V 
Sbjct: 214 YKQWCDEYFFLPHRNEPRGTGGVFYDHHDS----GDWEKDFAFTQAVGEAFLKVYCDIVA 269

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R  H  ++E +R+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP+V WP
Sbjct: 270 RRMHEPWTEAEREEQLIRRGRYVEFNLLYDRGTMFGLKTGGNVESILSSMPPVVKWP 326


>gi|262402040|ref|ZP_06078604.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC586]
 gi|262351686|gb|EEZ00818.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. RC586]
          Length = 305

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 114/298 (38%), Positives = 158/298 (53%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
              K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR
Sbjct: 4   NIDKQAVKSFLLQLQDQICQQLEAADGQAQ----------FIEDAWQRESGEK-LGGGGR 52

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V+G+  P              F A G+S+++HP NP++P  
Sbjct: 53  TRVMRDGAVFEQGGVNFSHVFGEQMPGSATAHRPELAGRRFEAMGVSLVMHPKNPYIPTS 112

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R            +WFGGG DLTP        +  D  F+H+T K +C+      Y
Sbjct: 113 HANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDCQFWHHTAKNLCAPFGADIY 167

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +
Sbjct: 168 NQHKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPI 223

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 224 VEKRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|148978489|ref|ZP_01814963.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
 gi|145962396|gb|EDK27676.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
          Length = 305

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ +  A          +F    W R+   +   GGGR 
Sbjct: 4   IDKEAVKQFLLSLQDSICQQLEQADGSA----------LFKEDAWEREPGDR-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H
Sbjct: 53  RVMTDGAVFEQGGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        +D D   +H T K++C+      Y 
Sbjct: 113 ANVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FDEDCQSWHQTAKDLCAPFGDNVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KEWCD+YFYLPHR E+RG+GG+FFD L+      G +  F+++ AVG+ +   Y  +V
Sbjct: 168 EHKEWCDKYFYLPHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGEGYAAAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|218710990|ref|YP_002418611.1| coproporphyrinogen III oxidase [Vibrio splendidus LGP32]
 gi|254800280|sp|B7VMW3|HEM6_VIBSL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218324009|emb|CAV20371.1| Coproporphyrinogen III oxidase, aerobic [Vibrio splendidus LGP32]
          Length = 305

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 112/297 (37%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ +  A          +F    W R+  ++   GGGR 
Sbjct: 4   IDKEAVKQFLLSLQDSICQQLEQADGTA----------LFEEDAWQREPGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H
Sbjct: 53  RVMTNGAVFEQGGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP         D D   +H T K++C+      Y 
Sbjct: 113 ANVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----VDEDCQSWHQTAKDLCAPFGDDVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KEWCD+YFYLPHR E+RG+GG+FFD L+      G +  F+++ AVG+ F   Y  +V
Sbjct: 168 EHKEWCDKYFYLPHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGEGFAAAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|160873163|ref|YP_001552479.1| coproporphyrinogen III oxidase [Shewanella baltica OS195]
 gi|160858685|gb|ABX47219.1| Coproporphyrinogen oxidase [Shewanella baltica OS195]
          Length = 323

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 117/292 (40%), Positives = 157/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           F    W R +      GGG    L  
Sbjct: 30  VKAFLLDLQNRICAGLQALDGQA----------TFAADSWTRAEG-----GGGTSRVLTQ 74

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 75  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 134

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 135 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 189

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 190 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKD 245

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 246 TEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 297


>gi|157373183|ref|YP_001471783.1| coproporphyrinogen III oxidase [Shewanella sediminis HAW-EB3]
 gi|189028108|sp|A8FP82|HEM6_SHESH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157315557|gb|ABV34655.1| Coproporphyrinogen oxidase [Shewanella sediminis HAW-EB3]
          Length = 306

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 114/292 (39%), Positives = 155/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC   E+L+ +            F    W R++      GGG    L  
Sbjct: 9   VKAFLLDLQQRICEGLEQLDGK----------GTFEADSWKREEG-----GGGTSRVLTN 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           GKVFE+A V  S V G   P          +   F A G+S+++HP NP +P  H N+R 
Sbjct: 54  GKVFEQAGVNFSHVTGAAMPASATANRSELEGRSFEAMGVSLVIHPKNPFLPTTHANVRF 113

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DVI +H    ++C     + Y  YK+W
Sbjct: 114 FIAKKEGADPVWWFGGGFDLTPYYP-----FEEDVIEWHQNAHDLCQPFGESVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+      G +  F F+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQD----GFEKSFEFMQAVGNGFLTSYAPIVERRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TEYGEKEREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|167621975|ref|YP_001672269.1| coproporphyrinogen III oxidase [Shewanella halifaxensis HAW-EB4]
 gi|189028106|sp|B0TLD7|HEM6_SHEHH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167351997|gb|ABZ74610.1| Coproporphyrinogen oxidase [Shewanella halifaxensis HAW-EB4]
          Length = 304

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 120/305 (39%), Positives = 158/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD       + +    +LQ  IC   E L+  A           F    W R++   
Sbjct: 1   MNAPDS-----TLVKAFLLDLQHRICNGLEALDGSA----------KFAEDAWKREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG+   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGQSRVLTGGTVFEQAGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPN 100

Query: 128 NPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NPH+P  H N+R  +         +WFGGG DLTP        Y  DV+ +H + K +C 
Sbjct: 101 NPHIPTTHANVRFFIAHKDGADPVWWFGGGFDLTPYYP-----YLEDVVEWHQSAKSLCE 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YF+LPHR E+RG+GG+FFD L+      G D  F+F+ AVG+ F
Sbjct: 156 PFGDEIYPEYKQWCDEYFFLPHRNETRGVGGLFFDDLNK----QGFDTSFAFMQAVGNGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R    ++ E +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMP
Sbjct: 212 LTAYAPIVERRKDTVYGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|58040326|ref|YP_192290.1| coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
 gi|58002740|gb|AAW61634.1| Coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
          Length = 305

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 134/295 (45%), Positives = 179/295 (60%), Gaps = 16/295 (5%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSAN-----RSPKIFTVKHWLRDKSQKEDLGG 72
           K+ ++  FE L+  IC  +EKLE+EA E  +       +P  F    W R +     +  
Sbjct: 22  KQDAKAWFETLRDRICASYEKLEDEAAEGGSQVLRDRTAPGRFERTAWSRPEGGSGVMSV 81

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
            R         FEK  V VSTV+G+ SP+F+  I G  ++P F+ATG+S++ HP NPHV 
Sbjct: 82  MRGRV------FEKVGVNVSTVWGEFSPEFRKNIPGADEDPRFFATGVSLVAHPCNPHVS 135

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A HFN RMI+T   WFGGG D+TP       +   D  +FH + ++ C++H   +Y  +K
Sbjct: 136 AAHFNTRMIITTKGWFGGGGDITPMFPESAEAQS-DAAYFHKSFEDACNRHDPEHYPRFK 194

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCDRYF+L HR E RG+GGIF+D  ++    G +D DF+F   VG  F   YP++VRR 
Sbjct: 195 EWCDRYFHLHHRNEPRGLGGIFYDQFYT----GDVDLDFAFTKDVGMAFHDAYPAVVRRR 250

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
               ++E DR  QLIRRGRY EFNLL+D+GT FG KTGGN E+IL SMPP V WP
Sbjct: 251 MFTPWTEADRDAQLIRRGRYVEFNLLHDRGTLFGLKTGGNTEAILMSMPPEVRWP 305


>gi|114561218|ref|YP_748731.1| coproporphyrinogen III oxidase [Shewanella frigidimarina NCIMB 400]
 gi|114332511|gb|ABI69893.1| Coproporphyrinogen oxidase [Shewanella frigidimarina NCIMB 400]
          Length = 310

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 117/294 (39%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC   E L+ +A           F    W R++      GGG    L
Sbjct: 12  QQVKSFLLGLQQNICQRLELLDGKA----------TFKADSWEREEG-----GGGTSRVL 56

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V G   P              F A G+S+++HP NP +P  H N+
Sbjct: 57  TQGQVFEQAGVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPFIPTTHANV 116

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        +  DV+ +H T K++C       Y  YK
Sbjct: 117 RFFIARKEGADPVWWFGGGFDLTPYYP-----FKEDVVSWHQTAKDICDPFGEDVYPKYK 171

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+LPHR E+RG+GG+FFD L+      G +  F F+ AVG+ FI+ Y  +V RN
Sbjct: 172 KWCDEYFFLPHRNETRGVGGLFFDDLNEP----GFERSFEFMQAVGNGFIEAYAPIVERN 227

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + + +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 228 KELEYGDDERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 281


>gi|294138841|ref|YP_003554819.1| coproporphyrinogen III oxidase, aerobic [Shewanella violacea DSS12]
 gi|293325310|dbj|BAJ00041.1| coproporphyrinogen III oxidase, aerobic [Shewanella violacea DSS12]
          Length = 305

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 154/305 (50%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD         +     LQ  IC   E+L+ +           +F    W R++   
Sbjct: 1   MPVPDI-----SAVKSFLLALQQQICEGLEQLDGK----------GVFKADSWEREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG    L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGTSRVLTKGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPN 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP++P  H N+R  +         +WFGGG DLTP        ++ DVI +H   K  C 
Sbjct: 101 NPYIPTTHANVRFFIASKEGADPVWWFGGGFDLTPYYP-----FEQDVIEWHQHSKSFCD 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFYLPHR E+RG+GG+FFD L+      G D  F F+ AVG  F
Sbjct: 156 PFGDEVYPKYKKWCDEYFYLPHRDETRGVGGLFFDDLNQE----GFDTSFEFMQAVGTGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V+R     + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMP
Sbjct: 212 LTAYAPIVKRRKDTEYGEKERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|126733458|ref|ZP_01749205.1| coproporphyrinogen III oxidase [Roseobacter sp. CCS2]
 gi|126716324|gb|EBA13188.1| coproporphyrinogen III oxidase [Roseobacter sp. CCS2]
          Length = 311

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 120/304 (39%), Positives = 158/304 (51%), Gaps = 18/304 (5%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKE 68
              D  E  K  +   F  L+  I   FE LE+       + +   F V   +R      
Sbjct: 19  NMSDGFEAEKSKASSWFRTLRDQIVASFEGLEDSHKG---DGTAGRFEVTETMRTSDDGS 75

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S++
Sbjct: 76  DAGGGLMSVMRGGRVFEKVGVNVSTVYGQLGASAQKAMAARGVPGMEDDPRFWASGISLV 135

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P +E     YD D   FH T K     
Sbjct: 136 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHLDP 190

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A+Y   K W D YFY+PHR  +RG+GGIF D   +    G  +ADF+    +G  F+
Sbjct: 191 HGEAHYPKLKAWADEYFYIPHRNRARGVGGIFMDDYCT----GDWEADFTLTQDIGKAFL 246

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP
Sbjct: 247 PAYIPLVEKRRDTPWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPP 306

Query: 303 LVAW 306
           L  W
Sbjct: 307 LAKW 310


>gi|229524956|ref|ZP_04414361.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae bv.
           albensis VL426]
 gi|229338537|gb|EEO03554.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae bv.
           albensis VL426]
          Length = 305

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 158/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEAADGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R  +         +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FVEDCQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYVQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRAESILMSMPPLARW 281


>gi|148545346|ref|YP_001265448.1| coproporphyrinogen III oxidase [Pseudomonas putida F1]
 gi|166217810|sp|A5VWK4|HEM6_PSEP1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|148509404|gb|ABQ76264.1| coproporphyrinogen oxidase [Pseudomonas putida F1]
          Length = 303

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GKV EK  V  S V+G   P              F A G+S+++HPYNPHVP 
Sbjct: 46  RTRVIGDGKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCVHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKDTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|221135277|ref|ZP_03561580.1| coproporphyrinogen III oxidase [Glaciecola sp. HTCC2999]
          Length = 310

 Score =  338 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 108/297 (36%), Positives = 150/297 (50%), Gaps = 30/297 (10%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E+    +     LQ  IC   E  + +A           F    W R++      GGGR 
Sbjct: 9   EKIAQVKAFLLKLQDNICQTLELSDGKA----------RFVEDEWEREQG-----GGGRT 53

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G V E+  V  S V+GD  P              F A G+S+++HP+NP++P  H
Sbjct: 54  RVLTNGAVIEQGGVNFSHVFGDQMPASATAARPELAGRRFQAMGVSLVIHPHNPYIPTSH 113

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        +  DV+ +H    ++C       Y 
Sbjct: 114 ANVRFFIAEKEGEAPIWWFGGGFDLTPFFP-----FKEDVVHWHKVAHDLCLPFGEDVYP 168

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            YK+WCD YFYL HR E+RG+GG+FFD L++       +  F F+ AVG+ ++  Y  ++
Sbjct: 169 KYKKWCDDYFYLKHRNETRGVGGLFFDDLNTP----DFETAFGFMQAVGNGYLDAYVPII 224

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +  +   +R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 EKRKNTEYGNMERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 281


>gi|330806733|ref|YP_004351195.1| coproporphyrinogen oxidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374841|gb|AEA66191.1| Coproporphyrinogen oxidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 304

 Score =  338 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E  +              F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALETEDG----------GTRFVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAEQACAPFGPEV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD L++       D  F+FI A+GD +I  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRNEPRGIGGLFFDDLNAW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR  H  F+ + R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKHDAFTAKQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|86147121|ref|ZP_01065437.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
 gi|85835005|gb|EAQ53147.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
          Length = 305

 Score =  338 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 113/297 (38%), Positives = 157/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ +  A          +F    W R+  ++   GGGR 
Sbjct: 4   IDKEAVKQFLLSLQDSICQQLEQADGAA----------LFEEDAWEREPGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H
Sbjct: 53  RVMTNGAVFEQGGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        +D D   +H T K++C+      Y 
Sbjct: 113 ANVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FDEDCQSWHQTAKDLCAPFGDDVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KEWCD+YFYLPHR E+RG+GG+FFD L+      G D  F+++ AVG+ F   Y  +V
Sbjct: 168 EHKEWCDKYFYLPHRDETRGVGGLFFDDLNEW----GFDKSFAYMQAVGEGFAAAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|167031110|ref|YP_001666341.1| coproporphyrinogen III oxidase [Pseudomonas putida GB-1]
 gi|189028102|sp|B0KF35|HEM6_PSEPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166857598|gb|ABY96005.1| Coproporphyrinogen oxidase [Pseudomonas putida GB-1]
          Length = 303

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GKV EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGDGKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD ++  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYVNAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKDTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|34496212|ref|NP_900427.1| coproporphyrinogen III oxidase [Chromobacterium violaceum ATCC
           12472]
 gi|41017116|sp|Q7P012|HEM6_CHRVO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|34102066|gb|AAQ58433.1| coproporphyrinogen oxidase [Chromobacterium violaceum ATCC 12472]
          Length = 302

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E+ + +A           F    W R+       GGGR   L
Sbjct: 7   NAVKSFLLDLQDRICAALEQADGKAQ----------FAEDAWSRE-----AGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V+GD  P              F A G+S+++HP NPHVP  H N+
Sbjct: 52  TGGEVFEQAGVNFSHVHGDALPPSASAHRPELAGRRFEAMGVSLVIHPSNPHVPTSHANV 111

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP         + D + +H   +++C+      Y  YK
Sbjct: 112 RFFIAEKDGEAPVWWFGGGFDLTPFYP-----QEEDAVHWHTVARDLCAPFGGDVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGG+FFD L+      G D  F+F  AVGD ++  Y  +V R 
Sbjct: 167 KWCDEYFHLKHRNEARGIGGLFFDDLNEW----GFDKSFAFTRAVGDGYLDAYLPIVARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 223 KEQAWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|192359457|ref|YP_001984040.1| coproporphyrinogen III oxidase [Cellvibrio japonicus Ueda107]
 gi|190685622|gb|ACE83300.1| coproporphyrinogen III oxidase, aerobic [Cellvibrio japonicus
           Ueda107]
          Length = 306

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 111/303 (36%), Positives = 149/303 (49%), Gaps = 30/303 (9%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
                   K   +    +LQ  IC      +  +           F    W R +     
Sbjct: 1   MTPSTAPDKAAVKAYLLDLQDRICQALAAEDGASG----------FIEDSWQRAEG---- 46

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGGR   L  G+V EK  V  S VYG   P              F A G+S+++HP NP
Sbjct: 47  -GGGRSRVLADGQVIEKGGVNFSHVYGTQMPASATAHRPELAGRAFEAMGVSLVIHPGNP 105

Query: 130 HVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP  H N+R  +         +WFGGG DLTP   +     + DVI +H + K  C   
Sbjct: 106 YVPTSHANVRFFIAEKEGAAPVWWFGGGYDLTPYYGN-----EADVIHWHQSAKNACDPL 160

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K+WCD YFYL HR E+RG+GG+FFD  ++          F+ + AVGD ++ 
Sbjct: 161 GEHLYPKFKKWCDDYFYLKHRGEARGVGGLFFDDYNAE----SFAHSFALMRAVGDSYVP 216

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V+   H  + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPL
Sbjct: 217 AYLPIVQARKHTPYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPL 276

Query: 304 VAW 306
           V W
Sbjct: 277 VRW 279


>gi|227356205|ref|ZP_03840594.1| coproporphyrinogen III oxidase, aerobic [Proteus mirabilis ATCC
           29906]
 gi|227163669|gb|EEI48585.1| coproporphyrinogen III oxidase, aerobic [Proteus mirabilis ATCC
           29906]
          Length = 302

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 113/292 (38%), Positives = 154/292 (52%), Gaps = 30/292 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             Q  F +LQ  IC   E ++ +A           F   +W R+       GGGR   L 
Sbjct: 8   RVQSFFLSLQDSICHAIENIDQKA----------TFQQDNWQRE-----AGGGGRTRVLT 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G +FE+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R
Sbjct: 53  QGAIFEQAGVNFSHVYGDALPASATAHRPELSGRRFQAMGVSLVIHPLNPYIPTSHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ DVI +H   K +C   +   Y  YK+
Sbjct: 113 FFIAEKEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCDPFSQNYYARYKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +  
Sbjct: 168 WCDDYFYLKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGQGYLDAYLPIVEKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
              + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 224 SIPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 275


>gi|254419937|ref|ZP_05033661.1| coproporphyrinogen III oxidase, aerobic [Brevundimonas sp. BAL3]
 gi|196186114|gb|EDX81090.1| coproporphyrinogen III oxidase, aerobic [Brevundimonas sp. BAL3]
          Length = 293

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 133/297 (44%), Positives = 175/297 (58%), Gaps = 10/297 (3%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
            D ++ +K  ++  FE+L+  I + FE LE+ A +      P  F    W R       +
Sbjct: 7   SDPLDLKKVETRAWFEHLRDRIHSAFEALEDAAPDELFPGEPGRFVRTAWDRKDGGGGVM 66

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           G           +FEK  V VSTV+G    D+   + G  ++P F+ATG+S+I HP +P 
Sbjct: 67  GMMHGR------LFEKVGVHVSTVHGSFPADYAKTVPGAAEDPRFFATGISLICHPVSPR 120

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R I T   WFGGG DLTP L++ R    PD + FH  +K  C  H    +  
Sbjct: 121 VPAVHMNTRFIATTRSWFGGGGDLTPVLDADRRQDHPDTLAFHAAMKAACDAHDPDWHAK 180

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK WCD YF+LPHRQE RG GGIF+DH  S    G  D DF+F   VG  F+ +YP +V 
Sbjct: 181 YKAWCDEYFFLPHRQEPRGTGGIFYDHHDS----GDHDRDFAFTRDVGLAFLDVYPKIVA 236

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
                 ++ ++R+EQL+RRGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 237 GRMGEAWTPEEREEQLVRRGRYVEFNLLYDRGTMFGLKTGGNVDSILSSMPPVVKWP 293


>gi|319424447|gb|ADV52521.1| Coproporphyrinogen oxidase [Shewanella putrefaciens 200]
          Length = 302

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 118/292 (40%), Positives = 158/292 (54%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ+ IC   + L+ +A           FT   W R +      GGG    L  
Sbjct: 9   VKAFLIDLQNRICAGLQALDGQA----------TFTADSWTRAEG-----GGGTSKVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVLHPNNPYIPTTHANVRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ DV  +H T K++C+      Y  YK+W
Sbjct: 114 FIAQKEGADPVWWFGGGFDLTPYYP-----FEEDVREWHQTSKDICAPFGDEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  FSF+ AVG+ F+  Y  +V R   
Sbjct: 169 CDEYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFSFMQAVGNGFLTAYAPIVERRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TGFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|104779343|ref|YP_605841.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
 gi|122401160|sp|Q1I2G6|HEM6_PSEE4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|95108330|emb|CAK13024.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
          Length = 303

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 109/299 (36%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+RD       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRD-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GKV EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGEGKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCVHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+        D  F+F+ A+GD ++  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFMRAIGDAYVDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +++R     ++ + R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IIQRRKDTPYTAKQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|170719279|ref|YP_001746967.1| coproporphyrinogen III oxidase [Pseudomonas putida W619]
 gi|226740889|sp|B1J4A2|HEM6_PSEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|169757282|gb|ACA70598.1| Coproporphyrinogen oxidase [Pseudomonas putida W619]
          Length = 303

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 110/299 (36%), Positives = 153/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GK+ EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGDGKLIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF++ HR E RGIGG+FFD L+      G D  F+FI A+GD ++  Y  
Sbjct: 161 YPRYKAWCDRYFHIKHRGEPRGIGGLFFDDLNEW----GFDTCFAFIRAIGDAYVDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++ + R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKDTPYTAEQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|146280423|ref|YP_001170576.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri A1501]
 gi|166217811|sp|A4VFI3|HEM6_PSEU5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|145568628|gb|ABP77734.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas stutzeri
           A1501]
 gi|327478639|gb|AEA81949.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri DSM 4166]
          Length = 306

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 156/299 (52%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  +  A           F    W R        GGG
Sbjct: 1   MNDRTEAVKAYLLDLQDRICAALEVEDGGA----------RFVEDAWTR-----PGGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP+NP+VP 
Sbjct: 46  RTRVIENGALIEKGGVNFSHVHGDSLPPSASAHRPELAGRSFEALGVSLVIHPHNPYVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKDGEEPVWWFGGGFDLTPY-----YGAEEDCVHWHRVARDACAPFGAEV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YKEWCDRYF++ HR E RG+GG+FFD L+        D  F+F+ AVGD +++ Y  
Sbjct: 161 YPRYKEWCDRYFHIKHRNEPRGVGGLFFDDLNQW----DFDTSFAFMRAVGDAYLQAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     F E++RQ QL+RRGRY E+NL+YD+GT FG ++GG  ESIL S+PP VAW
Sbjct: 217 IVQRRKATPFGERERQFQLLRRGRYVEYNLVYDRGTLFGLQSGGRTESILMSLPPQVAW 275


>gi|107099017|ref|ZP_01362935.1| hypothetical protein PaerPA_01000025 [Pseudomonas aeruginosa PACS2]
          Length = 308

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 113/301 (37%), Positives = 154/301 (51%), Gaps = 30/301 (9%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           + + +R    +    +LQ  IC   E  + +A           F    W R        G
Sbjct: 2   NSVTDRIAAVKTYLLDLQDRICAALEAEDGKA----------RFAEDAWER-----PAGG 46

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GGR   +  G + EK  V  S V+GD  P              F A G+S+++HP NPHV
Sbjct: 47  GGRTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHV 106

Query: 132 PAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N+R            +WFGGG DLTP      ++++ D + +H   ++ C+    
Sbjct: 107 PTSHANVRFFCAEKEGEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGA 161

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  YKEWCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y
Sbjct: 162 DVYPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAY 217

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V+R  H  F E+ R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V 
Sbjct: 218 LPIVQRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVR 277

Query: 306 W 306
           W
Sbjct: 278 W 278


>gi|152983988|ref|YP_001345421.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PA7]
 gi|166217808|sp|A6UX86|HEM6_PSEA7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150959146|gb|ABR81171.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           PA7]
          Length = 305

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  + +A           F    W R        GGG
Sbjct: 1   MTDRIAAVKTYLLDLQDRICAALEAEDGKA----------RFAEDAWER-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP NPHVP 
Sbjct: 46  RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R            +WFGGG DLTP      ++ + D + +H   ++ C+      
Sbjct: 106 SHANVRFFCAEKAGEEPVWWFGGGFDLTPY-----YASEEDCVHWHRVARDACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YKEWCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  H  F E+ R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|163751674|ref|ZP_02158893.1| coproporphyrinogen III oxidase [Shewanella benthica KT99]
 gi|161328413|gb|EDP99569.1| coproporphyrinogen III oxidase [Shewanella benthica KT99]
          Length = 306

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 117/294 (39%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           R  +     LQ  IC   E+L+ +            F    W R++      GGG    L
Sbjct: 7   RAVKSFLLALQQQICEGLEQLDGK----------GEFKADSWEREEG-----GGGTSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP+NP++P  H N+
Sbjct: 52  TKGAVFEQAGVNFSHVTGASMPASATAHRPELAGRSFEAMGVSLVIHPHNPYIPTTHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        ++ DVI +H   K  C       Y  YK
Sbjct: 112 RFFIASKEGADPVWWFGGGFDLTPYYP-----FEEDVIEWHQDAKSFCDPFGDEVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR E+RG+GG+FFD L+      G D  F F+ AVG  F+  Y  +V R 
Sbjct: 167 QWCDEYFYLPHRDETRGVGGLFFDDLNQE----GFDTSFEFMQAVGTGFLTSYAPIVNRR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KDTEYGEKERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|15595222|ref|NP_248714.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAO1]
 gi|116053744|ref|YP_788179.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296386498|ref|ZP_06875997.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAb1]
 gi|313111453|ref|ZP_07797255.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           39016]
 gi|1170220|sp|P43898|HEM6_PSEAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122262121|sp|Q02V57|HEM6_PSEAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|9945844|gb|AAG03414.1|AE004442_1 coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           PAO1]
 gi|695693|emb|CAA59376.1| oxygen-dependent coproporphyrinogen III oxidase [Pseudomonas
           aeruginosa PAO1]
 gi|115588965|gb|ABJ14980.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310883757|gb|EFQ42351.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           39016]
          Length = 305

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 153/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  + +A           F    W R        GGG
Sbjct: 1   MTDRIAAVKTYLLDLQDRICAALEAEDGKA----------RFAEDAWER-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP NPHVP 
Sbjct: 46  RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R            +WFGGG DLTP      ++++ D + +H   ++ C+      
Sbjct: 106 SHANVRFFCAEKEGEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YKEWCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  H  F E+ R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|327482965|gb|AEA77372.1| Coproporphyrinogen III oxidase, aerobic [Vibrio cholerae LMA3894-4]
          Length = 305

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 115/296 (38%), Positives = 157/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F++I AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|27364488|ref|NP_760016.1| coproporphyrinogen III oxidase [Vibrio vulnificus CMCP6]
 gi|320154892|ref|YP_004187271.1| coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus
           MO6-24/O]
 gi|31340169|sp|Q8DDD5|HEM6_VIBVU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|27360607|gb|AAO09543.1| Coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus CMCP6]
 gi|319930204|gb|ADV85068.1| coproporphyrinogen III oxidase, aerobic [Vibrio vulnificus
           MO6-24/O]
          Length = 305

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 115/297 (38%), Positives = 153/297 (51%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   +     LQ  IC   E+ + +A           F    W R+   +   GGGR 
Sbjct: 4   IDKEAVKLYLMQLQDQICQRLEQEDGKA----------TFIEDAWYREPGDR-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G+  P              F A G+S+++HP+NP+VP  H
Sbjct: 53  RVMRDGNVFEQGGVNFSHVQGNAMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSH 112

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        ++ D  F+HNT KE+C+      Y 
Sbjct: 113 ANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FEEDCQFWHNTAKEVCAPFGADVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YFYLPHR E+RGIGG+FFD L+        D  F +I AVG+ +   Y  +V
Sbjct: 168 QHKAWCDDYFYLPHRGETRGIGGLFFDDLNQWE----FDKCFDYIKAVGEGYCDAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKVTEYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|37681400|ref|NP_936009.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
 gi|41017097|sp|Q7MGL4|HEM6_VIBVY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|37200152|dbj|BAC95980.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
          Length = 305

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 115/297 (38%), Positives = 153/297 (51%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   +     LQ  IC   E+ + +A           F    W R+   +   GGGR 
Sbjct: 4   IDKEAVKLYLMQLQDQICQRLEQEDGKA----------TFIEDAWHREPGDR-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G+  P              F A G+S+++HP+NP+VP  H
Sbjct: 53  RVMRNGNVFEQGGVNFSHVQGNAMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSH 112

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        ++ D  F+HNT KE+C+      Y 
Sbjct: 113 ANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FEEDCQFWHNTAKEVCAPFGADVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YFYLPHR E+RGIGG+FFD L+        D  F +I AVG+ +   Y  +V
Sbjct: 168 QHKAWCDDYFYLPHRGETRGIGGLFFDDLNQWE----FDKCFDYIKAVGEGYCDAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKVTEYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|307151643|ref|YP_003887027.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7822]
 gi|306981871|gb|ADN13752.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7822]
          Length = 343

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 112/312 (35%), Positives = 150/312 (48%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K    +  ++LQ  IC   E+L+              F    W R++      GGGR   
Sbjct: 22  KERVSQFMKSLQDEICQGLEELDG----------TGKFREDSWNREEG-----GGGRSRV 66

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G V E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P VH N
Sbjct: 67  LRDGGVLEQGGVNFSEVWGKQLPPSILKQRPEAEGHEFYATGTSLVLHPRNPYIPTVHLN 126

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        Y  D   FH T K  C QH    Y  +K WCD
Sbjct: 127 YRYFEAGPVWWFGGGADLTPYYP-----YAEDAAHFHRTFKAACDQHHPEYYPVFKRWCD 181

Query: 197 RYFYLPHRQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFI 234
            YFYL HR E+RGIGG+FFD+                                +  F+F+
Sbjct: 182 EYFYLKHRGETRGIGGLFFDYQDGLDPLYRGPHADQGAAIYSQQLPPQSPRTWEQLFAFV 241

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
           +  G  F+  Y  + +R  +  + +++RQ QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 242 NDCGRAFLPAYVPIAQRRKNTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 301

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 302 SILMSLPPLVRW 313


>gi|297180819|gb|ADI17025.1| coproporphyrinogen III oxidase [uncultured Vibrionales bacterium
           HF0010_22E23]
          Length = 307

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 113/295 (38%), Positives = 149/295 (50%), Gaps = 30/295 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K   +    +LQ  IC   E+ +  A           F    W R +      GGGR   
Sbjct: 12  KEQVKAFLLSLQDTICQALEQEDGAAS----------FKQDSWERQEG-----GGGRSRV 56

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G +FE+A V  S V+GD  P              F A G+S++VHP NPHVP  H N
Sbjct: 57  LRDGAIFEQAGVNFSHVFGDKMPASATAHRPELAGRSFEAMGVSLVVHPNNPHVPTSHAN 116

Query: 138 IRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R            +WFGGG DLTP         + D   +H   K +C       Y  +
Sbjct: 117 VRFFIAEKEGEAPVWWFGGGFDLTPFYP-----VEEDCAHWHQVAKSLCEPFGDDVYAEH 171

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCDRYF+LPHR E+RG+GG+FFD L+      G +  F++I AVG  ++  Y  +V +
Sbjct: 172 KAWCDRYFFLPHRNETRGVGGLFFDDLN----GWGFENSFAYIRAVGLGYLDGYLPIVAK 227

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                F E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 228 RKDTEFGEKERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPMARW 282


>gi|26986818|ref|NP_742243.1| coproporphyrinogen III oxidase [Pseudomonas putida KT2440]
 gi|38372332|sp|Q88RQ6|HEM6_PSEPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24981415|gb|AAN65707.1|AE016197_5 coproporphyrinogen III oxidase, aerobic [Pseudomonas putida KT2440]
          Length = 303

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGEGNVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD F+  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAFVDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  +  ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|260771096|ref|ZP_05880024.1| coproporphyrinogen III oxidase aerobic [Vibrio furnissii CIP
           102972]
 gi|260613985|gb|EEX39176.1| coproporphyrinogen III oxidase aerobic [Vibrio furnissii CIP
           102972]
          Length = 304

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 153/297 (51%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E ++  A           F    W R+  +K   GGGR 
Sbjct: 4   INKEAVKQFLLSLQDSICQQLEAVDGGA----------TFEEDAWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMRNGHVFEQGGVNFSHVAGQQMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        ++ D   +H   K +C+      Y 
Sbjct: 113 ANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FEQDCHEWHRVAKALCAPFGDEVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCDRYFYLPHR+E+RGIGG+FFD L+        +  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDRYFYLPHREETRGIGGLFFDDLNQW----SFEQCFDYIKAVGEGYTQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKATPYGEREREFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|260432445|ref|ZP_05786416.1| coproporphyrinogen III oxidase, aerobic [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416273|gb|EEX09532.1| coproporphyrinogen III oxidase, aerobic [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 294

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 160/302 (52%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKEDLG 71
             +  K  +   F +L+  I   FE LE+       +   P  F VK   R      D G
Sbjct: 1   MFDTEKATASAWFRSLRDQIVAAFEALEDSHDTGPFSEAEPGRFEVKETRRHSEDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTVYG        +   +  I G   +P FWA+G+S++ H
Sbjct: 61  GGLMSVMRGGRVFEKVGVNVSTVYGTLGERAQQAMAARKGIPGMADDPRFWASGISLVAH 120

Query: 126 PYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T   +WFGGG DL P +E     Y  D   FH T K     H 
Sbjct: 121 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHATQKAHLDPHG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
             +Y   KEW D YFY+PHR+ +RG+GGIF D   +    G   ADF+    +G  F+  
Sbjct: 176 PGHYPRLKEWADEYFYIPHRKRARGVGGIFMDDYCT----GDWQADFALTQDIGRAFLPA 231

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV +     F+E D+  QLI RG YAE+NL+YD+GT FG +TG + +++L S+PPL 
Sbjct: 232 FLPLVEKRRVQPFTEADKDTQLIHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPPLA 291

Query: 305 AW 306
            W
Sbjct: 292 KW 293


>gi|170724415|ref|YP_001758441.1| coproporphyrinogen III oxidase [Shewanella woodyi ATCC 51908]
 gi|226740902|sp|B1KCX1|HEM6_SHEWM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|169809762|gb|ACA84346.1| Coproporphyrinogen oxidase [Shewanella woodyi ATCC 51908]
          Length = 306

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 118/292 (40%), Positives = 157/292 (53%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC   E+L+ EA           F    W R++      GGG    L  
Sbjct: 9   VKAFLLDLQQRICDGLEQLDGEA----------KFKADSWKREEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           GKVFE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GKVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        +  DVI +H    ++C       Y  YK+W
Sbjct: 114 FIAKKEGADPVWWFGGGFDLTPYYP-----FKEDVIEWHQNAHDLCLPFGEEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYLPHR E+RG+GG+FFD L++     G D  F+F+ AVG+ F+  Y  +V+R   
Sbjct: 169 CDDYFYLPHRDETRGVGGLFFDDLNAE----GFDTSFAFMQAVGNGFLTAYAPIVQRRKE 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 TQYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|313496445|gb|ADR57811.1| HemF [Pseudomonas putida BIRD-1]
          Length = 303

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 153/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALETEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GKV EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGEGKVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD F+  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAFVDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  +  ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|229530160|ref|ZP_04419549.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae 12129(1)]
 gi|262191285|ref|ZP_06049479.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae CT 5369-93]
 gi|229332293|gb|EEN97780.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae 12129(1)]
 gi|262032823|gb|EEY51367.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae CT 5369-93]
          Length = 305

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 157/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|91791399|ref|YP_561050.1| coproporphyrinogen III oxidase [Shewanella denitrificans OS217]
 gi|123357279|sp|Q12T99|HEM6_SHEDO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91713401|gb|ABE53327.1| Coproporphyrinogen oxidase [Shewanella denitrificans OS217]
          Length = 305

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 119/292 (40%), Positives = 160/292 (54%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ+ IC E E+L+ EA           F  + W R +      GGG    L  
Sbjct: 9   VKQFLLALQTNICAELEQLDGEAS----------FKAESWQRAEG-----GGGTSRVLTQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           GK+FE+A V  S V G   P              F A G+S+++HP NP++P  H N+R 
Sbjct: 54  GKLFEQAGVNFSHVKGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTTHANVRF 113

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        +  DV+ +H T  ++C+      Y  YK+W
Sbjct: 114 FIASKEGADPVWWFGGGFDLTPYYP-----FKEDVLSWHQTAADLCAPFGEEVYPKYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+LPHR E+RG+GG+FFD L+ +    G +  F+F+ AVG+ FI+ Y  +V R   
Sbjct: 169 CDDYFFLPHRNETRGVGGLFFDDLNQA----GFEQSFAFMRAVGEGFIQAYAPIVERRKA 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 LSFGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|15640087|ref|NP_229714.1| coproporphyrinogen III oxidase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121587246|ref|ZP_01677019.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 2740-80]
 gi|121727881|ref|ZP_01680940.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V52]
 gi|147674221|ref|YP_001218358.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|153817569|ref|ZP_01970236.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae NCTC 8457]
 gi|153821927|ref|ZP_01974594.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae B33]
 gi|229508339|ref|ZP_04397843.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae BX 330286]
 gi|229508822|ref|ZP_04398313.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae B33]
 gi|229517093|ref|ZP_04406539.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC9]
 gi|229606614|ref|YP_002877262.1| coproporphyrinogen III oxidase [Vibrio cholerae MJ-1236]
 gi|254851619|ref|ZP_05240969.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|255746764|ref|ZP_05420710.1| coproporphyrinogen III oxidase aerobic [Vibrio cholera CIRS 101]
 gi|262155845|ref|ZP_06028967.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae INDRE 91/1]
 gi|262166888|ref|ZP_06034609.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC27]
 gi|13431551|sp|Q9KVT4|HEM6_VIBCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|172047504|sp|A5F4C4|HEM6_VIBC3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|9654449|gb|AAF93233.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121548492|gb|EAX58548.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 2740-80]
 gi|121629825|gb|EAX62240.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V52]
 gi|126511837|gb|EAZ74431.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae NCTC 8457]
 gi|126520547|gb|EAZ77770.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae B33]
 gi|146316104|gb|ABQ20643.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae O395]
 gi|227011942|gb|ACP08152.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|229346156|gb|EEO11128.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC9]
 gi|229354097|gb|EEO19029.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae B33]
 gi|229354612|gb|EEO19534.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae BX 330286]
 gi|229369269|gb|ACQ59692.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae MJ-1236]
 gi|254847324|gb|EET25738.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|255735521|gb|EET90920.1| coproporphyrinogen III oxidase aerobic [Vibrio cholera CIRS 101]
 gi|262024659|gb|EEY43339.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae RC27]
 gi|262030297|gb|EEY48939.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae INDRE 91/1]
          Length = 305

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 113/296 (38%), Positives = 155/296 (52%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K +C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKNICAPFGSEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+        +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEW----SFEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|156933010|ref|YP_001436926.1| coproporphyrinogen III oxidase [Cronobacter sakazakii ATCC BAA-894]
 gi|166217800|sp|A7MKX5|HEM6_ENTS8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|156531264|gb|ABU76090.1| hypothetical protein ESA_00813 [Cronobacter sakazakii ATCC BAA-894]
          Length = 301

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 116/303 (38%), Positives = 160/303 (52%), Gaps = 35/303 (11%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
              DI    +  +    +LQ  IC +   ++ +            F    W R+      
Sbjct: 1   MAPDI----QRVKAFLLDLQDRICQQLSAVDGD-----------DFVEDAWQREGGG--- 42

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
             GGR   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP
Sbjct: 43  --GGRSRVLRDGVVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPRNP 100

Query: 130 HVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP  H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C+  
Sbjct: 101 YVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDAVHWHRTARDLCAPF 155

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  YK+WCD YFYL HRQE+RGIGG+FFD L++       D  F+F+ AVGD ++ 
Sbjct: 156 GDDVYPRYKKWCDDYFYLKHRQEARGIGGLFFDDLNTP----DFDTCFAFMQAVGDGYLN 211

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL
Sbjct: 212 AYLPIVERRKTLPWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPL 271

Query: 304 VAW 306
           V W
Sbjct: 272 VRW 274


>gi|153826440|ref|ZP_01979107.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-2]
 gi|149739826|gb|EDM54021.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-2]
          Length = 305

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 156/296 (52%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K +C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKNICAPFGSEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|84516583|ref|ZP_01003942.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
 gi|84509619|gb|EAQ06077.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
          Length = 292

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 115/303 (37%), Positives = 154/303 (50%), Gaps = 18/303 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             ++   +K  +   F  L+  I   FE LE+      A+     F V    R      D
Sbjct: 1   MAEEFATQKAKASAWFRALRDDIVAAFEALEDSHT---ADTPAGRFEVTETSRHSDDGSD 57

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVIV 124
            GGG M+ +  G+VFEK  V +STVYG              + G   +P FWA+G+S++ 
Sbjct: 58  AGGGLMSVMRGGRVFEKVGVNISTVYGQLGDGAQRAMAARGVPGMADDPRFWASGISLVA 117

Query: 125 HPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T   +WFGGG DL P +E     Y  D   FH T K     H
Sbjct: 118 HMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHATQKAHLDPH 172

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
            + +Y   K W D YFY+PHR  +RG+GGIF D   +    G  DADF+    +G  F+ 
Sbjct: 173 GLDHYPKLKAWADEYFYIPHRNRARGVGGIFMDDYCT----GDWDADFTLTQDIGRAFLP 228

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  LV       +++ D+  QLI RG YAE+NL+YD+GT FG  TG +  ++L S+PPL
Sbjct: 229 AYVPLVETRRETPWTDADKDTQLIHRGLYAEYNLVYDRGTKFGLTTGHDANAVLMSLPPL 288

Query: 304 VAW 306
             W
Sbjct: 289 AKW 291


>gi|221640139|ref|YP_002526401.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides KD131]
 gi|221160920|gb|ACM01900.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides KD131]
          Length = 291

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 171/304 (56%), Gaps = 21/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
             D ++ +K  +   F  L++ I   FE LE+ A   + A+ +P  F V    R+     
Sbjct: 1   MNDAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEVTETSRE----- 55

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
             GGG M+ +  G+VFEK  V VSTV+G              + G  ++P FWA+G+S++
Sbjct: 56  AGGGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P L+     Y  D   FH TL+  C  
Sbjct: 116 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTEHFHATLRRACEA 170

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+
Sbjct: 171 HGADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFL 226

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 227 PAFVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 286

Query: 303 LVAW 306
           L  W
Sbjct: 287 LAKW 290


>gi|260598821|ref|YP_003211392.1| coproporphyrinogen III oxidase [Cronobacter turicensis z3032]
 gi|260217998|emb|CBA32667.1| Coproporphyrinogen-III oxidase, aerobic [Cronobacter turicensis
           z3032]
          Length = 301

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 117/303 (38%), Positives = 160/303 (52%), Gaps = 35/303 (11%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
              DI    +  +    +LQ  IC +   ++ +            F    W R+      
Sbjct: 1   MAPDI----QRVKAFLLDLQDRICQQLAAVDGDH-----------FVEDAWQREGGG--- 42

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
             GGR   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP
Sbjct: 43  --GGRSRVLRDGVVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPRNP 100

Query: 130 HVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP  H N+R  +         +WFGGG DLTP      + ++ D   +H T +++C+  
Sbjct: 101 YVPTSHANVRFFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDASHWHRTARDLCAPF 155

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  YK+WCD YFYL HRQE+RGIGG+FFD L++       D  F+F+ AVGD ++K
Sbjct: 156 GDDVYPRYKKWCDDYFYLKHRQEARGIGGLFFDDLNTP----DFDTCFAFMQAVGDGYLK 211

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL
Sbjct: 212 AYLPIVERRKALPWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPL 271

Query: 304 VAW 306
           V W
Sbjct: 272 VRW 274


>gi|254237734|ref|ZP_04931057.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           C3719]
 gi|126169665|gb|EAZ55176.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           C3719]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/299 (38%), Positives = 154/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  + +A           F    W R        GGG
Sbjct: 1   MTDRIAAVKTYLLDLQDRICAALEAEDGKA----------RFAEDAWER-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP NPHVP 
Sbjct: 46  RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R            +WFGGG DLTP      ++++ D + +H   ++ C+      
Sbjct: 106 SHANVRFFCAEKEGEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y HYKEWCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YPHYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  H  F E+ R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|197106335|ref|YP_002131712.1| coproporphyrinogen III oxidase precursor [Phenylobacterium zucineum
           HLK1]
 gi|196479755|gb|ACG79283.1| coproporphyrinogen III oxidase precursor [Phenylobacterium zucineum
           HLK1]
          Length = 296

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 178/305 (58%), Gaps = 9/305 (2%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +       P +I  R+  ++  FE+LQ+ IC E E+LE+EA       +P  F ++ W R
Sbjct: 1   MSEPAPTLPPEILARRDRAKAWFEDLQARICAELERLEDEAPPELYPDAPGRFEMRPWTR 60

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           +       GG        G++FEKA V  S      SP+   Q+ G  K+P + +  +S+
Sbjct: 61  ETGVGGGTGGHL-----KGRLFEKAGVHTSAATARFSPEMAAQMPGADKDPSYVSASISL 115

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           IVHP +P VP VH N R + T   WFGGG DLTP L+ +R     D   FH  +K  C  
Sbjct: 116 IVHPVSPRVPTVHMNTRFLSTAESWFGGGADLTPMLDEQRSQDADDAKLFHAAMKAACDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
                +  YK WCD YF+LPHR E RGIGGIF+D  ++    G  + DF+F  AVG+ F+
Sbjct: 176 FDPEWHPRYKAWCDEYFFLPHRGEPRGIGGIFYDRHNT----GDFETDFAFTRAVGEAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
            +YP +VR      +++ DR EQL+RRGRY EFNLLYD+GT FG K GGN+E+IL+SMPP
Sbjct: 232 DVYPKIVRHRMSEPWTDADRAEQLVRRGRYVEFNLLYDRGTMFGLKAGGNIETILSSMPP 291

Query: 303 LVAWP 307
           LVAWP
Sbjct: 292 LVAWP 296


>gi|254291085|ref|ZP_04961882.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae AM-19226]
 gi|150422930|gb|EDN14880.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae AM-19226]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 157/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FIEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|229520240|ref|ZP_04409667.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TM
           11079-80]
 gi|229342834|gb|EEO07825.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TM
           11079-80]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 115/296 (38%), Positives = 157/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R  +         +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F++I AVG  + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYIQAVGKGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|297581912|ref|ZP_06943832.1| coproporphyrinogen III oxidase [Vibrio cholerae RC385]
 gi|297533779|gb|EFH72620.1| coproporphyrinogen III oxidase [Vibrio cholerae RC385]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 156/296 (52%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDVWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        +  D   +H T K +C+      Y  
Sbjct: 115 NVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKNICAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|153217572|ref|ZP_01951253.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 1587]
 gi|153802767|ref|ZP_01957353.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-3]
 gi|153830120|ref|ZP_01982787.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 623-39]
 gi|229515907|ref|ZP_04405364.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TMA 21]
 gi|124113484|gb|EAY32304.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 1587]
 gi|124121680|gb|EAY40423.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae MZO-3]
 gi|148874384|gb|EDL72519.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae 623-39]
 gi|229347007|gb|EEO11969.1| coproporphyrinogen III oxidase aerobic [Vibrio cholerae TMA 21]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 158/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRRFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R  +         +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|254225577|ref|ZP_04919186.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V51]
 gi|125621897|gb|EAZ50222.1| coproporphyrinogen III oxidase, aerobic [Vibrio cholerae V51]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 159/296 (53%), Gaps = 26/296 (8%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K+  +     LQ  IC + E  + +A           F    W R+  +K   GGGR  
Sbjct: 6   DKQAVKHFLLQLQDKICQQLEATDGQAQ----------FIEDAWQREPGEK-LGGGGRTR 54

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            +  G VFE+  V  S V+G+  P             +F A G+S+++HP NP+VP  H 
Sbjct: 55  VMREGAVFEQGGVNFSHVFGEQMPASATAHRPELAGRHFEAMGVSLVMHPKNPYVPTSHA 114

Query: 137 NIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R  +         +WFGGG DLTP        +  D   +H T K++C+      Y  
Sbjct: 115 NVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FVEDGQHWHQTAKQLCAPFGAEIYNE 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCDRYFYLPHR E+RGIGG+FFD L+  P     +  F+++ AVG+ + + Y  +V 
Sbjct: 170 HKAWCDRYFYLPHRNETRGIGGLFFDDLNEWP----FEQCFAYMQAVGEGYTQAYVPIVE 225

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F+E++RQ QL RRGRY EFNL+ D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 226 KRKNTPFTERERQFQLYRRGRYVEFNLVLDRGTLFGLQTGGRTESILMSMPPLARW 281


>gi|126463097|ref|YP_001044211.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104761|gb|ABN77439.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides ATCC 17029]
          Length = 291

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 171/304 (56%), Gaps = 21/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
             D ++ +K  +   F  L++ I   FE LE+ A   + A+ +P  F V    R+     
Sbjct: 1   MNDAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEVTETSRE----- 55

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
             GGG M+ +  G+VFEK  V VSTV+G              + G  ++P FWA+G+S++
Sbjct: 56  AGGGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P L+     Y  D   FH TL+  C  
Sbjct: 116 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTEHFHATLRHACEA 170

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+
Sbjct: 171 HGADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFL 226

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 227 PAFVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 286

Query: 303 LVAW 306
           L  W
Sbjct: 287 LAKW 290


>gi|149201111|ref|ZP_01878086.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
 gi|149145444|gb|EDM33470.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
          Length = 296

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/304 (37%), Positives = 157/304 (51%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
             D+  ++K  +   F  L+  I T FE LE+  A    ++ +P  F V    R      
Sbjct: 1   MTDEFTQQKSRAAAWFRQLRDDIVTAFEGLEDNHATGPLSDAAPARFEVSDTSRHSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V VS VYG              + G   +P FWA+G+S++
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNVSEVYGTLGEAAQRAMAARGVPGMDSDPRFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P +E     Y  D   FH   +     
Sbjct: 121 AHMQNPHCPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHGQQRAHLDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y   K W D YF++PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+
Sbjct: 176 HGADLYPKLKAWADEYFFVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV +     +S+ D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP
Sbjct: 232 PAYVPLVEKRRVQPWSDADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPP 291

Query: 303 LVAW 306
           L  W
Sbjct: 292 LAKW 295


>gi|254784310|ref|YP_003071738.1| coproporphyrinogen III oxidase [Teredinibacter turnerae T7901]
 gi|237684189|gb|ACR11453.1| HemF/Oxygen-dependent Coproporphyrinogen III oxidase
           [Teredinibacter turnerae T7901]
          Length = 307

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 151/305 (49%), Gaps = 31/305 (10%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  P D  + K   +    +LQ  IC + E ++              F    W R +   
Sbjct: 1   MANPSDTPD-KAAVKSYLLDLQQRICNQLEAVDG----------GGRFAADTWQRAEGGG 49

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            +        L  G V EK  V  S V G   P              F A G+S+++HP 
Sbjct: 50  GE-----SRVLTDGAVIEKGGVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHPS 104

Query: 128 NPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP+VP  H N+R            +WFGGG DLTP   +     + D   +H T  + C 
Sbjct: 105 NPYVPTSHANVRFFIAEKPGEAPVWWFGGGYDLTPYYGN-----EEDCRHWHRTAADACE 159

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
           +     YT YK WCD YFYL HRQE RGIGG+FFD L+      G +  F+F+ +VGD +
Sbjct: 160 EFGAGVYTEYKRWCDEYFYLKHRQEPRGIGGLFFDDLN----HWGFNRSFAFMQSVGDSY 215

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
            + Y  +V R  H  + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+P
Sbjct: 216 CRAYLPIVERRKHLPYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLP 275

Query: 302 PLVAW 306
           PLV W
Sbjct: 276 PLVRW 280


>gi|126724992|ref|ZP_01740835.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
 gi|126706156|gb|EBA05246.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
          Length = 293

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 116/304 (38%), Positives = 165/304 (54%), Gaps = 19/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             ++ +++K  +   F  L++ I T FE LE++      +     F V    R      D
Sbjct: 1   MTNNFDQQKSQASAWFRQLRNEIRTSFEGLEDKFGG---DAPAGRFEVTETTRTSDDGSD 57

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVI 123
            GGG M+ +  G+VFEK  V +STVYG        +   +  I     +P FWA G+S++
Sbjct: 58  AGGGEMSVMRGGRVFEKIGVNISTVYGTLGERAQKAMAAQKNIPEMRDDPRFWAAGISLV 117

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P +E     Y  D   FH T +  C  
Sbjct: 118 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTEHFHATQRAHCDP 172

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +KEW D YFY+PHR  +RG+GGIF+D L++    G  D DF+F   VG  F+
Sbjct: 173 HDAGYYDKFKEWADTYFYIPHRHRARGVGGIFYDDLNT----GDWDKDFAFTQDVGRAFL 228

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  L+++     +++ D+  QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 229 PAYVPLIQKRMQQPWNDADKDAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 288

Query: 303 LVAW 306
           +  W
Sbjct: 289 MAKW 292


>gi|83941604|ref|ZP_00954066.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
 gi|83847424|gb|EAP85299.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
          Length = 297

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 119/305 (39%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
              D E  K  +   F +L+  I   FE LE + A    ++ +P  F V    R      
Sbjct: 1   MTVDFEAEKTRAAEWFRSLRDQIVEAFETLERDHAEGPLSDAAPGTFEVTPTKRSSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V VSTV+G       ++   +  I G  ++P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNVSTVFGTLGERAQVAMAARKGIPGMAEDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T    WFGGG DL P +E     YD D   FH   K    
Sbjct: 121 VAHMQNPHAPAVHMNTRMFWTPHASWFGGGSDLNPCIE-----YDEDTAHFHAVQKAHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   K W D YFY+PHR  +RG+GGIF D   +    G  +ADF+    +G  F
Sbjct: 176 PHGSDLYPRLKAWADEYFYIPHRHRARGVGGIFMDDHAT----GDWEADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV++     +SE D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVQKRITQDWSEADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|325272503|ref|ZP_08138881.1| coproporphyrinogen III oxidase [Pseudomonas sp. TJI-51]
 gi|324102364|gb|EGB99832.1| coproporphyrinogen III oxidase [Pseudomonas sp. TJI-51]
          Length = 303

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 114/299 (38%), Positives = 154/299 (51%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  +  A           F    W+R+       GGG
Sbjct: 1   MTSRTEAVKAYLLDLQDRICSALENEDGGA----------RFVEDAWVRE-----AGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  GK+ EK  V  S V+G   P              F A G+S+++HPYNPHVP 
Sbjct: 46  RTRVIGEGKLIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCIHWHRVAEQACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCDRYF+L HR E RGIGG+FFD L+      G D  F+FI A+GD ++  Y  
Sbjct: 161 YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----GFDTCFAFIRAIGDAYVDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  H  ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKHTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|254491125|ref|ZP_05104306.1| coproporphyrinogen III oxidase, aerobic [Methylophaga thiooxidans
           DMS010]
 gi|224463638|gb|EEF79906.1| coproporphyrinogen III oxidase, aerobic [Methylophaga thiooxydans
           DMS010]
          Length = 302

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 157/294 (53%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++ +A           F +  W R +      GGGR   L
Sbjct: 7   DAVREYLLTLQDTICNALEAIDGDA----------KFELDEWQRAEG-----GGGRTRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+  V  S V GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  TNGAVFEQGGVNFSEVSGDNMPPSATASRPELAGRSFKAMGVSLVIHPNNPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP   +     + DVI +H+  K+ C     A Y  +K
Sbjct: 112 RFFIAEKEGEEPIWWFGGGYDLTPYYGN-----EDDVIHWHSEAKKACEPFGEAVYPRFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+      G +  F+F+ +VG+ +IK Y  +V++ 
Sbjct: 167 QWCDDYFYLKHRDECRGVGGLFFDDLNEW----GFERCFAFLQSVGNSYIKAYTPIVKKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + ++ EQ+R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 223 MNEVYGEQERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVTW 276


>gi|197285694|ref|YP_002151566.1| coproporphyrinogen III oxidase [Proteus mirabilis HI4320]
 gi|226740887|sp|B4EZS7|HEM6_PROMH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194683181|emb|CAR43816.1| Coproporphyrinogen III oxidase, aerobic [Proteus mirabilis HI4320]
          Length = 302

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 113/292 (38%), Positives = 154/292 (52%), Gaps = 30/292 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             Q  F +LQ  IC   E ++ +A           F   +W R+       GGGR   L 
Sbjct: 8   RVQSFFLSLQDSICHAIENIDQKA----------TFQQDNWQRE-----AGGGGRTRMLT 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G +FE+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R
Sbjct: 53  QGAIFEQAGVNFSHVYGDALPASATAHRPELSGRRFQAMGVSLVIHPLNPYIPTSHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ DVI +H   K +C   +   Y  YK+
Sbjct: 113 FFIAEKEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCDPFSQDYYARYKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +  
Sbjct: 168 WCDDYFYLKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGQGYLDAYLPIVEKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
              + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 224 SIPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 275


>gi|83855080|ref|ZP_00948610.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
 gi|83842923|gb|EAP82090.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
          Length = 297

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
              D E  K  +   F +L+  I   FE LE + A    ++ +P  F V    R      
Sbjct: 1   MTVDFEAEKTRAAEWFRSLRDQIVEAFETLERDHAEGPLSDAAPGTFEVTPTKRSSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V VSTV+G       ++   +  I G  ++P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNVSTVFGTLGERAQVAMAARKGIPGMAEDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N R+  T    WFGGG DL P +E     YD D   FH   K    
Sbjct: 121 VAHMQNPHAPAVHMNTRLFWTPHASWFGGGSDLNPCIE-----YDEDTAHFHAVQKAHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   K W D YFY+PHR  +RG+GGIF D   +    G  +ADF+    +G  F
Sbjct: 176 PHGSDLYPRLKAWADEYFYIPHRHRARGVGGIFMDDHAT----GDWEADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV++     +SE D++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVQKRITQDWSEADKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|218888770|ref|YP_002437634.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa LESB58]
 gi|226740888|sp|B7V0Q9|HEM6_PSEA8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218768993|emb|CAW24751.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas aeruginosa
           LESB58]
          Length = 305

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R        GGGR   +
Sbjct: 6   AAVKTYLLDLQDRICAALEAEDGKA----------RFAEDAWER-----PAGGGGRTRVI 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + EK  V  S V+GD  P              F A G+S+++HP NPHVP  H N+
Sbjct: 51  GDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANV 110

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP      ++++ D + +H   ++ C+      Y  YK
Sbjct: 111 RFFCAEKEGEEPVWWFGGGFDLTPY-----YAHEEDCVHWHRVARDACAPFGADVYPRYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCDRYF+L HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  +V+R 
Sbjct: 166 EWCDRYFHLKHRNEPRGIGGLFFDDLNQW----DFDTCFAFIRAIGDAYIDAYLPIVQRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  F E+ R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 222 KHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|209522928|ref|ZP_03271485.1| Coproporphyrinogen oxidase [Arthrospira maxima CS-328]
 gi|209496515|gb|EDZ96813.1| Coproporphyrinogen oxidase [Arthrospira maxima CS-328]
          Length = 348

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 120/325 (36%), Positives = 153/325 (47%), Gaps = 44/325 (13%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T  +  P   + R     +  + +Q  IC   EKL+            K F    W R  
Sbjct: 10  TATVQSPPPADSR-ERVSQWMKQIQDEICAGLEKLDG----------AKTFVEDAWER-- 56

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
               + GGGR   +  G VFE+  V  S V+G   P              F+ATG S+++
Sbjct: 57  ---PEGGGGRTRVIREGNVFEQGGVNFSEVWGQNLPPSILSQRPEAAGNGFYATGTSMVL 113

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           HP NP+VP VH N R       +WFGGG DLTP        +  D   FH TLKE C +H
Sbjct: 114 HPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHKTLKEACDRH 168

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS---------------------- 221
               Y  +K WCD YF+L HR E+RGIGGIFFD+                          
Sbjct: 169 HSEYYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGQETESEAATYSDRMGA 228

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
           PE    +  FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+
Sbjct: 229 PESRDWEGLFSFIQDCGKSFLPSYGPIVERRNSIEYGDRERNFQLYRRGRYVEFNLVYDR 288

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 289 GTIFGLQTKGRTESILMSLPPLVRW 313


>gi|229587601|ref|YP_002869720.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens SBW25]
 gi|259709756|sp|C3K4I0|HEM6_PSEFS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|229359467|emb|CAY46308.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas fluorescens
           SBW25]
          Length = 310

 Score =  335 bits (859), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 150/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  E +            F    W R        GGG
Sbjct: 1   MTTRTEAVKAYLLDLQDRICSALETFETDT----------RFIEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGSVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGPDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y+ YK WCD YF++ HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YSRYKAWCDTYFHIKHRNEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++EQ RQ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKAMAYTEQQRQFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|332139436|ref|YP_004425174.1| coproporphyrinogen III oxidase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549458|gb|AEA96176.1| coproporphyrinogen III oxidase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 310

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +            F    W R++      GGGR   L
Sbjct: 17  EQVKSYLLGLQDTICQTLELADGK----------GQFVEDSWQREEG-----GGGRSRVL 61

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP+NP++P  H N+
Sbjct: 62  KNGAVIEQGGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYIPTSHANV 121

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP        +  DV+ +H+T K++C       Y  YK
Sbjct: 122 RFFIAEKEGEAPIWWFGGGFDLTPFYP-----FKDDVVHWHDTAKKLCKPFGEDVYPKYK 176

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ AVG+ FI  Y  +V R 
Sbjct: 177 KWCDEYFYLKHRNETRGVGGLFFDDLNEW----GFEQSFAFMQAVGNGFIDAYVPIVERR 232

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 233 KQTDYGERERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|304309711|ref|YP_003809309.1| Oxygen-dependent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
 gi|301795444|emb|CBL43642.1| Oxygen-dependent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
          Length = 334

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC+  E  E          S   F    W RD       GGG    L
Sbjct: 32  EQVKNWLLGLQARICSGLEAEE----------SRGCFIEDRWDRD-----AGGGGCSRVL 76

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFEKA V  S VYG+  P              F A G+S+++HP NP VP  H N+
Sbjct: 77  EGGEVFEKAGVNFSHVYGESLPASATAHRPELAGRSFNAMGVSLVIHPRNPFVPTSHANV 136

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP        ++ D + +H T K  C       Y  YK
Sbjct: 137 RYFVAEKPGAEPVWWFGGGFDLTPYYP-----FEEDCVHWHKTAKAACDPFGAGVYAQYK 191

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L+        +  F+F+ +VGD F+  Y  +V   
Sbjct: 192 KWCDEYFFLKHRNETRGVGGLFFDDLNQW----DFETSFAFMRSVGDHFLPAYQPIVAAR 247

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +++  R+ QL RRGRY EFNL+YD+GT FG +TGG VESIL S+P  V+W
Sbjct: 248 KNTHYTDAQREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRVESILMSLPSQVSW 301


>gi|84500367|ref|ZP_00998616.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
 gi|84391320|gb|EAQ03652.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
          Length = 297

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 119/305 (39%), Positives = 166/305 (54%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKE 68
             +++   +  +   F  L+  I   FE LE+ +A    ++R P  F V    R      
Sbjct: 1   MTEELTAERTRAADWFRGLRDEIVAAFEGLEDAQAEGPLSDREPGRFDVTETRRATPDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V VSTVYG        +   +  + G  ++P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNVSTVYGELGPEAQAAMAARKGLPGMQEDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P +E     YD D   FH  L++ C 
Sbjct: 121 VAHMQNPHCPAVHMNTRMFWTPHGWWFGGGADLNPCIE-----YDEDTAHFHRVLEDHCD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   K W D YFY+PHR  +RG+GGIF D   S    G  +ADF+FI  +G  F
Sbjct: 176 PHGAGQYDRLKAWADEYFYIPHRGRARGVGGIFLDDHCS----GDWEADFAFIRDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +     +S+ D++ QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+P
Sbjct: 232 LPAYLPLVEKRRRSPWSDADKEVQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLP 291

Query: 302 PLVAW 306
           P+  W
Sbjct: 292 PMAKW 296


>gi|308047753|ref|YP_003911319.1| coproporphyrinogen oxidase [Ferrimonas balearica DSM 9799]
 gi|307629943|gb|ADN74245.1| Coproporphyrinogen oxidase [Ferrimonas balearica DSM 9799]
          Length = 304

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ+ IC   E  + EA           F    W R++    +        L
Sbjct: 6   NAVKHYLLSLQNQICEALEGADGEA----------RFQRDQWQREEGGGGE-----SRVL 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP+NPH+P  H N+
Sbjct: 51  RDGAVFEQAGVNFSHVMGAQMPASATAHRPELAGRRFEAMGVSLVIHPHNPHIPTTHANV 110

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP         D D+  +H    ++C+      Y  YK
Sbjct: 111 RFFIAEKDGEDPVWWFGGGFDLTPYYP-----VDEDIRHWHQVAHDLCAPFGDQVYDEYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCDRYF+L HR E+RG+GG+FFD L++     G +  F+ + AVG+ F+  Y  +V R 
Sbjct: 166 AWCDRYFFLKHRDETRGVGGLFFDDLNAP----GFEQSFALMQAVGNGFLDAYLPIVARR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 KDDAYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|170767389|ref|ZP_02901842.1| coproporphyrinogen III oxidase, aerobic [Escherichia albertii
           TW07627]
 gi|170123723|gb|EDS92654.1| coproporphyrinogen III oxidase, aerobic [Escherichia albertii
           TW07627]
          Length = 299

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 116/293 (39%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDSICQQLAAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAIHWHRTARDLCQPFGENVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              +SE++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMTYSERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|312958126|ref|ZP_07772649.1| Coproporphyrinogen-3 oxidase [Pseudomonas fluorescens WH6]
 gi|311287557|gb|EFQ66115.1| Coproporphyrinogen-3 oxidase [Pseudomonas fluorescens WH6]
          Length = 310

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC+  E  E +            FT   W R        GGG
Sbjct: 1   MTTRTEAVKAYLLDLQDRICSALETFETDT----------RFTEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIANGAVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     D D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGN-----DEDCIHWHRVAEQACAPFGPDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF++ HR E RGIGG+FFD L+        D  F+FI A+GD +I  Y  
Sbjct: 161 YARYKAWCDTYFHIKHRNEPRGIGGLFFDDLNEW----DFDTCFAFIRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKATAYTAQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|159030185|emb|CAO91077.1| hemF [Microcystis aeruginosa PCC 7806]
          Length = 340

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 116/326 (35%), Positives = 160/326 (49%), Gaps = 43/326 (13%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            T          + +       ++LQ  IC   E+++ +A           F    W R 
Sbjct: 5   TTTPTLANLPASDSRSRVSEFMKSLQDEICRGLEEVDGKA----------KFIEDSWQR- 53

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + G GR   L  G +FE+A V  S V+G   P    +         F+ATG S++
Sbjct: 54  ----PEGGCGRSRVLREGAIFEQAGVNFSEVWGKELPPSIAKQRPEAAGHQFYATGTSMV 109

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP++P VH N R       +WFGGG DLTP      ++++ D   FH T K++C Q
Sbjct: 110 LHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPY-----YAFEEDASHFHRTFKQVCDQ 164

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------S 220
           H    Y  +K WCD YFYL HRQE+RGIGGIFFD+                        S
Sbjct: 165 HHPEYYPVFKRWCDEYFYLNHRQEARGIGGIFFDYQDGLDPLYRGPFAESDAAIYSEKLS 224

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
             +    +  FSFI+  G  F+  Y  +V++     + +++RQ QL RRGRY EFNL+YD
Sbjct: 225 PQQPRNWEEIFSFINDCGRAFLPAYVPIVQKRRSTEYGDRERQFQLYRRGRYVEFNLVYD 284

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 285 RGTIFGLQTNGRTESILMSLPPLVRW 310


>gi|307822447|ref|ZP_07652679.1| Coproporphyrinogen oxidase [Methylobacter tundripaludum SV96]
 gi|307737013|gb|EFO07858.1| Coproporphyrinogen oxidase [Methylobacter tundripaludum SV96]
          Length = 304

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    NLQ  ICT  E +E EA           F  + W R +      GGGR   L
Sbjct: 7   TQVKNYLLNLQDQICTALESVEPEA----------RFIEELWDRAEG-----GGGRTRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+V E+  V  S V G   P           +  F A G+S+++HP NP+VP  H N+
Sbjct: 52  ADGRVIEQGGVNFSHVSGFKLPPSATAKRPELADRQFQAMGVSLVIHPNNPYVPTSHANV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R ++         +WFGGG DLTP        +  DV+ +H T +  C       Y  YK
Sbjct: 112 RFLIAEKPGEPTIWWFGGGFDLTPFYP-----FKEDVLHWHQTARAACQPFGDDIYPTYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L+      G +  F+F+ +VG+ +I  Y  ++++ 
Sbjct: 167 KWCDEYFFLKHRNETRGVGGLFFDDLNEW----GFEKSFAFMQSVGNHYIDAYLPIIQKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +S+++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 223 KDTPYSDKERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPVAHW 276


>gi|269467897|gb|EEZ79636.1| coproporphyrinogen III oxidase [uncultured SUP05 cluster bacterium]
          Length = 302

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 119/294 (40%), Positives = 162/294 (55%), Gaps = 29/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++    LQS ICT+ E+++ +A           F   +W ++       GGG    L
Sbjct: 3   DQVKKYLLALQSDICTQLEQVDGKAS----------FIKDNWKKEGG----AGGGLTRVL 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V GD  P     +        F A G+S+++HP+NP+ P  H N+
Sbjct: 49  TDGAVFEQAGVNFSLVRGDNMPASATALRPELAGRSFTALGVSLVIHPHNPYAPTSHANV 108

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + +D D I +H T KE C       Y  YK
Sbjct: 109 RFFIAEKEGEDPIWWFGGGFDLTPY-----YGFDEDAILWHQTAKEACDPFGKDVYAKYK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG+GG+FFD L+     GG D  F+F+ +VG+ +IK Y  +V++ 
Sbjct: 164 KWCDDYFYLKHRDEQRGVGGLFFDDLNE----GGFDECFAFMQSVGNGYIKAYRPIVQKR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 220 KDTSYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLVRW 273


>gi|254487459|ref|ZP_05100664.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. GAI101]
 gi|214044328|gb|EEB84966.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. GAI101]
          Length = 297

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 157/305 (51%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
                   K  +   F  L+  I + FE LEN       A+ +P  F V    R      
Sbjct: 1   MTQSFYTEKTRAAAWFRELRDQIVSAFEGLENNHVSGPMADAAPGAFEVTKTTRTSEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STVYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISTVYGTLGERAQHAMAARKGIPGMKDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P +E     Y  D   FH+  K    
Sbjct: 121 VAHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHDQQKAHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H  A Y   K W D YFY+PHR  +RG+GGIF D   +    G  +ADF+    +G  F
Sbjct: 176 PHGDAFYPKLKAWADEYFYIPHRNRARGVGGIFMDDHCT----GDWEADFALTHDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +     ++E D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVEKRKAQDWNEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|304398331|ref|ZP_07380205.1| Coproporphyrinogen oxidase [Pantoea sp. aB]
 gi|304354197|gb|EFM18570.1| Coproporphyrinogen oxidase [Pantoea sp. aB]
          Length = 304

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 150/293 (51%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +     LQ  IC +    +  A           F    W R        GGG+   L 
Sbjct: 6   RVKAFLLALQDEICNQLAAEDGGAQ----------FAEDSWQR-----PGGGGGQSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S+++HP NP+VP  H N+R
Sbjct: 51  NGAVFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSLVIHPKNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D + +H T   +C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDALHWHQTAANICQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       +  FSF+ +VG  FI  Y  +V R  
Sbjct: 166 WCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFEQSFSFMQSVGRGFIDAYRPIVARRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 DHPWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|332559144|ref|ZP_08413466.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
 gi|332276856|gb|EGJ22171.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
          Length = 291

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 171/304 (56%), Gaps = 21/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
             D ++ +K  +   F  L++ I   FE LE+ A   + A+ +P  F V    R+     
Sbjct: 1   MNDAMDGQKARASEWFRELRNRILAAFEGLEDMATGGSPADAAPGRFEVTETSRE----- 55

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
             GGG M+ +  G+VFEK  V VSTV+G              + G  ++P FWA+G+S++
Sbjct: 56  AGGGGLMSVMRGGRVFEKVGVNVSTVHGTLAPRAQQAMAARGVPGMAEDPRFWASGISLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P L+     Y  D   FH TL+  C  
Sbjct: 116 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTKHFHATLRHACEA 170

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF++PHR  +RG+GGIFFD L++    G  +ADF+F  AVG+ F+
Sbjct: 171 HGADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNT----GDWEADFAFTRAVGEAFL 226

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 227 PAFVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 286

Query: 303 LVAW 306
           L  W
Sbjct: 287 LAKW 290


>gi|156972718|ref|YP_001443625.1| coproporphyrinogen III oxidase [Vibrio harveyi ATCC BAA-1116]
 gi|166217821|sp|A7N128|HEM6_VIBHB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|156524312|gb|ABU69398.1| hypothetical protein VIBHAR_00383 [Vibrio harveyi ATCC BAA-1116]
          Length = 305

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 113/297 (38%), Positives = 159/297 (53%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + +A           F    W R+K ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEQEDGKAV----------FVEDAWQREKGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G +FE+  V  S V G+  P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLRDGHIFEQGGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        +D D   +H+T K++C+      Y 
Sbjct: 113 ANVRFFIAEKDGEDPIWWFGGGFDLTPFYP-----FDEDCQSWHDTAKQLCAPFGDEVYP 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     F E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKDIEFGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|290475992|ref|YP_003468888.1| coproporphyrinogen III oxidase [Xenorhabdus bovienii SS-2004]
 gi|289175321|emb|CBJ82124.1| coproporphyrinogen III oxidase [Xenorhabdus bovienii SS-2004]
          Length = 302

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 109/293 (37%), Positives = 156/293 (53%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +  F +LQ  IC + E+L+  ++          F  + W R++      GGGR   L 
Sbjct: 8   QVKNFFLSLQDEICKQLERLDGHSN----------FMEECWQREEG-----GGGRSRVLK 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
           AG VFE+A V  S + G   P              + A G+S+++HP NP++P  H N+R
Sbjct: 53  AGNVFEQAGVNFSHITGASLPPSASAHRPELAGRSYQALGVSLVIHPLNPYIPTSHANVR 112

Query: 140 MI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
                       +WFGGG DLTP      + +  D I +H   K +C       Y  YK+
Sbjct: 113 FFIAEKEGEAPVWWFGGGFDLTPY-----YGFKEDAIHWHTVAKTLCQPFGNNVYPEYKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF++ HR E RGIGG+F+D L++       +  F+F  AVG+ F+  Y  +V R  
Sbjct: 168 WCDDYFFIKHRNEPRGIGGLFYDDLNTP----DFETCFNFTQAVGNGFLAAYLPIVERRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 224 NINWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|163733943|ref|ZP_02141385.1| coproporphyrinogen III oxidase, aerobic [Roseobacter litoralis Och
           149]
 gi|161393054|gb|EDQ17381.1| coproporphyrinogen III oxidase, aerobic [Roseobacter litoralis Och
           149]
          Length = 297

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKE 68
              D +  K  +   F  L+  I   FE+LE + AH   ++    +F V    R      
Sbjct: 1   MTTDFDTEKTRASAWFRELRDQIVAAFEELESDHAHGPLSDGEAAVFDVSETKRQSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STVYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISTVYGTLGTRAQSAMAARKGIPGMKDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH   +E   
Sbjct: 121 VAHMQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHAQQQEKLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   K+W D YFY+PHR  +RG+GGIF D   ++      + DFS    +G  F
Sbjct: 176 PHGTDFYPRLKDWADEYFYIPHRNRARGVGGIFMDDHCTN----DWEQDFSLTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LVR+     ++E D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYVPLVRKRRAQDWTEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|83951018|ref|ZP_00959751.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
 gi|83838917|gb|EAP78213.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
          Length = 296

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 168/304 (55%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKE 68
              D+ E K  +   F  L+  I   FE++E        A++    F ++   R      
Sbjct: 1   MTQDLPEEKSRAAAWFRALRDEIVDAFEEVETRHEDGPRADQPAGRFELRDTKRTAEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V VS V+G LSP  +  +      G  +NP FWA+G+S++
Sbjct: 61  DAGGGLMSVMRNGRVFEKVGVNVSEVHGRLSPAAQKSMAARGVPGIAENPSFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPHVPAVH N RM  T  A+WFGGG DL P LE     YD D   FH+TL+     
Sbjct: 121 AHMQNPHVPAVHMNTRMFWTPGAWWFGGGADLNPCLE-----YDEDTAHFHSTLQSHLDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A Y   K W D YFY+PHR  +RG+GG+F D  +S    G  +ADF+    +G  F+
Sbjct: 176 HDPALYPDLKRWADEYFYIPHRGRARGVGGVFMDDRNS----GDWEADFALTQDIGRAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV R     ++E D++ QL+ RG YAE+NL+YD+GT FG  TG + +++L S+PP
Sbjct: 232 PAYLPLVERRRGQTWTEADKEAQLVHRGLYAEYNLVYDRGTKFGLATGHDPDAVLMSLPP 291

Query: 303 LVAW 306
           L  W
Sbjct: 292 LAKW 295


>gi|293410838|ref|ZP_06654414.1| coproporphyrinogen III oxidase [Escherichia coli B354]
 gi|291471306|gb|EFF13790.1| coproporphyrinogen III oxidase [Escherichia coli B354]
          Length = 299

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|322831812|ref|YP_004211839.1| Coproporphyrinogen oxidase [Rahnella sp. Y9602]
 gi|321167013|gb|ADW72712.1| Coproporphyrinogen oxidase [Rahnella sp. Y9602]
          Length = 316

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC +    +              F+   W+R++      GGG+   L
Sbjct: 9   QQVKTFLLKLQDHICQQLAAADGN----------GQFSEDQWVREEG-----GGGQSRVL 53

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP NP+VP  H N+
Sbjct: 54  THGAVFEQAGVNFSHVAGATLPASATAHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANV 113

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP      + ++ D   +H T +++C       Y  YK
Sbjct: 114 RFFIAEKPGEAPVWWFGGGFDLTPY-----YGFEEDARHWHLTAQQLCQPFGDDVYPKYK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD L+S       D  FSF+ AVG+ F   Y  +V + 
Sbjct: 169 KWCDDYFFIKHRNEARGIGGLFFDDLNSP----DFDTSFSFMQAVGNGFTDAYLPIVEKR 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 225 KALPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 278


>gi|281179507|dbj|BAI55837.1| coproporphyrinogen III oxidase [Escherichia coli SE15]
 gi|330912225|gb|EGH40735.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli AA86]
          Length = 299

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
           + ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   LVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|218439994|ref|YP_002378323.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 7424]
 gi|218172722|gb|ACK71455.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7424]
          Length = 344

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 111/312 (35%), Positives = 150/312 (48%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K    +  + LQ  IC   E+L+  A           F    W R++      GGGR   
Sbjct: 22  KARVSQFMKALQDEICQGLEELDGVAQ----------FREDSWEREEG-----GGGRSRV 66

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G +FE+  V  S V+G   P    +     +   F+ATG S+++HP +P++P VH N
Sbjct: 67  MREGAIFEQGGVNFSEVWGKQLPPSILKQRPEAEGHQFYATGTSMVLHPRSPYIPTVHLN 126

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        Y  D   FH T K  C +H    Y  +K WCD
Sbjct: 127 YRYFEAGPVWWFGGGADLTPYYP-----YAEDASHFHRTFKAACDKHHPEYYPVFKRWCD 181

Query: 197 RYFYLPHRQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFI 234
            YFYL HR E RG+GGIFFD+                        S       +  F+F+
Sbjct: 182 EYFYLKHRGEMRGVGGIFFDYQDGLDPLYRGPDADKPAAIYSNQLSPKNPRTWEELFAFV 241

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
           S  G  F+  Y  + ++     + +++RQ QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 242 SDCGRAFLPAYVPIAQKRKDTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 301

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 302 SILMSLPPLVRW 313


>gi|238783886|ref|ZP_04627904.1| Coproporphyrinogen III oxidase [Yersinia bercovieri ATCC 43970]
 gi|238715273|gb|EEQ07267.1| Coproporphyrinogen III oxidase [Yersinia bercovieri ATCC 43970]
          Length = 308

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 157/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD       + +    +LQ  IC      +  A           F  ++W R++   
Sbjct: 1   MNLPDI-----ALIKTYLLDLQDKICVALAAADGSA----------TFAEENWTREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLINGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D + +H T  ++C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPGEDPVWWFGGGFDLTPF-----YGFEEDAVHWHQTAYQLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+FFD L+S       D+ F F  AVGD F
Sbjct: 156 PFGEQVYPRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSP----DFDSCFRFTQAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LAAYLPIVERRKALSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|300724179|ref|YP_003713496.1| coproporphyrinogen III oxidase [Xenorhabdus nematophila ATCC 19061]
 gi|297630713|emb|CBJ91378.1| coproporphyrinogen III oxidase [Xenorhabdus nematophila ATCC 19061]
          Length = 302

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 155/293 (52%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +  F +LQ  IC + E+++  +           F   +W R++      G GR   L 
Sbjct: 8   QVKNFFLSLQDQICQQLEQIDGHS----------TFIEDYWQREEG-----GNGRSRVLT 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V G   P              + A G+S+++HP NP++P  H N+R
Sbjct: 53  TGHVFEQAGVNFSHVTGASMPVSATDHRPELAGRSYQAMGVSLVIHPLNPYIPTSHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + +  DVI +H   K +C       Y +YK+
Sbjct: 113 FFIAEKEGESPVWWFGGGFDLTPY-----YGFQEDVIHWHTIAKNLCQPFGDDTYPNYKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF++ HR E RG+GG+FFD L++       D  F+F  AVG+ F+  Y  +V +  
Sbjct: 168 WCDDYFFIKHRNEPRGVGGLFFDDLNTP----DFDTCFNFTQAVGNGFLPAYLPIVEKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  + +++RQ QL RR RY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 224 NITWGDRERQFQLYRRSRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|315178579|gb|ADT85493.1| Coproporphyrinogen 3 oxidase, aerobic (Coproporphyrinogen III
           oxidase, aerobic) (Coproporphyrinogenase) (Coprogen
           oxidase) [Vibrio furnissii NCTC 11218]
          Length = 304

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 152/297 (51%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E ++  A           F    W R+  +K   GGGR 
Sbjct: 4   INKEAVKQFLLSLQDSICQQLEAVDGGA----------TFEEDAWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMRNGHVFEQGGVNFSHVAGQQMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        ++ D   +H   K +C+      Y 
Sbjct: 113 ANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FEQDCHEWHRVAKALCAPFGDEVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCDRYFYLPHR+E+RGIGG+FFD L+        +  F +I AVG  + + Y  +V
Sbjct: 168 EHKAWCDRYFYLPHREETRGIGGLFFDDLNQWR----FEQCFDYIKAVGKGYTQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKVTPYGEREREFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|172038114|ref|YP_001804615.1| coproporphyrinogen III oxidase [Cyanothece sp. ATCC 51142]
 gi|171699568|gb|ACB52549.1| coproporphyrinogen III oxidase, aerobic [Cyanothece sp. ATCC 51142]
          Length = 343

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 116/326 (35%), Positives = 158/326 (48%), Gaps = 43/326 (13%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            T         E+ ++   +  + LQ  IC   EK + E            F    W R+
Sbjct: 8   ATTPQQTSLPPEDAQKRVSQFMKTLQDEICQGLEKADGE----------GKFHEDSWQRE 57

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
           +      GGGR   L  G + E+  V  S V+G   P    +     +   F+ATG S++
Sbjct: 58  EG-----GGGRSRVLRDGNLLEQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTSMV 112

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP+VP VH N R       +WFGGGIDLTP        +  D   FH TLKE C +
Sbjct: 113 LHPRNPYVPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FAEDAAQFHRTLKETCDK 167

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------S 220
           H    Y  +K WCD YFYL HRQE+RG+GGIFFD+                         
Sbjct: 168 HHREYYPVFKHWCDEYFYLKHRQETRGVGGIFFDYQDGTDPLYRGPHADKAAAKYSNQLP 227

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
             +    +  F+F++  G  F+  Y  +V +  +  + +++RQ QL RRGRY EFNL+YD
Sbjct: 228 PQDNRSWEDLFAFVNDCGRTFLPAYLPIVEKRRNTEYGDRERQFQLYRRGRYVEFNLVYD 287

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 288 RGTIFGLQTNGRTESILMSLPPLVRW 313


>gi|269962636|ref|ZP_06176981.1| coproporphyrinogen III oxidase, aerobic [Vibrio harveyi 1DA3]
 gi|269832559|gb|EEZ86673.1| coproporphyrinogen III oxidase, aerobic [Vibrio harveyi 1DA3]
          Length = 305

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 112/297 (37%), Positives = 159/297 (53%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + +A           F    W R+K ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEQEDGKAV----------FVEDAWQREKGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G +FE+  V  S V G+  P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLRDGHIFEQGGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K++C+      Y 
Sbjct: 113 ANVRFFIAEKDGEDPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKQLCAPFGEDVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     F E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKDIEFGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|84393449|ref|ZP_00992206.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
 gi|84375965|gb|EAP92855.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
          Length = 305

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 112/297 (37%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ +  A          +F    W R+  ++   GGGR 
Sbjct: 4   IDKEAVKQFLLSLQDSICQQLEQADGTA----------LFEEDAWEREPGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H
Sbjct: 53  RVMTNGAVFEQGGVNFSHVAGKAMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        +D D   +H T K++C+      Y 
Sbjct: 113 ANVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FDEDCQSWHQTAKDLCAPFGDDVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KEWCD+YFYLPHR E+RG+GG+FFD L+      G D  F+++ AVG+ F   Y  +V
Sbjct: 168 EHKEWCDKYFYLPHRDETRGVGGLFFDDLNEW----GFDKSFAYMQAVGEGFAAAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  Q  RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETSYGERERDFQFYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|83642947|ref|YP_431382.1| coproporphyrinogen III oxidase [Hahella chejuensis KCTC 2396]
 gi|83630990|gb|ABC26957.1| Coproporphyrinogen III oxidase [Hahella chejuensis KCTC 2396]
          Length = 301

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 151/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++++    +     LQ  IC     ++              F    W R++      GGG
Sbjct: 1   MQQQITQVKDYLLGLQDEICNGLAVIDGGDG----------FVEDAWSREEG-----GGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFEKA V  S V G   P              F A G+S++VHP NP+ P 
Sbjct: 46  RTRVLSEGGVFEKAGVNFSHVSGARLPASASAARPELAGRSFQAMGVSLVVHPRNPYTPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  V         +WFGGG DLTP      + +D D   +H T  + C       
Sbjct: 106 SHANVRFFVAEKEGEDPVWWFGGGYDLTPY-----YGFDEDCAHWHRTAAQACEPFGAEI 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HR E+RG+GG+FFD L++     G +  F F+ AVG+ ++  Y  
Sbjct: 161 YPKYKKWCDDYFYLKHRDEARGVGGLFFDDLNAW----GFERSFEFMRAVGNSYLPAYSP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 217 IVERRKDMTYGERERSFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 275


>gi|331648098|ref|ZP_08349188.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M605]
 gi|331042958|gb|EGI15098.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M605]
          Length = 300

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
           + ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 8   LVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 51

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 52  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 111

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 112 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 166

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 167 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 222

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|332991535|gb|AEF01590.1| coproporphyrinogen III oxidase [Alteromonas sp. SN2]
          Length = 314

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 153/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +            F    W+R++      GGGR   +
Sbjct: 21  EQVKAYLLSLQDNICQTLELADGK----------GQFKEDSWVREEG-----GGGRSRVI 65

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP+NP++P  H N+
Sbjct: 66  KNGAVIEQGGVNFSHVFGSQMPASATAHRPELAGRNFQAMGVSLVIHPHNPYIPTSHANV 125

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP        +  DV+ +HNT K++C+      Y  YK
Sbjct: 126 RFFIAEKEGEAPIWWFGGGFDLTPFYP-----FKDDVVHWHNTAKKLCAPFGEDVYGKYK 180

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L+      G +  F+F+ AVG+ F+  Y  +V + 
Sbjct: 181 KWCDDYFFLKHRNETRGVGGLFFDDLNDW----GFETSFNFMQAVGNGFVDAYVPIVEKR 236

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 237 KSTSYGERERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 290


>gi|239993916|ref|ZP_04714440.1| coproporphyrinogen III oxidase [Alteromonas macleodii ATCC 27126]
          Length = 310

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +            F    W R++      GGGR   L
Sbjct: 17  EQVKSYLLGLQDTICQTLELADGK----------GQFVEDSWQREEG-----GGGRSRVL 61

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP+NP++P  H N+
Sbjct: 62  KNGAVIEQGGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYIPTSHANV 121

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R         T  +WFGGG DLTP        +  DV+ +H+T K++C       Y  YK
Sbjct: 122 RFFIAEKEGETPIWWFGGGFDLTPFYP-----FKDDVLHWHDTAKKLCKPFGDDVYPKYK 176

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ AVG+ FI  Y  +V R 
Sbjct: 177 KWCDDYFYLKHRNETRGVGGLFFDDLNEW----GFEQSFAFMQAVGNGFIDAYVPIVERR 232

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 233 KQTDFGERERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|77456250|ref|YP_345755.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf0-1]
 gi|123606492|sp|Q3KKE0|HEM6_PSEPF RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|77380253|gb|ABA71766.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas fluorescens
           Pf0-1]
          Length = 304

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 108/299 (36%), Positives = 147/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC   E  +              F    W R        GGG
Sbjct: 1   MTTRTDAVKAYLLDLQDRICAALETEDG----------GTRFVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +     + D I +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGN-----EEDCIHWHRVAEKACAPFGPDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF++ HR E RGIGG+FFD L+        D  F+F+ A+GD +I  Y  
Sbjct: 161 YPRYKAWCDTYFHIKHRHEPRGIGGLFFDDLNEW----DFDTSFAFMRAIGDAYIDAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R  +  F+ + R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKNDAFTARQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|308187708|ref|YP_003931839.1| Coproporphyrinogen III oxidase [Pantoea vagans C9-1]
 gi|308058218|gb|ADO10390.1| Coproporphyrinogen III oxidase [Pantoea vagans C9-1]
          Length = 304

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 150/293 (51%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +     LQ  IC +    +  A           F    W R        GGG+   L 
Sbjct: 6   RVKAFLLALQDEICNQLAAEDGGAQ----------FAEDSWQR-----PGGGGGQSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S+++HP NP+VP  H N+R
Sbjct: 51  NGTVFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSLVIHPNNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D + +H T   +C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDALHWHQTAASLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       +  FSF+ AVG  F+  Y  +V R  
Sbjct: 166 WCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFEQSFSFMQAVGRGFMDAYRPIVSRRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 DHPWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|163803307|ref|ZP_02197185.1| coproporphyrinogen III oxidase [Vibrio sp. AND4]
 gi|159172877|gb|EDP57716.1| coproporphyrinogen III oxidase [Vibrio sp. AND4]
          Length = 305

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 110/297 (37%), Positives = 158/297 (53%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E  + +A           F    W R+K ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEHEDGQAV----------FVEDAWQREKGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G +FE+  V  S V G+  P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLSDGHIFEQGGVNFSHVEGNEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K++C+      Y 
Sbjct: 113 ANVRFFIAEKDGEDPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKQLCAPFGDEVYP 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNQWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + +++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKDIEYGDREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|77464255|ref|YP_353759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides 2.4.1]
 gi|77388673|gb|ABA79858.1| coproporphyrinogen III oxidase, aerobic [Rhodobacter sphaeroides
           2.4.1]
          Length = 291

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 170/304 (55%), Gaps = 21/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
             D ++ +K  +   F  L++ I   FE LE+ A   + A+ +P  F +    R+     
Sbjct: 1   MNDAMDGQKARASEWFRELRNRILAAFEGLEDAATGGSPADAAPGRFEMTETSRE----- 55

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
             GGG M+ +  G+VFEK  V VSTV+G              + G  ++P FWA+G+S++
Sbjct: 56  AGGGGLMSVMRGGRVFEKVGVNVSTVHGTLASRAQQAMAARGVPGMAEDPRFWASGISLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P L+     Y  D   FH TL+  C  
Sbjct: 116 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----YPEDTKHFHATLRHACEA 170

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF++PHR  +RG+GGIFFD L++       +ADF+F  AVG+ F+
Sbjct: 171 HGADYYPRFKAWADEYFFIPHRGRARGVGGIFFDDLNTD----DWEADFAFTRAVGEAFL 226

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 227 PAFVPLVERRMETPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 286

Query: 303 LVAW 306
           L  W
Sbjct: 287 LAKW 290


>gi|218246003|ref|YP_002371374.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 8801]
 gi|257059054|ref|YP_003136942.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 8802]
 gi|218166481|gb|ACK65218.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 8801]
 gi|256589220|gb|ACV00107.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 8802]
          Length = 346

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 116/327 (35%), Positives = 163/327 (49%), Gaps = 45/327 (13%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           L + ++  P   ++ ++   +  ++LQ  IC   E+L+ ++           F    W R
Sbjct: 9   LTSPKVSLPP--QDAQKRVSQFMKDLQDEICANLEELDGKS----------KFREDSWQR 56

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
           ++      GGGR   L  G V E+  V  S V+G   P    +         F+ATG S+
Sbjct: 57  EEG-----GGGRSRVLRDGGVLEQGGVNFSEVWGKELPPSILKQRPEAAGHGFYATGTSM 111

Query: 123 IVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           ++HP NP++P VH N R       +WFGGGIDLTP        +  D   FH TLK+ C 
Sbjct: 112 VLHPRNPYIPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FAEDAAHFHRTLKDTCD 166

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH---------------------- 219
           QH    Y+ +K WCD YFYL HRQE RG+GGIFFD+                        
Sbjct: 167 QHHPEYYSVFKPWCDEYFYLNHRQEMRGVGGIFFDYQDGVDPLYRGPHPDKAAAIYSNEL 226

Query: 220 SSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
              E    +  F+F++  G  FI  Y  +  +  +  + +++RQ QL RRGRY EFNL+Y
Sbjct: 227 PPLEPRNWEDLFAFVNDCGRAFIPAYIPIAEKRRNTEYGDRERQFQLYRRGRYVEFNLVY 286

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 287 DRGTIFGLQTNGRTESILMSLPPLVRW 313


>gi|323967870|gb|EGB63282.1| coproporphyrinogen III oxidase [Escherichia coli M863]
 gi|327252091|gb|EGE63763.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli STEC_7v]
          Length = 299

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGHGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMEYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|110806377|ref|YP_689897.1| coproporphyrinogen III oxidase [Shigella flexneri 5 str. 8401]
 gi|123146843|sp|Q0T273|HEM6_SHIF8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110615925|gb|ABF04592.1| coproporphyrinogen III oxidase [Shigella flexneri 5 str. 8401]
 gi|281601851|gb|ADA74835.1| Coproporphyrinogen III oxidase, aerobic [Shigella flexneri 2002017]
 gi|313650893|gb|EFS15293.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri 2a str.
           2457T]
 gi|332755479|gb|EGJ85843.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-671]
 gi|332756295|gb|EGJ86646.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri 2747-71]
 gi|332766245|gb|EGJ96455.1| coproporphyrinogen III oxidase family protein [Shigella flexneri
           2930-71]
 gi|333001767|gb|EGK21333.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-218]
 gi|333016383|gb|EGK35714.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-304]
          Length = 299

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|110642617|ref|YP_670347.1| coproporphyrinogen III oxidase [Escherichia coli 536]
 gi|117624641|ref|YP_853554.1| coproporphyrinogen III oxidase [Escherichia coli APEC O1]
 gi|191172900|ref|ZP_03034435.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli F11]
 gi|215487689|ref|YP_002330120.1| coproporphyrinogen III oxidase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218559381|ref|YP_002392294.1| coproporphyrinogen III oxidase [Escherichia coli S88]
 gi|218690571|ref|YP_002398783.1| coproporphyrinogen III oxidase [Escherichia coli ED1a]
 gi|227887481|ref|ZP_04005286.1| coproporphyrinogen III oxidase [Escherichia coli 83972]
 gi|300981733|ref|ZP_07175697.1| coproporphyrinogen III oxidase [Escherichia coli MS 45-1]
 gi|300997839|ref|ZP_07181865.1| coproporphyrinogen III oxidase [Escherichia coli MS 200-1]
 gi|301046325|ref|ZP_07193488.1| coproporphyrinogen III oxidase [Escherichia coli MS 185-1]
 gi|312967723|ref|ZP_07781938.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 2362-75]
 gi|331658591|ref|ZP_08359535.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA206]
 gi|331684093|ref|ZP_08384689.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H299]
 gi|31563153|sp|Q8FFA3|HEM6_ECOL6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123147846|sp|Q0TF33|HEM6_ECOL5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217799|sp|A1ADV0|HEM6_ECOK1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740875|sp|B7MHT7|HEM6_ECO45 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800268|sp|B7UGD5|HEM6_ECO27 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800270|sp|B7MY86|HEM6_ECO81 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110344209|gb|ABG70446.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 536]
 gi|115513765|gb|ABJ01840.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli APEC O1]
 gi|190906764|gb|EDV66368.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli F11]
 gi|215265761|emb|CAS10168.1| coproporphyrinogen III oxidase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218366150|emb|CAR03895.1| coproporphyrinogen III oxidase [Escherichia coli S88]
 gi|218428135|emb|CAR09052.2| coproporphyrinogen III oxidase [Escherichia coli ED1a]
 gi|222034164|emb|CAP76905.1| Coproporphyrinogen 3 oxidase, aerobic [Escherichia coli LF82]
 gi|227835831|gb|EEJ46297.1| coproporphyrinogen III oxidase [Escherichia coli 83972]
 gi|294491890|gb|ADE90646.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli IHE3034]
 gi|300301695|gb|EFJ58080.1| coproporphyrinogen III oxidase [Escherichia coli MS 185-1]
 gi|300304124|gb|EFJ58644.1| coproporphyrinogen III oxidase [Escherichia coli MS 200-1]
 gi|300408918|gb|EFJ92456.1| coproporphyrinogen III oxidase [Escherichia coli MS 45-1]
 gi|307554475|gb|ADN47250.1| coproporphyrinogen III oxidase [Escherichia coli ABU 83972]
 gi|312287920|gb|EFR15825.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 2362-75]
 gi|320196281|gb|EFW70905.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli
           WV_060327]
 gi|323188256|gb|EFZ73549.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli RN587/1]
 gi|323949523|gb|EGB45411.1| coproporphyrinogen III oxidase [Escherichia coli H252]
 gi|323955692|gb|EGB51450.1| coproporphyrinogen III oxidase [Escherichia coli H263]
 gi|324011161|gb|EGB80380.1| coproporphyrinogen III oxidase [Escherichia coli MS 60-1]
 gi|331054256|gb|EGI26283.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA206]
 gi|331079045|gb|EGI50247.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H299]
          Length = 299

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|218700902|ref|YP_002408531.1| coproporphyrinogen III oxidase [Escherichia coli IAI39]
 gi|226740877|sp|B7NPX2|HEM6_ECO7I RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218370888|emb|CAR18705.1| coproporphyrinogen III oxidase [Escherichia coli IAI39]
          Length = 299

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 115/293 (39%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
           + ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   LVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|254464105|ref|ZP_05077516.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           Y4I]
 gi|206685013|gb|EDZ45495.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           Y4I]
          Length = 297

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 120/305 (39%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHE-NSANRSPKIFTVKHWLRDKSQKE 68
              ++ E K  +   F  L+  I   FE LE+   E   A  +P  F V    R      
Sbjct: 1   MTAEMIEEKARAAAWFRQLRDQIVAAFEGLEDSHSEGPFAEMAPGRFEVTQTKRSSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +S VYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISEVYGTLGDRAQAAMAARKGIPGMKDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPHVPAVH N RM  T   +WFGGG DL P +E     Y+ D   FH T K+   
Sbjct: 121 VAHMRNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YEEDTAHFHATQKQHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   K W D YFY+PHR+ +RG+GGIF D  +S    G   ADF+    +G  F
Sbjct: 176 PHGPDQYPRLKAWADEYFYIPHRKRARGVGGIFMDDQNS----GDWAADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  +  LV +     +SE D++ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAFVPLVEKRRVQDYSEADKEAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|260845076|ref|YP_003222854.1| coproporphyrinogen III oxidase [Escherichia coli O103:H2 str.
           12009]
 gi|257760223|dbj|BAI31720.1| coproporphyrinogen III oxidase [Escherichia coli O103:H2 str.
           12009]
          Length = 299

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKLGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|90581184|ref|ZP_01236983.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
 gi|90437705|gb|EAS62897.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
          Length = 302

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/300 (38%), Positives = 158/300 (52%), Gaps = 30/300 (10%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D +  K   +    +LQ  IC   E+ E          +   F    W R++        
Sbjct: 2   DSQVDKSAVKAFLLDLQDRICQALEQQE----------TTVAFEQDQWQREEGGGGS--- 48

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
                L  G++FE+A V  S VYG   P              F A G+S+++HP NP+VP
Sbjct: 49  --SRVLRGGEIFEQAGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVP 106

Query: 133 AVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R            +WFGGG DLTP        +D D   +H+T K++C+     
Sbjct: 107 TSHANVRFFIAEKDGEAPVWWFGGGFDLTPFYP-----FDEDCQHWHDTAKQLCAPFGDD 161

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  +K WCD+YF+LPHR E+RG+GG+FFD L+      G D  FS++ AVG+ FI  Y 
Sbjct: 162 VYQEHKAWCDKYFFLPHRNETRGVGGLFFDDLNQW----GFDKSFSYMQAVGNGFINAYM 217

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +V++ YH  + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 218 PIVQQRYHLPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 277


>gi|331673903|ref|ZP_08374666.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA280]
 gi|331069176|gb|EGI40568.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA280]
          Length = 300

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 8   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 51

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 52  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 111

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 112 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 166

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 167 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 222

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|110678607|ref|YP_681614.1| coproporphyrinogen III oxidase [Roseobacter denitrificans OCh 114]
 gi|109454723|gb|ABG30928.1| coproporphyrinogen III oxidase, aerobic [Roseobacter denitrificans
           OCh 114]
          Length = 297

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
              D +  K  +   F +L+  I   FE+LE + A    ++    +F V    R      
Sbjct: 1   MTTDYDTEKTRASAWFRDLRDQIVAAFEELERDHATGPLSDGEAAVFDVSETKRQSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STVYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISTVYGTLGTRAQSAMAARKGIPGMKDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH   +E   
Sbjct: 121 VAHMQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHAQQQEKLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   KEW D YFY+PHR  +RG+GGIF D   ++      + DF+    +G  F
Sbjct: 176 PHGAELYPRLKEWADEYFYIPHRNRARGVGGIFMDDHCTN----DWERDFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LVR+     +++ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYVPLVRKRRTQDWTDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|26248812|ref|NP_754852.1| coproporphyrinogen III oxidase [Escherichia coli CFT073]
 gi|91211774|ref|YP_541760.1| coproporphyrinogen III oxidase [Escherichia coli UTI89]
 gi|237704959|ref|ZP_04535440.1| coproporphyrinogen III oxidase [Escherichia sp. 3_2_53FAA]
 gi|26109218|gb|AAN81420.1|AE016764_102 Coproporphyrinogen III oxidase, aerobic [Escherichia coli CFT073]
 gi|91073348|gb|ABE08229.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli UTI89]
 gi|226901325|gb|EEH87584.1| coproporphyrinogen III oxidase [Escherichia sp. 3_2_53FAA]
 gi|307625993|gb|ADN70297.1| coproporphyrinogen III oxidase [Escherichia coli UM146]
 gi|312947029|gb|ADR27856.1| coproporphyrinogen III oxidase [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 300

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 8   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 51

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 52  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 111

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 112 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 166

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 167 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 222

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|316935314|ref|YP_004110296.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris DX-1]
 gi|315603028|gb|ADU45563.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris DX-1]
          Length = 304

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 127/306 (41%), Positives = 172/306 (56%), Gaps = 9/306 (2%)

Query: 2   NLCTIEIGCPDD-IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           +L        D+ +E R+  ++  FE L+  IC E E LE EA        P  FT K W
Sbjct: 6   DLDRSPAASTDNPVEARRAQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPW 65

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R       +GG     L  G++FEK  +  S+  G L+P+    + G   +  + +T +
Sbjct: 66  QRKTGAGGGVGGF----LSNGRLFEKIGIHTSSANGRLTPEMAKNLPGDGVSLDYVSTSI 121

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I+HP +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C
Sbjct: 122 SLIMHPRSPRVPTVHMNTRFLSTSKGWFGGGADLTPMLPEQRSQDAEDAVIFHAAMKAAC 181

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H    Y  +K W D YF+LPHR  +RG+GGIF+DHL S    G  D DF+F   VG  
Sbjct: 182 DAHDPNYYAKFKPWADTYFFLPHRGTARGVGGIFYDHLDS----GDFDRDFAFTRDVGSA 237

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            + +YP +VR+     ++EQ+R +QL  RG Y EFNLLYDKGT FG +TGGN E+I++SM
Sbjct: 238 LLDIYPKIVRKRMVEPWTEQERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNTETIMSSM 297

Query: 301 PPLVAW 306
           PPLV+W
Sbjct: 298 PPLVSW 303


>gi|324112950|gb|EGC06926.1| coproporphyrinogen III oxidase [Escherichia fergusonii B253]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEALPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMEYGEHERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|226327998|ref|ZP_03803516.1| hypothetical protein PROPEN_01889 [Proteus penneri ATCC 35198]
 gi|225203702|gb|EEG86056.1| hypothetical protein PROPEN_01889 [Proteus penneri ATCC 35198]
          Length = 302

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 153/292 (52%), Gaps = 30/292 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +  F +LQ  IC   E ++ +            F    W R +      GGGR   L 
Sbjct: 8   RVKEFFLSLQDTICHSLENIDQK----------GTFQQDTWERKEG-----GGGRTRVLT 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G +FE+A V  S VYGD  P              F A G+S+++HP NP++P  H N+R
Sbjct: 53  NGALFEQAGVNFSHVYGDTLPKSATAHRPELAGRRFQAMGVSLVIHPINPYIPTSHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ DVI +H   K +C+  +   Y  YK+
Sbjct: 113 FFIAEKEGEDPVWWFGGGFDLTPY-----YGFEEDVIHWHKVAKSVCTPFSEDYYPRYKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFY+ HR E RG+GG+FFD L++       D  F F+  VG  ++  Y  +V +  
Sbjct: 168 WCDDYFYIKHRNEPRGVGGLFFDDLNTP----DFDHCFEFVQHVGLGYLDAYLPIVEKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
              + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 224 SMHWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 275


>gi|218548124|ref|YP_002381915.1| coproporphyrinogen III oxidase [Escherichia fergusonii ATCC 35469]
 gi|226740884|sp|B7LKJ9|HEM6_ESCF3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218355665|emb|CAQ88277.1| coproporphyrinogen III oxidase [Escherichia fergusonii ATCC 35469]
 gi|325496510|gb|EGC94369.1| coproporphyrinogen III oxidase [Escherichia fergusonii ECD227]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMEYGEHERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|324009601|gb|EGB78820.1| coproporphyrinogen III oxidase [Escherichia coli MS 57-2]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|323977383|gb|EGB72469.1| coproporphyrinogen III oxidase [Escherichia coli TW10509]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMEYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|16329455|ref|NP_440183.1| coproporphyrinogen III oxidase [Synechocystis sp. PCC 6803]
 gi|2493811|sp|P72848|HEM6_SYNY3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|1651937|dbj|BAA16863.1| coproporphyrinogen III oxidase [Synechocystis sp. PCC 6803]
          Length = 340

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 115/312 (36%), Positives = 150/312 (48%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K+   +  + LQ  IC   E L+ +            F    W R++      GGGR   
Sbjct: 21  KQRVSQFMQTLQDEICQGLEALDGK----------GKFQEDSWQREEG-----GGGRSRV 65

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G   E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P VH N
Sbjct: 66  LADGDFLEQGGVNFSEVWGKSLPPSILKQRPEAEGHEFYATGTSMVLHPKNPYIPTVHLN 125

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH+TLK  C Q     Y  +K WCD
Sbjct: 126 YRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHHTLKNACDQTHGEFYPVFKRWCD 180

Query: 197 RYFYLPHRQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFI 234
            YFYL HRQE RGIGGIFFD+                        +  E  G +  FSF 
Sbjct: 181 EYFYLKHRQEMRGIGGIFFDYQDGNAPLYRGPDPNGPAAQYSNQLAPIEPLGWEDLFSFA 240

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
              G  F+  Y  +V +  +  + ++ RQ QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 241 QRCGRAFLPAYSPIVEKRRNTEYGDRQRQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 300

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 301 SILMSLPPLVRW 312


>gi|24113777|ref|NP_708287.1| coproporphyrinogen III oxidase [Shigella flexneri 2a str. 301]
 gi|62510627|sp|Q83QN1|HEM6_SHIFL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|24052858|gb|AAN43994.1| coproporphyrinogen III oxidase [Shigella flexneri 2a str. 301]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|170751060|ref|YP_001757320.1| coproporphyrinogen III oxidase [Methylobacterium radiotolerans JCM
           2831]
 gi|170657582|gb|ACB26637.1| Coproporphyrinogen oxidase [Methylobacterium radiotolerans JCM
           2831]
          Length = 310

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 145/302 (48%), Positives = 182/302 (60%), Gaps = 9/302 (2%)

Query: 9   GCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN---SANRSPKIFTVKHWLRDKS 65
               D+   K  +   FE L+  I    E LE EA       A  +P  F    W R   
Sbjct: 15  PSEADVTAMKSEAAAWFETLRDRIVAALETLEAEAAGPFHPDAPEAPGTFEKTPWNRTDH 74

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG MA L  G+VFEKA V +STV+G+ +P+F+ Q+ G  ++P F+ATG+S+I H
Sbjct: 75  TGRPGGGGVMAMLR-GRVFEKAGVHISTVHGEFAPEFRAQMPGAAEDPRFFATGISLIAH 133

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P+NPHVP VH N R + T   WFGGG DLTP L+ RR   DPD   FH  L+  C+ H +
Sbjct: 134 PWNPHVPTVHMNTRFVATTRAWFGGGADLTPVLDRRRTQEDPDSRHFHACLERACAAHGI 193

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             +  YK WCD YF+L HR E RGIGGIF+D+L S    G   AD ++   VG  F++ Y
Sbjct: 194 D-HARYKAWCDEYFHLKHRNEPRGIGGIFYDYLWS----GTPQADLAYTRDVGRAFLEAY 248

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P +VR N    ++E DR EQ +RRGRY EFNLLYD+GT FG KTGGNV SIL+SMPP V 
Sbjct: 249 PKIVRDNLGTPWTEADRHEQQVRRGRYVEFNLLYDRGTIFGLKTGGNVASILSSMPPTVR 308

Query: 306 WP 307
           WP
Sbjct: 309 WP 310


>gi|74312971|ref|YP_311390.1| coproporphyrinogen III oxidase [Shigella sonnei Ss046]
 gi|82544895|ref|YP_408842.1| coproporphyrinogen III oxidase [Shigella boydii Sb227]
 gi|157156271|ref|YP_001463765.1| coproporphyrinogen III oxidase [Escherichia coli E24377A]
 gi|191168977|ref|ZP_03030744.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B7A]
 gi|193064771|ref|ZP_03045849.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E22]
 gi|193068400|ref|ZP_03049363.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|193071214|ref|ZP_03052136.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|194427271|ref|ZP_03059821.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B171]
 gi|194432098|ref|ZP_03064387.1| coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae 1012]
 gi|218554968|ref|YP_002387881.1| coproporphyrinogen III oxidase [Escherichia coli IAI1]
 gi|256017414|ref|ZP_05431279.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|260856537|ref|YP_003230428.1| coproporphyrinogen III oxidase [Escherichia coli O26:H11 str.
           11368]
 gi|260869132|ref|YP_003235534.1| coproporphyrinogen III oxidase [Escherichia coli O111:H- str.
           11128]
 gi|293446797|ref|ZP_06663219.1| coproporphyrinogen III oxidase [Escherichia coli B088]
 gi|300817325|ref|ZP_07097542.1| coproporphyrinogen III oxidase [Escherichia coli MS 107-1]
 gi|300820896|ref|ZP_07101046.1| coproporphyrinogen III oxidase [Escherichia coli MS 119-7]
 gi|300903449|ref|ZP_07121374.1| coproporphyrinogen III oxidase [Escherichia coli MS 84-1]
 gi|300922145|ref|ZP_07138282.1| coproporphyrinogen III oxidase [Escherichia coli MS 182-1]
 gi|301306343|ref|ZP_07212413.1| coproporphyrinogen III oxidase [Escherichia coli MS 124-1]
 gi|301328940|ref|ZP_07221971.1| coproporphyrinogen III oxidase [Escherichia coli MS 78-1]
 gi|307312565|ref|ZP_07592198.1| Coproporphyrinogen oxidase [Escherichia coli W]
 gi|309794518|ref|ZP_07688941.1| coproporphyrinogen III oxidase [Escherichia coli MS 145-7]
 gi|331669178|ref|ZP_08370026.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA271]
 gi|331678424|ref|ZP_08379099.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H591]
 gi|332278413|ref|ZP_08390826.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|123559053|sp|Q31Y44|HEM6_SHIBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123616573|sp|Q3YZA7|HEM6_SHISS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167008821|sp|A7ZPN6|HEM6_ECO24 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740878|sp|B7M6U5|HEM6_ECO8A RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|73856448|gb|AAZ89155.1| coproporphyrinogen III oxidase [Shigella sonnei Ss046]
 gi|81246306|gb|ABB67014.1| coproporphyrinogen III oxidase [Shigella boydii Sb227]
 gi|157078301|gb|ABV18009.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E24377A]
 gi|190900984|gb|EDV60766.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B7A]
 gi|192927654|gb|EDV82270.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E22]
 gi|192955485|gb|EDV85966.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|192958352|gb|EDV88792.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli E110019]
 gi|194414592|gb|EDX30864.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli B171]
 gi|194419627|gb|EDX35707.1| coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae 1012]
 gi|218361736|emb|CAQ99333.1| coproporphyrinogen III oxidase [Escherichia coli IAI1]
 gi|257755186|dbj|BAI26688.1| coproporphyrinogen III oxidase [Escherichia coli O26:H11 str.
           11368]
 gi|257765488|dbj|BAI36983.1| coproporphyrinogen III oxidase [Escherichia coli O111:H- str.
           11128]
 gi|291323627|gb|EFE63055.1| coproporphyrinogen III oxidase [Escherichia coli B088]
 gi|300404481|gb|EFJ88019.1| coproporphyrinogen III oxidase [Escherichia coli MS 84-1]
 gi|300421460|gb|EFK04771.1| coproporphyrinogen III oxidase [Escherichia coli MS 182-1]
 gi|300526649|gb|EFK47718.1| coproporphyrinogen III oxidase [Escherichia coli MS 119-7]
 gi|300529951|gb|EFK51013.1| coproporphyrinogen III oxidase [Escherichia coli MS 107-1]
 gi|300838398|gb|EFK66158.1| coproporphyrinogen III oxidase [Escherichia coli MS 124-1]
 gi|300844682|gb|EFK72442.1| coproporphyrinogen III oxidase [Escherichia coli MS 78-1]
 gi|306907488|gb|EFN37992.1| Coproporphyrinogen oxidase [Escherichia coli W]
 gi|308121974|gb|EFO59236.1| coproporphyrinogen III oxidase [Escherichia coli MS 145-7]
 gi|315061760|gb|ADT76087.1| coproporphyrinogen III oxidase [Escherichia coli W]
 gi|315256455|gb|EFU36423.1| coproporphyrinogen III oxidase [Escherichia coli MS 85-1]
 gi|320173836|gb|EFW49016.1| Coproporphyrinogen III oxidase, aerobic [Shigella dysenteriae CDC
           74-1112]
 gi|323156342|gb|EFZ42500.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli EPECa14]
 gi|323159414|gb|EFZ45398.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli E128010]
 gi|323170301|gb|EFZ55954.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli LT-68]
 gi|323177438|gb|EFZ63026.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1180]
 gi|323184260|gb|EFZ69636.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1357]
 gi|323377659|gb|ADX49927.1| Coproporphyrinogen oxidase [Escherichia coli KO11]
 gi|323944659|gb|EGB40726.1| coproporphyrinogen III oxidase [Escherichia coli H120]
 gi|324118100|gb|EGC11998.1| coproporphyrinogen III oxidase [Escherichia coli E1167]
 gi|331064372|gb|EGI36283.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA271]
 gi|331074884|gb|EGI46204.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H591]
 gi|332093022|gb|EGI98088.1| coproporphyrinogen 3 oxidase, aerobic [Shigella boydii 3594-74]
 gi|332100765|gb|EGJ04111.1| coproporphyrinogen III oxidase [Shigella sp. D9]
 gi|332344263|gb|AEE57597.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli UMNK88]
 gi|333002234|gb|EGK21798.1| coproporphyrinogen 3 oxidase, aerobic [Shigella flexneri K-272]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|218705943|ref|YP_002413462.1| coproporphyrinogen III oxidase [Escherichia coli UMN026]
 gi|293405879|ref|ZP_06649871.1| coproporphyrinogen III oxidase [Escherichia coli FVEC1412]
 gi|298381628|ref|ZP_06991227.1| coproporphyrinogen-III oxidase [Escherichia coli FVEC1302]
 gi|226740880|sp|B7N626|HEM6_ECOLU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218433040|emb|CAR13935.1| coproporphyrinogen III oxidase [Escherichia coli UMN026]
 gi|291428087|gb|EFF01114.1| coproporphyrinogen III oxidase [Escherichia coli FVEC1412]
 gi|298279070|gb|EFI20584.1| coproporphyrinogen-III oxidase [Escherichia coli FVEC1302]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGISLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|194437711|ref|ZP_03069807.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 101-1]
 gi|253772665|ref|YP_003035496.1| coproporphyrinogen III oxidase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162419|ref|YP_003045527.1| coproporphyrinogen III oxidase [Escherichia coli B str. REL606]
 gi|297520352|ref|ZP_06938738.1| coproporphyrinogen III oxidase [Escherichia coli OP50]
 gi|300928597|ref|ZP_07144120.1| coproporphyrinogen III oxidase [Escherichia coli MS 187-1]
 gi|194423517|gb|EDX39508.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 101-1]
 gi|242378044|emb|CAQ32815.1| coproporphyrinogen III oxidase [Escherichia coli BL21(DE3)]
 gi|253323709|gb|ACT28311.1| Coproporphyrinogen oxidase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974320|gb|ACT39991.1| coproporphyrinogen III oxidase [Escherichia coli B str. REL606]
 gi|253978487|gb|ACT44157.1| coproporphyrinogen III oxidase [Escherichia coli BL21(DE3)]
 gi|300463397|gb|EFK26890.1| coproporphyrinogen III oxidase [Escherichia coli MS 187-1]
 gi|323961237|gb|EGB56849.1| coproporphyrinogen III oxidase [Escherichia coli H489]
 gi|323970874|gb|EGB66125.1| coproporphyrinogen III oxidase [Escherichia coli TA007]
          Length = 299

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|332533671|ref|ZP_08409530.1| coproporphyrinogen III oxidase, aerobic [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036835|gb|EGI73296.1| coproporphyrinogen III oxidase, aerobic [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 316

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +  F  LQ  IC   E  +  A           F   +W R +      GGGR    
Sbjct: 7   NQVKAYFMALQDTICQGLEAADGSA----------KFIEDNWQRAEG-----GGGRTRVT 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NPHVP  H N+
Sbjct: 52  TNGTVIEQGGVNYSHVFGASMPGSATAHRPELAGRSFHACGVSLVIHPKNPHVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV  +H    ++C+      Y  YK
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----VLEDVQHWHQVAHDICAPFGSEVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ +VG+ F+  Y  ++ R 
Sbjct: 167 TWCDEYFYLKHRDETRGVGGLFFDDLNE----LGFEQSFAFMQSVGNGFLDAYLPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 223 KNDEYTEQQRDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|253988874|ref|YP_003040230.1| coproporphyrinogen III oxidase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780324|emb|CAQ83485.1| coproporphyrinogen 3 oxidase, aerobic [Photorhabdus asymbiotica]
          Length = 302

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +  F +LQ  IC + E+ +  A           FT + W R +      GGGR   +
Sbjct: 7   NQIKSFFLSLQDKICQQLEQADGTA----------KFTEQSWQRKEG-----GGGRSRIM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A    S + G   P              + A G+SV++HP NP++P  H N+
Sbjct: 52  QEGTVFEQAGANFSHISGTRLPVSATSYRPELAGRSYQAMGISVVIHPLNPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H T   +C  +    Y  YK
Sbjct: 112 RFFIAEKEGESPVWWFGGGFDLTPY-----YGFEEDAIHWHTTASNICQPYGEDIYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HR E+RGIGG+F+D L++       +  F+F   +G  F+  Y  +V + 
Sbjct: 167 KWCDDYFYIKHRNEARGIGGLFYDDLNTP----NFEYCFNFTQDIGKGFLHAYLPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              L+ E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 223 KSLLWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|114765846|ref|ZP_01444939.1| coproporphyrinogen III oxidase [Pelagibaca bermudensis HTCC2601]
 gi|114541845|gb|EAU44882.1| coproporphyrinogen III oxidase [Roseovarius sp. HTCC2601]
          Length = 298

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 123/306 (40%), Positives = 160/306 (52%), Gaps = 16/306 (5%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQ 66
           +   D   ERK  +   F  L+  I   FE LE        ++ +P  F V    R    
Sbjct: 1   MTDTDAFAERKIRASDWFRALRDEIVAAFEGLEQSHDTGPFSDDAPGAFEVTPTSRTAED 60

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLS 121
             D GGG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S
Sbjct: 61  GSDAGGGLMSVMRGGRVFEKVGVNVSTVYGTLGEAAQKSMAARGVPGIESDPRFWASGIS 120

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           ++ H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH T K   
Sbjct: 121 LVAHMRNPHVPAVHMNTRMFWTPNAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHL 175

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H  A Y   K W D YFY+PHR+ +RG+GGIF D  ++    G  DADF+    +G  
Sbjct: 176 DPHGPALYPELKAWADEYFYIPHRKRARGVGGIFMDDRNT----GDWDADFALTQDIGRA 231

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  LV +         DR+ QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+
Sbjct: 232 FLPAYLPLVEKRRVMPCDAADRETQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSL 291

Query: 301 PPLVAW 306
           PPL  W
Sbjct: 292 PPLAKW 297


>gi|283832171|ref|ZP_06351912.1| coproporphyrinogen III oxidase [Citrobacter youngae ATCC 29220]
 gi|291071805|gb|EFE09914.1| coproporphyrinogen III oxidase [Citrobacter youngae ATCC 29220]
          Length = 299

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 110/299 (36%), Positives = 153/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  ++   +LQ  IC     ++              F    W R+       GGG
Sbjct: 1   MKPDAQRVKQFLLSLQDDICQRLSAVDG-----------AEFIEDSWQRE-----AGGGG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G +FE+A V  S V+GD  P              F A G+S++VHP NP++P 
Sbjct: 45  RSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYIPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGIEEDAVHWHRTARDLCQPFGEDV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  
Sbjct: 160 YPRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDRCFAFMQAVGKGYTDAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVGRRKTMSWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|260775022|ref|ZP_05883922.1| coproporphyrinogen III oxidase aerobic [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609112|gb|EEX35271.1| coproporphyrinogen III oxidase aerobic [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 305

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 113/297 (38%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K+  ++    LQ  IC + E+ +  A           F    W R+  ++   GGGR 
Sbjct: 4   IDKQAVKQFLMELQDSICQQLEQADGHAE----------FIEDAWSREPGER-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP++P  H
Sbjct: 53  RVMKEGAVFEQGGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPKNPYIPTSH 112

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        ++ D  ++HNT KE+C+      Y 
Sbjct: 113 ANVRFFIAEKDGEAPIWWFGGGFDLTPFYP-----FEEDAQYWHNTAKEVCAPFGSEVYP 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKATEYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|293395019|ref|ZP_06639306.1| coproporphyrinogen III oxidase [Serratia odorifera DSM 4582]
 gi|291422426|gb|EFE95668.1| coproporphyrinogen III oxidase [Serratia odorifera DSM 4582]
          Length = 305

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 157/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD  E      +     LQ  IC +  + +  A           FT   W R +   
Sbjct: 1   MSLPDIAE-----VKSFLLALQERICQQLAQADGGAE----------FTEDRWTRAEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G + P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLTNGAVFEQAGVNFSHVSGAMLPASATAHRPELAGRSFQAMGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP++P  H N+R            +WFGGG DLTP      + +  D + +H T +++C+
Sbjct: 101 NPYIPTSHANVRFFIAEKPGEAPVWWFGGGFDLTPY-----YGFKEDAVHWHRTAQQLCA 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YF++ HR E+RGIGG+F+D L++       D  F+F  AVGD F
Sbjct: 156 PFGEQVYPQYKKWCDDYFFIKHRNEARGIGGLFYDDLNTP----DFDHCFAFTRAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + EQ+RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMP
Sbjct: 212 LDAYLPIVARRKSMAWGEQERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|16130361|ref|NP_416931.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109250|ref|AP_003030.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           W3110]
 gi|157161903|ref|YP_001459221.1| coproporphyrinogen III oxidase [Escherichia coli HS]
 gi|170019282|ref|YP_001724236.1| coproporphyrinogen III oxidase [Escherichia coli ATCC 8739]
 gi|170082045|ref|YP_001731365.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188494062|ref|ZP_03001332.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 53638]
 gi|238901599|ref|YP_002927395.1| coproporphyrinogen III oxidase [Escherichia coli BW2952]
 gi|256021870|ref|ZP_05435735.1| coproporphyrinogen III oxidase [Escherichia sp. 4_1_40B]
 gi|300951863|ref|ZP_07165673.1| coproporphyrinogen III oxidase [Escherichia coli MS 116-1]
 gi|300957210|ref|ZP_07169445.1| coproporphyrinogen III oxidase [Escherichia coli MS 175-1]
 gi|301023792|ref|ZP_07187527.1| coproporphyrinogen III oxidase [Escherichia coli MS 196-1]
 gi|301648092|ref|ZP_07247855.1| coproporphyrinogen III oxidase [Escherichia coli MS 146-1]
 gi|307139078|ref|ZP_07498434.1| coproporphyrinogen III oxidase [Escherichia coli H736]
 gi|312973322|ref|ZP_07787494.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1827-70]
 gi|331643059|ref|ZP_08344194.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H736]
 gi|547614|sp|P36553|HEM6_ECOLI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167008822|sp|A8A2T4|HEM6_ECOHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|189028162|sp|B1IWM6|HEM6_ECOLC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740879|sp|B1XAA7|HEM6_ECODH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|259709754|sp|C4ZX09|HEM6_ECOBW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|453969|emb|CAA53167.1| coproporphyrinogen oxidase [Escherichia coli K-12]
 gi|1788777|gb|AAC75489.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1799866|dbj|BAA16319.1| coproporphyrinogen III oxidase [Escherichia coli str. K12 substr.
           W3110]
 gi|157067583|gb|ABV06838.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli HS]
 gi|169754210|gb|ACA76909.1| Coproporphyrinogen oxidase [Escherichia coli ATCC 8739]
 gi|169889880|gb|ACB03587.1| coproporphyrinogen III oxidase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188489261|gb|EDU64364.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli 53638]
 gi|238860612|gb|ACR62610.1| coproporphyrinogen III oxidase [Escherichia coli BW2952]
 gi|260448477|gb|ACX38899.1| Coproporphyrinogen oxidase [Escherichia coli DH1]
 gi|299880665|gb|EFI88876.1| coproporphyrinogen III oxidase [Escherichia coli MS 196-1]
 gi|300316054|gb|EFJ65838.1| coproporphyrinogen III oxidase [Escherichia coli MS 175-1]
 gi|300448904|gb|EFK12524.1| coproporphyrinogen III oxidase [Escherichia coli MS 116-1]
 gi|301073815|gb|EFK88621.1| coproporphyrinogen III oxidase [Escherichia coli MS 146-1]
 gi|309702724|emb|CBJ02053.1| coproporphyrinogen III oxidase [Escherichia coli ETEC H10407]
 gi|310331917|gb|EFP99152.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 1827-70]
 gi|315137067|dbj|BAJ44226.1| coproporphyrinogen III oxidase [Escherichia coli DH1]
 gi|315615687|gb|EFU96319.1| coproporphyrinogen 3 oxidase, aerobic [Escherichia coli 3431]
 gi|323936336|gb|EGB32626.1| coproporphyrinogen III oxidase [Escherichia coli E1520]
 gi|323941318|gb|EGB37503.1| coproporphyrinogen III oxidase [Escherichia coli E482]
 gi|331039857|gb|EGI12077.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli H736]
          Length = 299

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGADPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDRCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|270262972|ref|ZP_06191243.1| coproporphyrinogen III oxidase, aerobic [Serratia odorifera 4Rx13]
 gi|270043656|gb|EFA16749.1| coproporphyrinogen III oxidase, aerobic [Serratia odorifera 4Rx13]
          Length = 306

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC +  + +  A           F    W R++      GGGR   L
Sbjct: 7   AEVKSFLLSLQDSICAQLAQADGGAV----------FNEDRWTREEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP++P++P  H N+
Sbjct: 52  TQGSVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQAMGVSLVIHPHSPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T + +C+      Y  YK
Sbjct: 112 RFFIAEKPGEEPVWWFGGGFDLTPF-----YGFEEDAVHWHRTAERLCAPFGDEVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD L++       D+ F+F  AVG+ F+  Y  +V + 
Sbjct: 167 KWCDDYFFIKHRNEARGIGGLFFDDLNTP----DFDSCFAFTRAVGEGFLDAYLPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + + +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KALSWGDNERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|89074768|ref|ZP_01161226.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
 gi|89049532|gb|EAR55093.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
          Length = 302

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 117/300 (39%), Positives = 163/300 (54%), Gaps = 30/300 (10%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D +  K   +    +LQ  IC   E+ E          +   F    W R++      GG
Sbjct: 2   DSQVDKSAVKAFLLDLQDRICQALEQQE----------TTVAFEQDQWQREEG-----GG 46

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G++FE+A V  S VYG   P              F A G+S+++HP NP+VP
Sbjct: 47  GRSRVLRDGEIFEQAGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVP 106

Query: 133 AVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R            +WFGGG DLTP        ++ D   +H+T K++C+     
Sbjct: 107 TSHANVRFFIAEKDGEAPVWWFGGGFDLTPFYP-----FEEDCQHWHDTAKQLCAPFGDD 161

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  +K WCD+YF+LPHR E+RG+GG+FFD L+      G D  F+++ AVG+ FI  Y 
Sbjct: 162 VYQEHKAWCDKYFFLPHRNETRGVGGLFFDDLNQW----GFDKSFAYMQAVGNGFINAYM 217

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +V++ YH  + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPLV W
Sbjct: 218 PIVKQRYHLSYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLVRW 277


>gi|284922390|emb|CBG35477.1| coproporphyrinogen III oxidase [Escherichia coli 042]
          Length = 300

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 8   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 51

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 52  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 111

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 112 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 166

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ A+G  +   Y  +V R  
Sbjct: 167 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAIGKGYTDAYLPIVERRK 222

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|293415707|ref|ZP_06658350.1| coproporphyrinogen III oxidase [Escherichia coli B185]
 gi|291433355|gb|EFF06334.1| coproporphyrinogen III oxidase [Escherichia coli B185]
          Length = 299

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDGT-----------EFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|306814478|ref|ZP_07448640.1| coproporphyrinogen III oxidase [Escherichia coli NC101]
 gi|305851872|gb|EFM52324.1| coproporphyrinogen III oxidase [Escherichia coli NC101]
          Length = 300

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 8   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 51

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 52  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 111

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 112 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 166

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L+++      D  F+F+ AVG  +   Y  +V R  
Sbjct: 167 WCDEYFYLKHRNEQRGIGGLFFDDLNTA----DFDHCFAFMQAVGKGYTDAYLPIVERRK 222

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 275


>gi|254262194|emb|CAZ90522.1| Coproporphyrinogen-III oxidase, aerobic hemF [Enterobacter
           turicensis]
          Length = 299

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 114/299 (38%), Positives = 156/299 (52%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  +     LQ  IC +   ++  A           F    W RD       GGG
Sbjct: 1   MKPDSQRVKSFLLALQDDICRQLSAVDGTA-----------FIEDSWQRD-----AGGGG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S VYGD  P              F A G+S+++HP NP+VP 
Sbjct: 45  RSRVLRDGAVFEQAGVNFSHVYGDAMPASATAHRPELAGRSFEAMGVSLVIHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG D+TP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDMTPF-----YGFEEDAVHWHRTARDLCLPFGEDV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HR E RGIGG+FFD L++       +  F+F+ AVG+ F + Y  
Sbjct: 160 YPRYKKWCDDYFYLRHRNEQRGIGGLFFDDLNTP----DFEHCFAFMQAVGNGFTEAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKALAWGERERAFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|330447324|ref|ZP_08310974.1| coproporphyrinogen III oxidase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491515|dbj|GAA05471.1| coproporphyrinogen III oxidase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 302

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 113/300 (37%), Positives = 163/300 (54%), Gaps = 30/300 (10%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D +  K   +    +LQ  IC   E+ E          +   F    W R++      GG
Sbjct: 2   DNQVDKHAVKSFLLDLQDRICQALEQQE----------TTVSFEQDQWQREEG-----GG 46

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           GR   L  G++FE+A V  S VYG   P              F A G+S+++HP NP+VP
Sbjct: 47  GRSRVLRNGEIFEQAGVNFSHVYGAEMPASATAHRPELAGRRFEAMGVSLVIHPRNPYVP 106

Query: 133 AVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R            +WFGGG DLTP        ++ D   +H+T K++C+     
Sbjct: 107 TSHANVRFFIAEKDGEAPVWWFGGGFDLTPFYP-----FEEDCQHWHDTAKQLCAPFGDE 161

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y+ +K WCD+YF+LPHR E+RG+GG+FFD L+      G +  F+++ AVG+ +I  Y 
Sbjct: 162 VYSEHKAWCDQYFFLPHRNETRGVGGLFFDDLNQW----GFEKSFAYMQAVGNGYIDAYI 217

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++++ YH  + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 218 PILKQRYHLPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 277


>gi|170679650|ref|YP_001744627.1| coproporphyrinogen III oxidase [Escherichia coli SMS-3-5]
 gi|226740882|sp|B1LMN0|HEM6_ECOSM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|170517368|gb|ACB15546.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli SMS-3-5]
          Length = 299

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 115/293 (39%), Positives = 155/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    WLR+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWLRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G++ P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEVMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|220933307|ref|YP_002512206.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800278|sp|B8GTF9|HEM6_THISH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|219994617|gb|ACL71219.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 304

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 109/290 (37%), Positives = 145/290 (50%), Gaps = 30/290 (10%)

Query: 23  RKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGK 82
                LQ  IC      +              F    W R++      GGGR   L  G 
Sbjct: 12  DYLTGLQDRICQGIAGADGS----------GEFKEDSWTREEG-----GGGRSRVLTEGA 56

Query: 83  VFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV 142
           VFE+A +  S V G   P              F ATG+S+++HP NP+VP  H N+R  +
Sbjct: 57  VFEQAGINFSHVTGASLPPSATAHRPELAGRRFQATGVSLVIHPRNPYVPTSHANVRFFI 116

Query: 143 T------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
                    +WFGGG DLTP      +  D D + +H   K  C       Y  YK+WCD
Sbjct: 117 AEKEGAEPIWWFGGGFDLTPY-----YGEDEDCVHWHRVAKAACEPFGPEVYPRYKQWCD 171

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YF+L HR E RG+GG+FFD L+      G +  F+F+ +VGD ++  Y  +V R     
Sbjct: 172 EYFFLRHRNEPRGVGGLFFDDLNEW----GFEKSFAFMRSVGDHYLDAYLPIVARRKDTP 227

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 228 YGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 277


>gi|34222554|sp|Q8DL15|HEM6_THEEB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
          Length = 338

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 112/327 (34%), Positives = 152/327 (46%), Gaps = 47/327 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            +     P D    ++      ++LQ  IC   E  +  A           F    W R 
Sbjct: 5   TSASTAVPSD---SRQRVATFLKDLQDQICQGLEAADGGAQ----------FQEDTWQR- 50

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   +  G++ E+  V  S V+G+  P              F+ATG S++
Sbjct: 51  ----PEGGGGRSRVMKNGQLLEQGGVNFSEVWGEQLPPSILAQRPEAAGYGFYATGTSMV 106

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP+VP VH N R       +WFGGG DLTP        +  D   FH   +  C +
Sbjct: 107 LHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAKHFHQVHQAACDR 161

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM------------------ 224
           H    Y  +K WCD YFYL HR E+RG+GGIFFD+   S                     
Sbjct: 162 HHREYYPVFKRWCDEYFYLKHRGETRGVGGIFFDYQDGSDRELYRGPNPDGEAARYSQRV 221

Query: 225 -----GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
                   +  F+FI + G  F++ Y  +V R  H  + +++RQ QL RRGRY EFNL+Y
Sbjct: 222 GSIGSRSWEDLFAFIQSCGQAFLEAYLPIVERRRHLTYGDRERQFQLYRRGRYVEFNLVY 281

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 282 DRGTIFGLQTNGRTESILMSLPPLVRW 308


>gi|22298226|ref|NP_681473.1| coproporphyrinogen III oxidase [Thermosynechococcus elongatus BP-1]
 gi|22294405|dbj|BAC08235.1| coproporphyrinogen III oxidase [Thermosynechococcus elongatus BP-1]
          Length = 352

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 112/327 (34%), Positives = 152/327 (46%), Gaps = 47/327 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            +     P D    ++      ++LQ  IC   E  +  A           F    W R 
Sbjct: 19  TSASTAVPSD---SRQRVATFLKDLQDQICQGLEAADGGAQ----------FQEDTWQR- 64

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   +  G++ E+  V  S V+G+  P              F+ATG S++
Sbjct: 65  ----PEGGGGRSRVMKNGQLLEQGGVNFSEVWGEQLPPSILAQRPEAAGYGFYATGTSMV 120

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP+VP VH N R       +WFGGG DLTP        +  D   FH   +  C +
Sbjct: 121 LHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAKHFHQVHQAACDR 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM------------------ 224
           H    Y  +K WCD YFYL HR E+RG+GGIFFD+   S                     
Sbjct: 176 HHREYYPVFKRWCDEYFYLKHRGETRGVGGIFFDYQDGSDRELYRGPNPDGEAARYSQRV 235

Query: 225 -----GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
                   +  F+FI + G  F++ Y  +V R  H  + +++RQ QL RRGRY EFNL+Y
Sbjct: 236 GSIGSRSWEDLFAFIQSCGQAFLEAYLPIVERRRHLTYGDRERQFQLYRRGRYVEFNLVY 295

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 296 DRGTIFGLQTNGRTESILMSLPPLVRW 322


>gi|330890225|gb|EGH22886.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 309

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|238792064|ref|ZP_04635700.1| Coproporphyrinogen III oxidase [Yersinia intermedia ATCC 29909]
 gi|238728695|gb|EEQ20213.1| Coproporphyrinogen III oxidase [Yersinia intermedia ATCC 29909]
          Length = 308

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC      +  A           FT + W R++      GGGR   L
Sbjct: 7   AQIKTYLLALQDKICAALTHADGRA----------TFTEETWTREEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 52  VNGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPLSPYLPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H T  ++C       Y  YK
Sbjct: 112 RFFIAEKPGEDPVWWFGGGFDLTPY-----YGFEEDAIHWHQTAHQLCQPFGKEVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HR E+RGIGG+F+D L+S       D  F F  AVGD F+  Y  +V R 
Sbjct: 167 KWCDDYFYIKHRNEARGIGGLFYDDLNSP----DFDTCFRFTQAVGDGFLDAYMPIVARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + EQ+RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 KALSWGEQERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|331007620|ref|ZP_08330762.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC1989]
 gi|330418560|gb|EGG93084.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC1989]
          Length = 308

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 109/295 (36%), Positives = 150/295 (50%), Gaps = 31/295 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K+       NLQ+ IC   + ++              F    W RD+      GGG+   
Sbjct: 6   KQAVIDYLLNLQNNICEALQNIDG-----------GKFIEDTWQRDEG-----GGGKSRV 49

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G V EK  V  S V+GD  P              F A G+S+++HP NPH P  H N
Sbjct: 50  LAGGHVIEKGGVNFSHVFGDKMPASATAHRPELAGRNFEAMGVSLVIHPNNPHAPTSHMN 109

Query: 138 IRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           +R            +WFGGG DLTP    ++     D + +H T K+ C     + Y  +
Sbjct: 110 VRFFIAEKEGEAPVWWFGGGYDLTPYYGDKK-----DCVHWHQTAKDACDPFDQSYYPRF 164

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YFYL HR E+RGIGG+FFD  +      G D  F F+ ++GD +I  Y  ++  
Sbjct: 165 KKWCDDYFYLKHRDEARGIGGLFFDDFNE----LGFDKSFLFLQSIGDSYIHAYAPILDN 220

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                +++++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 221 KKDIPYTDKERNFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSLPPLVRW 275


>gi|224823560|ref|ZP_03696669.1| Coproporphyrinogen oxidase [Lutiella nitroferrum 2002]
 gi|224604015|gb|EEG10189.1| Coproporphyrinogen oxidase [Lutiella nitroferrum 2002]
          Length = 302

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 152/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
                 +LQ  IC   +  +  A           F    W R++      GGGR   L  
Sbjct: 9   VHAFLTDLQDRICAALQTADGGAS----------FVEDSWQREQG-----GGGRSRVLTG 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A V  S V GD  P              + A G+S++VHP NP+VP  H N+R 
Sbjct: 54  GAVFEQAGVNFSHVTGDTLPPSATAHRPELAGRRWEAMGVSLVVHPENPYVPTSHANVRF 113

Query: 141 I------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
                      +WFGGG DLTP      + ++ D + +H    ++C       Y  YK+W
Sbjct: 114 FIAEKDGEAPVWWFGGGFDLTPF-----YGFEEDAVHWHRVAHDLCQPFGAEVYPRYKQW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E+RG+GG+FFD L++     G +  F+F+ AVG+ ++  Y  +V R   
Sbjct: 169 CDEYFFLKHRHEARGVGGLFFDDLNAW----GFEQSFAFLQAVGNGYLDAYLPIVARRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 225 TPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|13472430|ref|NP_103997.1| coproporphyrinogen III oxidase [Mesorhizobium loti MAFF303099]
 gi|14023176|dbj|BAB49783.1| coproporphyrinogen III oxidase precursor [Mesorhizobium loti
           MAFF303099]
          Length = 286

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 149/289 (51%), Positives = 197/289 (68%), Gaps = 5/289 (1%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
            ++  FE L+  IC  FE++E +     A+ SP  F    W RD  +    GGG   ++ 
Sbjct: 2   KARLWFEALRERICGAFEQIEQDLQGPLASWSPGRFEKTPWERDAGK----GGGGTMSMM 57

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G+VFEK  V  STVYG+ SP+F+ Q+ G  ++P FWA+G+S+I HP+NP+VPAVH N R
Sbjct: 58  HGRVFEKVGVHTSTVYGEFSPEFRKQMPGAEEDPRFWASGISLIAHPWNPNVPAVHMNTR 117

Query: 140 MIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVANYTHYKEWCDRY 198
           M+VT   WFGGG DLTP L+ RR   DPD I FH  ++  C ++ AVA++  +K WCD Y
Sbjct: 118 MVVTSRQWFGGGADLTPVLDRRRTQDDPDTIAFHRAMQFACEKNVAVADHPKFKTWCDEY 177

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F+LPHR E RG+GGIFFD LHS  + GG +ADF+F+  VG  F+ +Y  LVR N++  ++
Sbjct: 178 FFLPHRNEPRGVGGIFFDWLHSGEDRGGWNADFNFVQDVGRSFLVVYSHLVRANFNENWT 237

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           + DR EQLIRRGRY EFNLL+D+GT FG KTGGNV SIL+S+PP V WP
Sbjct: 238 DGDRDEQLIRRGRYVEFNLLHDRGTIFGLKTGGNVASILSSLPPEVRWP 286


>gi|28899808|ref|NP_799413.1| coproporphyrinogen III oxidase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153837672|ref|ZP_01990339.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ3810]
 gi|260362027|ref|ZP_05775032.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           K5030]
 gi|260876486|ref|ZP_05888841.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AN-5034]
 gi|260897457|ref|ZP_05905953.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           Peru-466]
 gi|260901348|ref|ZP_05909743.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ4037]
 gi|31340151|sp|Q87KE3|HEM6_VIBPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|28808060|dbj|BAC61297.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149748962|gb|EDM59789.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ3810]
 gi|308087909|gb|EFO37604.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           Peru-466]
 gi|308090350|gb|EFO40045.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AN-5034]
 gi|308109895|gb|EFO47435.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           AQ4037]
 gi|308114126|gb|EFO51666.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           K5030]
 gi|328471158|gb|EGF42060.1| coproporphyrinogen III oxidase [Vibrio parahaemolyticus 10329]
          Length = 305

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + +A           F    W R+  ++   GGGR 
Sbjct: 4   IDKYAVKQFLMSLQDSICQQLEQEDGKAV----------FVEDAWHREPGER-LGGGGRS 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLRDGLVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K +C+      Y 
Sbjct: 113 ANVRFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKAICAPFGEDVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKDIEYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|315298253|gb|EFU57513.1| coproporphyrinogen III oxidase [Escherichia coli MS 16-3]
          Length = 299

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 155/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   +++             F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDD-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L+++      D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTA----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|315288130|gb|EFU47530.1| coproporphyrinogen III oxidase [Escherichia coli MS 110-3]
          Length = 299

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRPESILMSMPPLVRW 274


>gi|37525339|ref|NP_928683.1| coproporphyrinogen III oxidase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|41017106|sp|Q7N6Z9|HEM6_PHOLL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|36784766|emb|CAE13676.1| oxygen-dependent coproporphyrinogen III oxidase [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 302

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 158/294 (53%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +  F +LQ  IC + E+++ +          + FT + W R++      GGGR   +
Sbjct: 7   NQIKSFFLSLQDEICQQLEQIDGK----------EKFTEQCWQREEG-----GGGRSRIM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A    S V GD+ P             ++ A G+S+++HP NP++P  H N+
Sbjct: 52  KEGTIFEQAGANFSHVSGDMLPLSATAHRPELVGRHYQAMGVSLVIHPLNPYIPTSHANV 111

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP      + +  D I +H T + +C  +    Y  YK
Sbjct: 112 RFFIAEKEGEAPVWWFGGGFDLTPY-----YGFKEDAIHWHTTARNICRPYGEDVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCD YFY+ HR E+RGIGG+F+D L++       +  F+F   +G  F+  Y  +V + 
Sbjct: 167 EWCDNYFYIKHRNEARGIGGLFYDDLNTP----DFEHCFNFTQDIGKGFLSAYLPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              L+ E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 223 KEILWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|269966991|ref|ZP_06181061.1| coproporphyrinogen III oxidase, aerobic [Vibrio alginolyticus 40B]
 gi|269828385|gb|EEZ82649.1| coproporphyrinogen III oxidase, aerobic [Vibrio alginolyticus 40B]
          Length = 305

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 158/297 (53%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + +A           F    W R+  ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEQEDGKAV----------FVEDAWHREPGER-LGGGGRS 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLRDGLVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K++C+      Y 
Sbjct: 113 ANVRFFIAEKDGEDPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKQLCAPFGDDVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F++I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNQWE----FDKCFAYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKEIEYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|330500992|ref|YP_004377861.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
 gi|328915278|gb|AEB56109.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
          Length = 319

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 106/297 (35%), Positives = 150/297 (50%), Gaps = 30/297 (10%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           +R    +    +LQ  IC+  +  + +A           F    W R        GGGR 
Sbjct: 18  DRTEAVKAYLLDLQDRICSALQAEDGQAV----------FADDAWQR-----PAGGGGRT 62

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G + EK  V  S V+GD  P              F A G+S+++HP NP+VP  H
Sbjct: 63  RVIENGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPYVPTSH 122

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP   +     + D + +H    + C+      Y 
Sbjct: 123 ANVRFFSAEKEGEEPVWWFGGGFDLTPYYAN-----EEDCVHWHQVAHDACAPFGAEVYP 177

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCDRYF+L HR E RGIGG+FFD L+        D  F+F+ A+GD +I+ Y  +V
Sbjct: 178 KFKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTSFAFMRAIGDAYIQAYLPIV 233

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R     F +++R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 234 QRRKLTPFGDREREFQAFRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPHVRW 290


>gi|220907308|ref|YP_002482619.1| coproporphyrinogen III oxidase [Cyanothece sp. PCC 7425]
 gi|219863919|gb|ACL44258.1| Coproporphyrinogen oxidase [Cyanothece sp. PCC 7425]
          Length = 345

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 111/312 (35%), Positives = 151/312 (48%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ++        LQ  IC   E+++              F    W R      + GGGR   
Sbjct: 22  RQRVSAFLRQLQDDICQGLEQIDGS----------GKFREDAWER-----PEGGGGRSRV 66

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           + +G + E+  V  S V+G+  P    Q         F+ATG S+++HP +P++P VH N
Sbjct: 67  MQSGTILEQGGVNFSEVWGEKLPPSILQQRPEAAGHGFYATGTSMVLHPRSPYIPTVHLN 126

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH TLK  C +H    Y  +K WCD
Sbjct: 127 YRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHQTLKAACDRHHPQYYPTFKLWCD 181

Query: 197 RYFYLPHRQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFI 234
            YFYL HRQE+RG+GG+FFD+                           E    +  F+FI
Sbjct: 182 EYFYLKHRQETRGVGGLFFDYQDGRGELYHGPNPQGPAGVYSAGLPPLESRSWEDLFAFI 241

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
           ++ G  F+  Y  +V R     + E++RQ QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 242 NSCGSAFLNSYVPIVERRQGLEYGERERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 301

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 302 SILMSLPPLVRW 313


>gi|71735087|ref|YP_272340.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123638996|sp|Q48QH6|HEM6_PSE14 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|71555640|gb|AAZ34851.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 304

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTAQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|331663999|ref|ZP_08364909.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA143]
 gi|331059798|gb|EGI31775.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli TA143]
          Length = 299

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|284052971|ref|ZP_06383181.1| coproporphyrinogen III oxidase [Arthrospira platensis str. Paraca]
          Length = 347

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 152/322 (47%), Gaps = 44/322 (13%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  P   + R        + +Q  IC   E L+            K F    W R     
Sbjct: 12  VQSPPPADSR-ERVSHWMKQIQDEICAGLEGLDG----------AKTFVEDAWER----- 55

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGGR   L  G VFE+  V  S V+G   P          +   F+ATG S+++HP 
Sbjct: 56  PEGGGGRTRVLREGNVFEQGGVNFSEVWGQNLPPSILSQRPEVEGHGFYATGTSMVLHPR 115

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NP+VP VH N R       +WFGGG DLTP        +  D   FH TLKE C +H   
Sbjct: 116 NPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHKTLKEACDRHHSE 170

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS----------------------PEM 224
            Y  +K WCD YF+L HR E+RGIGGIFFD+                          PE 
Sbjct: 171 YYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGPYTESEAAIYSDRMGAPES 230

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +A FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT 
Sbjct: 231 RDWEALFSFIQDCGKSFLPSYGPIVERRNSMEYGDRERNFQLYRRGRYVEFNLVYDRGTI 290

Query: 285 FGFKTGGNVESILASMPPLVAW 306
           FG +T G  ESIL S+PPLV W
Sbjct: 291 FGLQTKGRTESILMSLPPLVRW 312


>gi|292493438|ref|YP_003528877.1| coproporphyrinogen oxidase [Nitrosococcus halophilus Nc4]
 gi|291582033|gb|ADE16490.1| Coproporphyrinogen oxidase [Nitrosococcus halophilus Nc4]
          Length = 312

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 158/305 (51%), Gaps = 31/305 (10%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  P + E    + +    +LQ  IC+  E+ +  A           F   +W R     
Sbjct: 1   MNNPSN-EPEVAVVKDYLLDLQDRICSTLEQEDGAAS----------FMEDNWQRA---- 45

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+  V  S V+G+  P              F A G+S+++HP+
Sbjct: 46  -AGGGGRSRVLSEGAVFEQGGVNFSHVFGEGLPAAATAQRPELAGRRFQALGVSLVIHPH 104

Query: 128 NPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP+VP  H NIR            +WFGGG DLTP        ++ D I +H+T +E C 
Sbjct: 105 NPYVPTSHANIRFFLATKEGEAPIWWFGGGFDLTPYYP-----FEEDAIHWHHTAREACI 159

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFYL HR E+RGIGG+FFD L+      G    F F+ +VG+ +
Sbjct: 160 PFGEEVYPRYKKWCDEYFYLKHRGETRGIGGLFFDDLNEW----GFPRCFDFMQSVGNHY 215

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           I  Y  +V+R     + E++R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+P
Sbjct: 216 ILAYLPIVQRRKTLSYGERERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLP 275

Query: 302 PLVAW 306
           PLV W
Sbjct: 276 PLVKW 280


>gi|237732430|ref|ZP_04562911.1| coproporphyrinogen oxidase [Citrobacter sp. 30_2]
 gi|226907969|gb|EEH93887.1| coproporphyrinogen oxidase [Citrobacter sp. 30_2]
          Length = 299

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 157/299 (52%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  ++   +LQ  IC +   ++              F   +W R+       GGG
Sbjct: 1   MKPDAQRVKQFLLSLQDEICQQLSTVDGS-----------EFVEDNWQRE-----AGGGG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G +FE+A V  S V+GD  P              F A G+S++VHP NP++P 
Sbjct: 45  RSRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPQNPYIPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + +D D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFDEDAVNWHRTARDLCQPFGDDV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG  + + Y  
Sbjct: 160 YPRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGQGYTEAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKMMSWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|320185130|gb|EFW59910.1| Coproporphyrinogen III oxidase, aerobic [Shigella flexneri CDC
           796-83]
          Length = 299

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WC+ YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCNDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|254421563|ref|ZP_05035281.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. PCC
           7335]
 gi|196189052|gb|EDX84016.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. PCC
           7335]
          Length = 351

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 117/313 (37%), Positives = 151/313 (48%), Gaps = 44/313 (14%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +       + LQ  IC + E L+              F    W R      + GGGR   
Sbjct: 29  RDRVSTALKGLQDRICQKLEALDG----------GGKFQEDAWDR-----PEGGGGRSRV 73

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           + AG VFE+  V  S V+GD  P          +   F+ATG S+++HP NP+VP VH N
Sbjct: 74  MKAGNVFEQGGVGFSEVWGDSLPPAILVKRPEAEGHQFYATGTSMVLHPRNPYVPTVHLN 133

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGGIDLTP   ++      DV+ FH TLK  C QH    Y  +K WCD
Sbjct: 134 YRYFEAGPVWWFGGGIDLTPYYANQ-----EDVVHFHKTLKAACDQHNPQYYPTFKRWCD 188

Query: 197 RYFYLPHRQESRGIGGIFFDHLHS-----------------------SPEMGGIDADFSF 233
            YFYL HR E RG+GGIFFD+ +                        S      +  F F
Sbjct: 189 EYFYLKHRNEPRGVGGIFFDYQNGQRGELYRGHNQDGPAALYSQKTGSAPKRSWEELFQF 248

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
               GD F+  Y  +V +     + +++R  QL RRGRY EFNL+YD+GT FG +T G  
Sbjct: 249 AMGCGDAFLPAYVPIVEKRADTAYGDRERNFQLYRRGRYVEFNLVYDRGTLFGLQTNGRT 308

Query: 294 ESILASMPPLVAW 306
           ESIL S+PPLV W
Sbjct: 309 ESILMSLPPLVRW 321


>gi|254230003|ref|ZP_04923404.1| coproporphyrinogen III oxidase, aerobic [Vibrio sp. Ex25]
 gi|262392840|ref|YP_003284694.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. Ex25]
 gi|151937505|gb|EDN56362.1| coproporphyrinogen III oxidase, aerobic [Vibrio sp. Ex25]
 gi|262336434|gb|ACY50229.1| coproporphyrinogen III oxidase aerobic [Vibrio sp. Ex25]
          Length = 305

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 112/297 (37%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + EA           F    W R+  ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEQEDGEAV----------FVEDAWHREPGER-LGGGGRS 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMRDGLVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K +C+      Y 
Sbjct: 113 ANVRFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKAICAPFGEEVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKDIEYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|218696071|ref|YP_002403738.1| coproporphyrinogen III oxidase [Escherichia coli 55989]
 gi|254800269|sp|B7LCI0|HEM6_ECO55 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|218352803|emb|CAU98591.1| coproporphyrinogen III oxidase [Escherichia coli 55989]
          Length = 299

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+F D L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFVDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|54310610|ref|YP_131630.1| coproporphyrinogen III oxidase [Photobacterium profundum SS9]
 gi|62510616|sp|Q6LLK0|HEM6_PHOPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|46915053|emb|CAG21828.1| Putative coproporphyrinogen III oxidase, aerobic [Photobacterium
           profundum SS9]
          Length = 301

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/296 (38%), Positives = 154/296 (52%), Gaps = 30/296 (10%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K   +    +LQ  IC   E  +  A           F    W R++      GGGR  
Sbjct: 5   DKHAVKAFLLSLQDQICQSLESQDKSAA----------FEQDEWQREQG-----GGGRSR 49

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            L  G VFE+A V  S V+G   P              F A G+S+++HP NP++P  H 
Sbjct: 50  VLRQGSVFEQAGVNFSHVFGTKMPASATAHRPELAGRSFEAMGVSLVIHPNNPYIPTSHA 109

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        ++ D   +HNT K +C+      Y  
Sbjct: 110 NVRFFIAEKEGEAPVWWFGGGFDLTPFYP-----FEEDCQHWHNTAKYLCAPFGDDIYEQ 164

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCD+YF+LPHR E+RG+GG+FFD L+      G +  F++  AVG+ FI  Y  +V+
Sbjct: 165 HKVWCDKYFFLPHRNETRGVGGLFFDDLNEW----GFEKSFAYTQAVGNGFIDGYLPIVQ 220

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 RRQDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|323139050|ref|ZP_08074109.1| Coproporphyrinogen oxidase [Methylocystis sp. ATCC 49242]
 gi|322395710|gb|EFX98252.1| Coproporphyrinogen oxidase [Methylocystis sp. ATCC 49242]
          Length = 302

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 152/298 (51%), Positives = 200/298 (67%), Gaps = 5/298 (1%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRS--PKIFTVKHWLRDKSQKEDLG 71
           +E+RK  ++  FE+LQ  I   FE LE+EA    +  +  P  F++  W R        G
Sbjct: 6   LEQRKIAAREWFESLQLRIIAAFETLEDEAPGPFSPEATAPGRFSLTPWERTDHSGAPGG 65

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GGRM  +   +VFEKA V  STV+G   P+F  QI G  ++P F+ATG+S+I HP+NP+V
Sbjct: 66  GGRMGMIHG-RVFEKAGVHCSTVFGTFQPEFARQIPGAAEDPRFFATGISLIAHPWNPNV 124

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R +VT   WFGGG DLTP L++RR   DPD I FH  ++  C +H VA+Y  +
Sbjct: 125 PAVHMNTRFVVTTKAWFGGGADLTPVLDARRTQDDPDTIAFHAAMRGACERHPVADYKRF 184

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG--IDADFSFISAVGDCFIKLYPSLV 249
           KEWCD YF+L HR E RGIGGIF+D+ +S+ +      D+DF+F   VG+ F+ +YP LV
Sbjct: 185 KEWCDEYFFLKHRNEPRGIGGIFYDYFNSAGDPANSAWDSDFAFTRDVGESFLSIYPELV 244

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           RRN+   +SE  R EQL+RRGRY E+NLLYD+GT FG KTGGNV+SIL+SMPP+V WP
Sbjct: 245 RRNFATPWSEAQRDEQLVRRGRYVEYNLLYDRGTIFGLKTGGNVDSILSSMPPMVKWP 302


>gi|237801641|ref|ZP_04590102.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024500|gb|EGI04556.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 304

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|85704463|ref|ZP_01035565.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
 gi|85670871|gb|EAQ25730.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
          Length = 296

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/304 (37%), Positives = 158/304 (51%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
             D+  ++K  +   F  L+  I   FE LE+  A+   ++ +P  F V    R      
Sbjct: 1   MTDEFTQQKTRAAAWFRQLRDDIVAAFEGLEDSHANGPLSDTAPGRFEVSDTRRHSEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVI 123
           D GGG M+ L  G+VFEK  V VS VYG              + G   +P FWA+G+S++
Sbjct: 61  DAGGGLMSVLRGGRVFEKVGVNVSEVYGTLGEAAQRSMAARGVPGMDSDPRFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P +E     Y  D   FH   +     
Sbjct: 121 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YPEDTAHFHAQQQAHLDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H +  Y   K W D YF++PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+
Sbjct: 176 HGIDLYPTLKAWADEYFFVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  L+ +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP
Sbjct: 232 PAYVPLIEKRRVQDWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPP 291

Query: 303 LVAW 306
           +  W
Sbjct: 292 MAKW 295


>gi|330901108|gb|EGH32527.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 292

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGSAH----------FMEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|291567257|dbj|BAI89529.1| coproporphyrinogen III oxidase, aerobic [Arthrospira platensis
           NIES-39]
          Length = 347

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 119/322 (36%), Positives = 152/322 (47%), Gaps = 44/322 (13%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  P   + R        + +Q  IC   E L+            K F    W R     
Sbjct: 12  VQSPPPADSR-ERVSHWMKQIQDEICAGLEGLDG----------AKTFVEDAWER----- 55

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGGR   +  G VFE+  V  S V+G   P          +   F+ATG S+++HP 
Sbjct: 56  PEGGGGRTRVIREGNVFEQGGVNFSEVWGQKLPPSILSQRPEAEGHGFYATGTSMVLHPR 115

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NP+VP VH N R       +WFGGG DLTP        +  D   FH TLKE C +H   
Sbjct: 116 NPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHKTLKEACDRHHSE 170

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS----------------------PEM 224
            Y  +K WCD YF+L HR E+RGIGGIFFD+                          PE 
Sbjct: 171 YYPVFKRWCDEYFHLTHRNEARGIGGIFFDYQGGEGLLYRGPYTESEAAIYSDRMGAPES 230

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +A FSFI   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT 
Sbjct: 231 RDWEALFSFIQDCGKSFLPSYGPIVERRNSMEYGDRERNFQLYRRGRYVEFNLVYDRGTI 290

Query: 285 FGFKTGGNVESILASMPPLVAW 306
           FG +T G  ESIL S+PPLV W
Sbjct: 291 FGLQTKGRTESILMSLPPLVRW 312


>gi|300921370|ref|ZP_07137731.1| coproporphyrinogen III oxidase [Escherichia coli MS 115-1]
 gi|300411682|gb|EFJ94992.1| coproporphyrinogen III oxidase [Escherichia coli MS 115-1]
          Length = 299

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
              +   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVNQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|318606637|emb|CBY28135.1| coproporphyrinogen III oxidase, aerobic [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 313

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 159/306 (51%), Gaps = 32/306 (10%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD         +    +LQ  IC    + +  A           FT ++W+R++   
Sbjct: 1   MNLPDI-----DQIKTYLLDLQDKICAALAQADGSA----------KFTEENWVREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   +  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVMVKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPN 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T   +C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPDEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG-GIDADFSFISAVGDC 240
                 YT YK+WCD YFY+ HR E+RGIGG+FFD L+S        D  F+F  AVGD 
Sbjct: 156 PFGEQLYTRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSDDLNSPDFDTCFNFTQAVGDG 215

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SM
Sbjct: 216 FLDAYMPIVARRKALCWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSM 275

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 276 PPLVRW 281


>gi|82777830|ref|YP_404179.1| coproporphyrinogen III oxidase [Shigella dysenteriae Sd197]
 gi|309784834|ref|ZP_07679467.1| coproporphyrinogen 3 oxidase, aerobic [Shigella dysenteriae 1617]
 gi|123561966|sp|Q32DB7|HEM6_SHIDS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|81241978|gb|ABB62688.1| coproporphyrinogen III oxidase [Shigella dysenteriae Sd197]
 gi|308927204|gb|EFP72678.1| coproporphyrinogen 3 oxidase, aerobic [Shigella dysenteriae 1617]
          Length = 299

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 154/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRESG-----GGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYAERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|300940320|ref|ZP_07154916.1| coproporphyrinogen III oxidase [Escherichia coli MS 21-1]
 gi|300454884|gb|EFK18377.1| coproporphyrinogen III oxidase [Escherichia coli MS 21-1]
          Length = 299

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLCAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVNGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|158333806|ref|YP_001514978.1| coproporphyrinogen III oxidase [Acaryochloris marina MBIC11017]
 gi|158304047|gb|ABW25664.1| coproporphyrinogen III oxidase, aerobic [Acaryochloris marina
           MBIC11017]
          Length = 341

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 115/326 (35%), Positives = 154/326 (47%), Gaps = 43/326 (13%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
                  P    + K    +    LQ  IC + + L+ ++           F    W R 
Sbjct: 8   PAAVTNAPPPPSDSKEQVGKFLRGLQDSICDKLQTLDGKS----------TFQEDSWDR- 56

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   L  G + E+  V  S V+GD  P    +         F+ATG S++
Sbjct: 57  ----PEGGGGRSRVLREGGLLEQGGVNYSEVWGDHLPPSILKQRPEAAGHRFYATGTSMV 112

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP +P+VP VH N R       +WFGGGIDLTP        +  DV+ FH T+K  C +
Sbjct: 113 LHPRSPYVPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FKEDVVHFHQTMKAACDR 167

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS---------------------- 220
           H    Y+ +K WCD YFYL HRQE RG+GGIFFD+                         
Sbjct: 168 HHPEYYSTFKPWCDEYFYLKHRQEMRGVGGIFFDYQDGIGALYRGPHAEGIAAHHSDQLG 227

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
           S      D  F+F    G+ F+  Y  +V R     + +++R  QL RRGRY EFNL+YD
Sbjct: 228 SLPQRSWDEIFAFAQDCGNAFLPAYVPIVERRRDTEYGDRERNFQLYRRGRYVEFNLVYD 287

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 288 RGTIFGLQTNGRTESILMSLPPLVRW 313


>gi|260774580|ref|ZP_05883493.1| coproporphyrinogen III oxidase aerobic [Vibrio metschnikovii CIP
           69.14]
 gi|260610486|gb|EEX35692.1| coproporphyrinogen III oxidase aerobic [Vibrio metschnikovii CIP
           69.14]
          Length = 304

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 114/298 (38%), Positives = 155/298 (52%), Gaps = 26/298 (8%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           +  K+  ++    LQ  IC + E+ + +A           F  + W R+  ++   GGGR
Sbjct: 3   DIDKQAVKQFLLELQDSICQQLEQADGKA----------KFVEEIWHREPGER-LGGGGR 51

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              +  G VFE+  V  S V G   P              F A G+S+++HP+NP VP  
Sbjct: 52  TRVMTDGLVFEQGGVNFSHVTGQQMPASATAHRPELAGRRFEAMGVSLVMHPHNPFVPTS 111

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R         T  +WFGGG DLTP        +  DV  +H T + +CS      Y
Sbjct: 112 HANVRFFIAEKEGETPIWWFGGGFDLTPFYP-----FLEDVQAWHATARTLCSPFGDQVY 166

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCD YF+LPHR E+RG+GG+FFD L+  P        F+++ AVG  + + Y  +
Sbjct: 167 AEHKAWCDDYFFLPHRNETRGVGGLFFDDLNQWP----FAECFAYMQAVGKGYTEAYLPI 222

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V R     + E  RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 VARRKETAYGEAQRQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW 280


>gi|56698473|ref|YP_168848.1| coproporphyrinogen III oxidase [Ruegeria pomeroyi DSS-3]
 gi|56680210|gb|AAV96876.1| coproporphyrinogen III oxidase, aerobic [Ruegeria pomeroyi DSS-3]
          Length = 294

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 161/302 (53%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKEDLG 71
             E  K  +   F +L+  I   FE LE+  A    +  +P  F V    R      D G
Sbjct: 1   MFETEKSTASAWFRDLRDQIVAAFEGLEDSHAEGPFSEMAPGRFEVTETTRQSDDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STVYG        +   +  I G   +P FWA+G+S++ H
Sbjct: 61  GGLMSVMRGGRVFEKVGVNISTVYGTLGERAQAAMAARKGIPGMADDPRFWASGISLVAH 120

Query: 126 PYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T   +WFGGG DL P +E     Y  D   FH T +     H 
Sbjct: 121 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YAEDTAHFHATQRAHLDPHG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
             +Y   K W D YFY+PHR+ +RG+GGIF D L +    G   ADF+    +G  F+  
Sbjct: 176 SEHYPRLKAWADEYFYIPHRKRARGVGGIFMDDLCT----GDWQADFALTQDIGRAFLPA 231

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y SLV R     F E +++ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL 
Sbjct: 232 YLSLVERRRVQPFDEAEKEAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLA 291

Query: 305 AW 306
            W
Sbjct: 292 KW 293


>gi|109896361|ref|YP_659616.1| coproporphyrinogen III oxidase [Pseudoalteromonas atlantica T6c]
 gi|109698642|gb|ABG38562.1| Coproporphyrinogen oxidase [Pseudoalteromonas atlantica T6c]
          Length = 307

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 117/307 (38%), Positives = 158/307 (51%), Gaps = 34/307 (11%)

Query: 6   IEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKS 65
           +      DIE      ++   +LQ  IC   E  + +            F   +W R+  
Sbjct: 1   MPQPHVTDIES----VKQFLLDLQDNICQTLEMADGK----------GSFIEDNWQRE-- 44

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGGR   L  G+V E+  V  S VYG   P              F A G+S+++H
Sbjct: 45  ---LGGGGRTRVLTNGQVIEQGGVNFSHVYGGQLPASATASRPELAGRSFQAMGVSLVIH 101

Query: 126 PYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           P NPHVP  H N+R+ +         +WFGGG DLTP           DV+ +H T K++
Sbjct: 102 PKNPHVPTSHANVRIFIAEKEGEEPIWWFGGGFDLTPFYP-----VHEDVLHWHQTAKDL 156

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGD 239
           C       Y+ YK+WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ AVG+
Sbjct: 157 CEPFGKDVYSKYKKWCDDYFYLKHRDETRGVGGLFFDDLNEW----GFERSFAFMQAVGN 212

Query: 240 CFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILAS 299
            F+  Y  ++ +     FSEQ+R  QL RRGRY EFNL++D+GT FG +TGG  ESIL S
Sbjct: 213 GFLDAYVPILEKRKDTSFSEQERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMS 272

Query: 300 MPPLVAW 306
           MPPL  W
Sbjct: 273 MPPLARW 279


>gi|301022324|ref|ZP_07186216.1| coproporphyrinogen III oxidase [Escherichia coli MS 69-1]
 gi|300397577|gb|EFJ81115.1| coproporphyrinogen III oxidase [Escherichia coli MS 69-1]
          Length = 299

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSTVDGT-----------EFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEDDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTNAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 TMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|332162548|ref|YP_004299125.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666778|gb|ADZ43422.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 313

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 159/306 (51%), Gaps = 32/306 (10%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD         +    +LQ  IC    + +  A           FT ++W+R++   
Sbjct: 1   MNLPDI-----DQIKTYLLDLQDKICAALAQADGSA----------KFTEENWVREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   +  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVMVKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPN 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T   +C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPDEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMG-GIDADFSFISAVGDC 240
                 YT YK+WCD YFY+ HR E+RGIGG+FFD L+S        D  F+F  AVGD 
Sbjct: 156 PFDEQLYTRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSDDLNSPDFDTCFNFTQAVGDG 215

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SM
Sbjct: 216 FLDAYMPIVARRKALCWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSM 275

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 276 PPLVRW 281


>gi|149913904|ref|ZP_01902436.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. AzwK-3b]
 gi|149812188|gb|EDM72019.1| coproporphyrinogen III oxidase, aerobic [Roseobacter sp. AzwK-3b]
          Length = 296

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 120/304 (39%), Positives = 158/304 (51%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQKE 68
              ++ E K+ +   F  L+  I   FE LE+  A    ++     F V    R      
Sbjct: 1   MSGEMLEEKQRAAAWFRQLRDEIVAAFEGLEDSHATGPMSDAPAARFEVTETKRSSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG-----DLSPDFKDQILGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V VS VYG              + G   +P FWA+G+S++
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNVSEVYGSLGAAAQQAMAARGVPGMESDPRFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T  A+WFGGG DL P LE     YD D   FH T K     
Sbjct: 121 AHMQNPHCPAVHMNTRMFWTPGAWWFGGGSDLNPCLE-----YDEDTAHFHATQKAHLDP 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A Y   K W D YFY+PHR  +RG+GGIF D  ++    G  +ADF+    +G  F+
Sbjct: 176 HDEALYPALKAWADEYFYVPHRNRARGVGGIFMDDRNT----GDWEADFALTQDIGRAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV +     +SE D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PP
Sbjct: 232 PAYVPLVEQRRVQDWSEADKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPP 291

Query: 303 LVAW 306
           L  W
Sbjct: 292 LAKW 295


>gi|56412663|ref|YP_149738.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361598|ref|YP_002141234.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|62510576|sp|Q5PI28|HEM6_SALPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740899|sp|B5BB50|HEM6_SALPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|56126920|gb|AAV76426.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093074|emb|CAR58513.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 308

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|257485579|ref|ZP_05639620.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289627015|ref|ZP_06459969.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289647921|ref|ZP_06479264.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298484633|ref|ZP_07002737.1| Coproporphyrinogen III oxidase, aerobic [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160857|gb|EFI01874.1| Coproporphyrinogen III oxidase, aerobic [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326687|gb|EFW82732.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331339|gb|EFW87282.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330867906|gb|EGH02615.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330985716|gb|EGH83819.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331011867|gb|EGH91923.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 304

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|119471687|ref|ZP_01614072.1| coproporphyrinogen III oxidase [Alteromonadales bacterium TW-7]
 gi|119445466|gb|EAW26753.1| coproporphyrinogen III oxidase [Alteromonadales bacterium TW-7]
          Length = 316

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 145/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +  F  LQ  IC   E  +  A           F    W R +      GGGR    
Sbjct: 7   EQVKAYFMALQDTICQGLEAADGSA----------KFVEDSWQRAEG-----GGGRTRVT 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NPHVP  H N+
Sbjct: 52  TDGNVIEQGGVNYSHVFGASMPGSATAHRPELAGRSFHACGVSLVIHPKNPHVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV  +H    ++C       Y+ YK
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----VFEDVQHWHQVAHDICVPFGSDVYSKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E+RG+GG+FFD L+      G +  F+F+ +VG+ F+  Y  ++ R 
Sbjct: 167 TWCDEYFYLKHRDETRGVGGLFFDDLNE----LGFEQSFAFMQSVGNGFLDAYIPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 223 KNDEYTEQQRDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|330976429|gb|EGH76484.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 286

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGSAH----------FMEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGEDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|238759434|ref|ZP_04620598.1| Coproporphyrinogen III oxidase [Yersinia aldovae ATCC 35236]
 gi|238702331|gb|EEP94884.1| Coproporphyrinogen III oxidase [Yersinia aldovae ATCC 35236]
          Length = 308

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 156/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD  + +          LQ  IC    + +  A           FT + W R++   
Sbjct: 1   MNSPDITQIK-----TYLLALQDKICAALAQADGHAA----------FTEESWTREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLVNGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T  ++C 
Sbjct: 101 SPYLPTSHANVRFFIAEKAGEDPVWWFGGGFDLTPY-----YGFEEDAIHWHQTAHQLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+F+D L+S          F+F  AVGD F
Sbjct: 156 PFGDEVYPRYKKWCDDYFYIKHRDEARGIGGLFYDDLNSP----DFGTCFNFTQAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LAAYMPIVARRKALSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|126732065|ref|ZP_01747867.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
 gi|126707354|gb|EBA06418.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
          Length = 293

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 118/301 (39%), Positives = 156/301 (51%), Gaps = 16/301 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKEDLG 71
            +   K  +   F +L+  I   FE LE+  H    A      F V    R      D G
Sbjct: 1   MMTAEKDRASTWFRDLRDQIVAAFEALEDSHHAGPFAEADAGRFEVTQTTRHSDDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVIVHP 126
           GG M+ +  G+VFEK  V VSTVYG              + G   +P FWA+G+S++ H 
Sbjct: 61  GGLMSVMRGGRVFEKVGVNVSTVYGTLGVPAQQAMAARGVPGIEDDPRFWASGISLVAHM 120

Query: 127 YNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH PAVH N RM  T  A+WFGGG DL P +E     YD D   FH T K     H  
Sbjct: 121 QNPHCPAVHMNTRMFWTPGAWWFGGGSDLNPCIE-----YDEDTAHFHATQKAHLDPHGD 175

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
            +Y   K W D YFY+PHR+ +RG+GGIF D  +S    G  +ADF+    +G  F+  +
Sbjct: 176 EHYPALKAWADEYFYIPHRKRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLPAF 231

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             L  +     FS+ D+  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+PPL  
Sbjct: 232 VPLTEKRRTQPFSDADKDVQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSLPPLAK 291

Query: 306 W 306
           W
Sbjct: 292 W 292


>gi|212710608|ref|ZP_03318736.1| hypothetical protein PROVALCAL_01674 [Providencia alcalifaciens DSM
           30120]
 gi|212686689|gb|EEB46217.1| hypothetical protein PROVALCAL_01674 [Providencia alcalifaciens DSM
           30120]
          Length = 307

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   ++LQ  IC     L+ +          + F  + W R +      GGGR   L
Sbjct: 7   DRVKAYLQSLQDTICQRITALDGK----------ETFLEQTWERAEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S + G+  P              + A G+S+++HP NP++P  H N+
Sbjct: 52  TQGALFEQAGVNFSHIKGEKLPASATAHRPELAGRSYQAMGVSLVIHPLNPYIPTTHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ DV+ +H+    +C+ +    Y  +K
Sbjct: 112 RFFIAEKEGMEPVWWFGGGFDLTPY-----YGFEEDVVHWHSVANALCAPYGDEVYPKFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RGIGG+F+D L+        +  F+F   VG+ F++ Y  +V + 
Sbjct: 167 QWCDDYFFLKHRNEPRGIGGLFYDDLNQW----DFETCFAFTQDVGNGFLQAYVPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 223 REIPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|119773192|ref|YP_925932.1| coproporphyrinogen III oxidase [Shewanella amazonensis SB2B]
 gi|166217815|sp|A1S1K6|HEM6_SHEAM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|119765692|gb|ABL98262.1| Coproporphyrinogen oxidase [Shewanella amazonensis SB2B]
          Length = 304

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 159/305 (52%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +G P+  E      +     LQ+ IC   E+L+ +A           F    W R +   
Sbjct: 1   MGLPNAEE-----VKAFLMQLQANICAGLERLDGQAS----------FATDSWQRAEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGG    L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGISRVLTDGAVFEQAGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPK 100

Query: 128 NPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP++P  H N+R  +         +WFGGG DLTP        ++ DV  +H + K++C+
Sbjct: 101 NPYIPTTHANVRFFIARKEGADPVWWFGGGFDLTPYYP-----FESDVKEWHQSAKDLCA 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YKEWCD+YF+LPHR E+RG+GG+FFD L+        D  F ++ AVG+ F
Sbjct: 156 PFGNEVYPKYKEWCDKYFFLPHRGETRGVGGLFFDDLNHWE----FDKCFDYMQAVGNGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++R  QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMP
Sbjct: 212 LTAYAPIVERRKDTAYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|157371701|ref|YP_001479690.1| coproporphyrinogen III oxidase [Serratia proteamaculans 568]
 gi|167008825|sp|A8GHH2|HEM6_SERP5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157323465|gb|ABV42562.1| Coproporphyrinogen oxidase [Serratia proteamaculans 568]
          Length = 306

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 153/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  ICT+  + +  A           F    W R++      GGGR   L
Sbjct: 7   AEVKTFLLALQDRICTQLAQADGSAV----------FNEDRWTREEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 52  TEGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQAMGVSLVIHPRSPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T + +C+      Y  YK
Sbjct: 112 RFFIAEKPGEEPVWWFGGGFDLTPF-----YGFEEDAVHWHRTAERLCAPFGEQVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD L++          F+F  AVG+ F++ Y  +V + 
Sbjct: 167 KWCDDYFFIKHRNEARGIGGLFFDDLNTP----DFATCFAFTQAVGEGFLEAYLPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + + +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KTLSWGDHERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|146305101|ref|YP_001185566.1| coproporphyrinogen III oxidase [Pseudomonas mendocina ymp]
 gi|166217809|sp|A4XNB8|HEM6_PSEMY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|145573302|gb|ABP82834.1| Coproporphyrinogen oxidase [Pseudomonas mendocina ymp]
          Length = 304

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 108/299 (36%), Positives = 152/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + +R    +    +LQ  IC   E  + +A          +F    W R        GGG
Sbjct: 1   MTDRTEAVKAYLLDLQDRICAALEAEDGQA----------LFREDAWQR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G + EK  V  S V+GD  P              F A G+S+++HP NP+VP 
Sbjct: 46  RTRVIENGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPYVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R            +WFGGG DLTP   +     + D  ++H    + C+      
Sbjct: 106 SHANVRFFSAEKEGEEPVWWFGGGFDLTPYYAN-----EEDCRYWHQVAFDACAPFGAEV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  +K WCDRYF+L HR E RGIGG+FFD L+        D  F+F+ A+GD +I+ Y  
Sbjct: 161 YPRFKAWCDRYFHLKHRGEPRGIGGLFFDDLNEW----DFDTCFAFMRAIGDAYIQAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     F E++R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 217 IVQRRKLTPFGEREREFQAFRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPMVRW 275


>gi|75911192|ref|YP_325488.1| coproporphyrinogen III oxidase [Anabaena variabilis ATCC 29413]
 gi|75704917|gb|ABA24593.1| coproporphyrinogen oxidase [Anabaena variabilis ATCC 29413]
          Length = 347

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 166/328 (50%), Gaps = 43/328 (13%)

Query: 2   NLCTIEIGCPDDI-EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           N   + I   + I ++ ++ SQ+  +NLQ  ICT  E+++ +A           F   +W
Sbjct: 14  NHTELLISPTNTIPKDSRQRSQQFMQNLQDEICTALEQIDGKAS----------FHQDYW 63

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R +      G GR   +  G+VFE+  V  S V+G+  P              F+ATG 
Sbjct: 64  ERAEG-----GEGRTRVIREGRVFEQGGVNFSAVWGNSLPASILAQRPEAAGHEFFATGT 118

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP NP+VP VH N R       +WFGGG DLTP      ++++ D + FH TLK  
Sbjct: 119 SMVLHPRNPYVPTVHLNYRYFEAGPIWWFGGGADLTPY-----YAFEEDAVHFHQTLKNA 173

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE---------------- 223
           C  H    Y  +K WCD YFYL HRQE RGIGGIFFD+  +S +                
Sbjct: 174 CDVHNPEYYPAFKRWCDEYFYLRHRQEQRGIGGIFFDYQDASGKLYIGTQADSPAAIYSQ 233

Query: 224 -----MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  F+F+ + G  F+  Y  +V R     + ++ R  QL RRGRY EFNL+
Sbjct: 234 KVGNVTRNWEDIFAFVQSCGQAFLPAYLPIVERRQATEYGDRQRNFQLYRRGRYVEFNLV 293

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           YD+GT FG +T G  ESIL S+PPL  W
Sbjct: 294 YDRGTVFGLQTKGRTESILMSLPPLARW 321


>gi|304321661|ref|YP_003855304.1| coproporphyrinogen III oxidase, aerobic [Parvularcula bermudensis
           HTCC2503]
 gi|303300563|gb|ADM10162.1| coproporphyrinogen III oxidase, aerobic [Parvularcula bermudensis
           HTCC2503]
          Length = 294

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 140/297 (47%), Positives = 186/297 (62%), Gaps = 7/297 (2%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSA-NRSPKIFTVKHWLRDKSQKEDL 70
            D+  R+  ++  FE L+  I   FE +E++  E    ++    FT+  W R    ++  
Sbjct: 4   PDLPPRQAKAKAWFETLRDKIVAAFEAIEDKGSEALYGDQPAGRFTLTPWRRGDGTEDQG 63

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GG     +  G+VFEKA + VSTV+G+ SP+F+ QI G  ++P FWA+G+S+I HP NPH
Sbjct: 64  GGV--MGMLHGRVFEKAGIHVSTVFGEFSPEFRSQIPGAEEDPRFWASGISLIAHPLNPH 121

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPA H N RMIVT   WFGGG DL P   + R     D  FF + ++  C +     +  
Sbjct: 122 VPAAHMNTRMIVTTKCWFGGGGDLNPMHPAYRDEDHEDARFFLDAMRGACDRRDPHYFAR 181

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +KE CD YF+LPHR E RG+GGIF+DH +S    G  + DF+F   VG  F+  YP+LV 
Sbjct: 182 FKEACDTYFFLPHRGEPRGVGGIFYDHHNS----GDWEDDFAFTKDVGLAFLDSYPALVH 237

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           R     +SE+DRQ QL +RGRYAEFNLLYD+GT FG KTGGNVESIL+S+PPL AWP
Sbjct: 238 RRLETPWSEEDRQLQLRQRGRYAEFNLLYDRGTTFGLKTGGNVESILSSLPPLTAWP 294


>gi|238764739|ref|ZP_04625682.1| Coproporphyrinogen III oxidase [Yersinia kristensenii ATCC 33638]
 gi|238697030|gb|EEP89804.1| Coproporphyrinogen III oxidase [Yersinia kristensenii ATCC 33638]
          Length = 308

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 158/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD         +    +LQ  IC    + + +A           FT ++W+R++   
Sbjct: 1   MNLPDI-----DQIKTYLLDLQDNICAALAQADGKAE----------FTEENWVREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLVKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPN 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T   +C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPGENPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCH 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+FFD L+S          F+F  AVG+ F
Sbjct: 156 PFGEQIYPRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSP----DFATCFNFTQAVGNGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LDAYMPIVARRRALSWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|254515968|ref|ZP_05128028.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR5-3]
 gi|219675690|gb|EED32056.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR5-3]
          Length = 310

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 107/299 (35%), Positives = 157/299 (52%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E     ++    LQ  IC    +++ +A           F+V+ W R      + GGG
Sbjct: 1   MSEMIDQVKQYLLGLQDSICEGLAQVDGKAD----------FSVEEWDR-----PEGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G V EKA V  S V GD  P     +        + A G+S+++HP NP+ P 
Sbjct: 46  RSRVLVDGAVLEKAGVNFSHVMGDSLPASATAVRPELAGRSYQALGVSLVIHPRNPYAPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R+ +         +WFGGG DLTP      + +D D + +H T  + C+      
Sbjct: 106 SHANVRLFIAEKPGEEPVWWFGGGYDLTPY-----YGFDEDCVHWHRTAADACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HR E RG+GG+F+D L+S       +  F+F+ A+GD ++  Y  
Sbjct: 161 YPRYKKWCDDYFYLKHRDEPRGVGGLFYDDLNSW----DFETCFAFMRAIGDSYLDAYRP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           ++ R       +++RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPLV W
Sbjct: 217 ILERRKDTPCGDRERQFQLYRRGRYVEFNLVFDRGTLFGLQSNGRTEAILMSLPPLVRW 275


>gi|213421057|ref|ZP_03354123.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 296

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFIEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|91226312|ref|ZP_01261152.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
 gi|91189323|gb|EAS75602.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
          Length = 305

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 110/297 (37%), Positives = 157/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++   +LQ  IC + E+ + +A           F    W R+  ++   GGGR 
Sbjct: 4   IDKHAVKQFLMSLQDSICQQLEQEDGKAV----------FVEDAWHREPGER-LGGGGRS 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMRDGLVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVIHPKNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +H+T K +C+      Y 
Sbjct: 113 ANVRFFIAEKDGEDPIWWFGGGFDLTPFYP-----FEEDCQSWHDTAKLLCAPFGDDVYQ 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YF+LPHR E+RG+GG+FFD L+        D  F++I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDKYFFLPHRNETRGVGGLFFDDLNQWE----FDKCFAYIKAVGEGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 SRRKEFKYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|71281546|ref|YP_270654.1| coproporphyrinogen III oxidase [Colwellia psychrerythraea 34H]
 gi|71147286|gb|AAZ27759.1| coproporphyrinogen III oxidase, aerobic [Colwellia psychrerythraea
           34H]
          Length = 312

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 155/305 (50%), Gaps = 32/305 (10%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +    +IE    I+   F++LQ  IC   E+ +              F   +W R +   
Sbjct: 5   LSSTANIEITPIIA--FFKSLQDKICQALEEADG----------TGKFVEDNWKRKEG-- 50

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   +  G V E+  V  S V GD  P              + A G+S+++HP 
Sbjct: 51  ---GGGRTRVMTDGTVVEQGGVNFSVVSGDKLPPSATAHRPELAGRTWQACGVSLVIHPK 107

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NP++P  H N+R  +         +WFGGG DLTP   +     D D+  +H T  ++C 
Sbjct: 108 NPNIPTSHANVRFFIAEKEGEKPVWWFGGGFDLTPFYPN-----DEDIQHWHQTAHDLCQ 162

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  +K+WCD YFYL HR E+RG+GG+FFD L+        D  F ++ AVG  F
Sbjct: 163 PFGDNVYNDHKKWCDEYFYLKHRDETRGVGGLFFDDLNQW----DFDTCFDYVKAVGQGF 218

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           I  Y  +++R     F EQ+RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMP
Sbjct: 219 IDAYVPIMQRRKDEAFGEQERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMP 278

Query: 302 PLVAW 306
           PL  W
Sbjct: 279 PLARW 283


>gi|77359011|ref|YP_338586.1| coproporphyrinogen III oxidase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76873922|emb|CAI85143.1| coproporphyrinogen III oxidase [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 324

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +  F  LQ  I    E  + +A           F   +W R      + GGGR   +
Sbjct: 15  EQVKAYFMALQDTISQGLEAADGKA----------KFIEDNWQR-----SEGGGGRTRVI 59

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + E+  V  S V+G   P              F A G+S+++HP NPH+P  H N+
Sbjct: 60  TNGNIIEQGGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLVIHPKNPHIPTSHANV 119

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV+ +H    ++C+      Y  YK
Sbjct: 120 RFFIAEKEGEQPIWWFGGGFDLTPFYP-----VLDDVVHWHQVAHDLCAPFGDELYPKYK 174

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E+RG+GG+FFD L+      G +  F+F  AVG+ F++ Y  ++ R 
Sbjct: 175 TWCDEYFYLKHRDETRGVGGLFFDDLNE----LGFEQSFAFTQAVGNGFLEAYLPIIERR 230

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               ++ Q R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 231 KKDEYTAQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 284


>gi|86605573|ref|YP_474336.1| coproporphyrinogen III oxidase [Synechococcus sp. JA-3-3Ab]
 gi|86554115|gb|ABC99073.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp.
           JA-3-3Ab]
          Length = 337

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 117/333 (35%), Positives = 155/333 (46%), Gaps = 52/333 (15%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           L       P D    ++   +   +LQ  IC   E L+ +A           F    W R
Sbjct: 2   LTASPTAPPTDA---RQRVSQFMRHLQDEICARLEALDGKA----------KFREDSWER 48

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
                   GGGR   +  G VFE+  V  S V+G   P    +         F+ATG S+
Sbjct: 49  -----PGGGGGRSRVIQQGGVFEQGGVNFSEVFGSQLPPSICKQRPEAAGHPFYATGTSM 103

Query: 123 IVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           ++HP NP+VP VH N R       +WFGGG+DLTP      + ++ D   FH T K  C 
Sbjct: 104 VLHPRNPYVPTVHLNYRYFEAGPVWWFGGGMDLTPY-----YLFEEDAAHFHRTAKAACD 158

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE------------------ 223
           +   A Y  +K WCDRYF+LPHR E+RG+GGIFFD+    P                   
Sbjct: 159 RLDPAYYPAFKIWCDRYFFLPHRGEARGVGGIFFDYQDDRPGLLYRPEGEAEADPEQLAA 218

Query: 224 ----------MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYA 273
                         +  F  + A  + F+  Y  +V R     + E++RQ QL RRGRY 
Sbjct: 219 EPPPLQVRVGSRSWEHLFELVQACAEAFLPAYVPIVERRQGMEWGERERQFQLYRRGRYV 278

Query: 274 EFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EFNL+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 279 EFNLVYDRGTVFGLQTQGRTESILMSLPPLVRW 311


>gi|22125348|ref|NP_668771.1| coproporphyrinogen III oxidase [Yersinia pestis KIM 10]
 gi|45442431|ref|NP_993970.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51597070|ref|YP_071261.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           32953]
 gi|108808214|ref|YP_652130.1| coproporphyrinogen III oxidase [Yersinia pestis Antiqua]
 gi|108811516|ref|YP_647283.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|145599411|ref|YP_001163487.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides F]
 gi|149365107|ref|ZP_01887142.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           CA88-4125]
 gi|162419132|ref|YP_001607174.1| coproporphyrinogen III oxidase [Yersinia pestis Angola]
 gi|165926908|ref|ZP_02222740.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165935964|ref|ZP_02224534.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011267|ref|ZP_02232165.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212569|ref|ZP_02238604.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398417|ref|ZP_02303941.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422685|ref|ZP_02314438.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424551|ref|ZP_02316304.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170023635|ref|YP_001720140.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis YPIII]
 gi|186896158|ref|YP_001873270.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis PB1/+]
 gi|218930077|ref|YP_002347952.1| coproporphyrinogen III oxidase [Yersinia pestis CO92]
 gi|229838627|ref|ZP_04458786.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895693|ref|ZP_04510864.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides A]
 gi|229899193|ref|ZP_04514336.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901781|ref|ZP_04516903.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|270489971|ref|ZP_06207045.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis KIM D27]
 gi|294504781|ref|YP_003568843.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|21362586|sp|Q8ZCF9|HEM6_YERPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|62510607|sp|Q668I6|HEM6_YERPS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122383096|sp|Q1C5T7|HEM6_YERPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122384927|sp|Q1CJZ7|HEM6_YERPN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217823|sp|A4TMK2|HEM6_YERPP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740910|sp|B2K962|HEM6_YERPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740911|sp|A9QZK6|HEM6_YERPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740912|sp|B1JSJ6|HEM6_YERPY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|21958229|gb|AAM85022.1|AE013748_4 coproporphyrinogen III oxidase [Yersinia pestis KIM 10]
 gi|45437296|gb|AAS62847.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51590352|emb|CAH21992.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775164|gb|ABG17683.1| coproporphyrinogen oxidase [Yersinia pestis Nepal516]
 gi|108780127|gb|ABG14185.1| coproporphyrinogen oxidase [Yersinia pestis Antiqua]
 gi|115348688|emb|CAL21634.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis CO92]
 gi|145211107|gb|ABP40514.1| coproporphyrinogen oxidase [Yersinia pestis Pestoides F]
 gi|149291520|gb|EDM41594.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia pestis
           CA88-4125]
 gi|162351947|gb|ABX85895.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis Angola]
 gi|165916109|gb|EDR34716.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921259|gb|EDR38483.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989945|gb|EDR42246.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206500|gb|EDR50980.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958392|gb|EDR55413.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050921|gb|EDR62329.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056433|gb|EDR66202.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750169|gb|ACA67687.1| Coproporphyrinogen oxidase [Yersinia pseudotuberculosis YPIII]
 gi|186699184|gb|ACC89813.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis PB1/+]
 gi|229681710|gb|EEO77804.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|229687595|gb|EEO79668.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694993|gb|EEO85040.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701499|gb|EEO89527.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides A]
 gi|262362843|gb|ACY59564.1| coproporphyrinogen III oxidase [Yersinia pestis D106004]
 gi|262366767|gb|ACY63324.1| coproporphyrinogen III oxidase [Yersinia pestis D182038]
 gi|270338475|gb|EFA49252.1| coproporphyrinogen III oxidase, aerobic [Yersinia pestis KIM D27]
 gi|294355240|gb|ADE65581.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|320014410|gb|ADV97981.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 309

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
            + +     LQ  IC    + +  A           FT + W+R++      GGGR   L
Sbjct: 7   ALIKTYLLTLQDNICAALAQADGHAE----------FTEECWVREEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G + P              F A G+S+++HP NP++P  H N+
Sbjct: 52  VNGAVFEQAGVNFSHVSGAMLPASATAHRPELAGRSFQALGVSLVIHPLNPYLPTSHANV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H     +C       Y  YK
Sbjct: 112 RFFIAEKPGEDAVWWFGGGFDLTPY-----YGFEEDAIHWHQVAHSLCQPFGEQIYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HRQE+RGIGG+FFD L+S          F+F  AVGD F+  Y  +V R 
Sbjct: 167 KWCDDYFYIKHRQEARGIGGLFFDDLNSP----DFMTCFNFTQAVGDGFLAAYMPIVARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 KALGWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|262089751|gb|ACY24845.1| HemF coproporphyrinogen III oxidase [uncultured organism]
          Length = 290

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 113/286 (39%), Positives = 148/286 (51%), Gaps = 30/286 (10%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
           +LQ  IC      +  A           F   +W R +      GGGR   L  G   EK
Sbjct: 2   DLQDRICNALAAEDGGAG----------FVEDNWTRAEG-----GGGRTRVLANGVAIEK 46

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT--- 143
             V  S VYG   P              F A G+S+++HP NP+ P  H N+R  +    
Sbjct: 47  GGVNFSHVYGAHMPASATAHRPELAGRAFEAMGVSLVIHPNNPYAPTSHANVRFFIAEKD 106

Query: 144 ---GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY 200
                +WFGGG DLTP   +     + DVI +H T K  C       Y  YK+WCD YFY
Sbjct: 107 GAEPVWWFGGGYDLTPYYGN-----EADVIHWHQTAKNACEPFGDDIYPRYKKWCDDYFY 161

Query: 201 LPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQ 260
           L HR E+RG+GG+FFD L+      G D  F+F+ AVGD ++  Y  ++    +  +SE+
Sbjct: 162 LKHRNEARGVGGLFFDDLND----QGFDQSFAFLRAVGDSYVPAYQPILAARKNMPYSER 217

Query: 261 DRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 218 EREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLVRW 263


>gi|204929614|ref|ZP_03220688.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321333|gb|EDZ06533.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 299

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RG+GG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGVGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|238799202|ref|ZP_04642652.1| Coproporphyrinogen III oxidase [Yersinia mollaretii ATCC 43969]
 gi|238716960|gb|EEQ08826.1| Coproporphyrinogen III oxidase [Yersinia mollaretii ATCC 43969]
          Length = 308

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 158/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD  + +         +LQ  IC      +  A           F  ++W R++   
Sbjct: 1   MNLPDITQIK-----TYLLDLQDKICVALAAADGSA----------TFAEENWTREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P           +  F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLINGAVFEQAGVNFSHVSGATLPASATAHRPELADRSFQALGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D + +H T  ++C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPGEDPVWWFGGGFDLTPF-----YGFEEDAVHWHKTAYQLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+FFD L+S       D  FSF  AVGD F
Sbjct: 156 PFGEQIYPRYKKWCDDYFYIKHRHEARGIGGLFFDDLNSP----DFDTCFSFTQAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LDAYLPIVARRKTLSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|88860591|ref|ZP_01135228.1| coproporphyrinogen III oxidase [Pseudoalteromonas tunicata D2]
 gi|88817186|gb|EAR27004.1| coproporphyrinogen III oxidase [Pseudoalteromonas tunicata D2]
          Length = 303

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E+ + +A           F    W R +      GGGR   +
Sbjct: 7   ETVKSFLLDLQDRICAGLEQADGDA----------KFVEDAWQRAEG-----GGGRTRVI 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NPH+P  H N+
Sbjct: 52  TNGAVIEQGGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLVIHPKNPHIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV  +H   K +CS      Y  YK
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----VLEDVKHWHQVAKNLCSPFGETVYDDYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E+RG+GG+FFD L++     G D  F+F+ AVG+ F+  Y  ++ + 
Sbjct: 167 KWCDEYFYLKHRGETRGVGGLFFDDLNTW----GFDKSFAFMQAVGNGFLDAYIPIIEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   ++  R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 223 KNTPVTQIQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|187731800|ref|YP_001881234.1| coproporphyrinogen III oxidase [Shigella boydii CDC 3083-94]
 gi|226740903|sp|B2TX24|HEM6_SHIB3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|187428792|gb|ACD08066.1| coproporphyrinogen III oxidase, aerobic [Shigella boydii CDC
           3083-94]
          Length = 299

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
              VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NDGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|66043295|ref|YP_233136.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|302186433|ref|ZP_07263106.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           642]
 gi|75504057|sp|Q500S4|HEM6_PSEU2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|63254002|gb|AAY35098.1| Coproporphyrinogen oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970348|gb|EGH70414.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 304

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGSAH----------FMEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGEDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|315293457|gb|EFU52809.1| coproporphyrinogen III oxidase [Escherichia coli MS 153-1]
          Length = 299

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 153/293 (52%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+       GGGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLSAVDG-----------AEFVEDSWQRE-----AGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++V+P+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVNPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDEYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|319788386|ref|YP_004147861.1| coproporphyrinogen oxidase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466898|gb|ADV28630.1| Coproporphyrinogen oxidase [Pseudoxanthomonas suwonensis 11-1]
          Length = 311

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 152/301 (50%), Gaps = 28/301 (9%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++    + +     LQ  IC   E  + +A           F    W R          G
Sbjct: 1   MDPNFELVRDYLTGLQDRICAAIEAADGQA----------RFVEDTWTRPAEAAGGSHAG 50

Query: 74  --RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
             R   L  G VFE+A +  S V G   P              + ATG+S++ HP NP++
Sbjct: 51  GGRTRILRDGAVFEQAGIGFSDVSGSRLPPSASAARPELAGASWRATGVSLVFHPRNPYL 110

Query: 132 PAVHFNIRMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N+R         T A+WFGGG DLTP        +D DV+ +H T  ++C+    
Sbjct: 111 PTTHANVRHFQARRDGETVAWWFGGGFDLTPFYP-----FDEDVVHWHRTAADLCAPFGA 165

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  +K WCD YF+L HR E+RG+GG+FFD LH        + DF+++ AVGD F+  Y
Sbjct: 166 DRYERHKRWCDDYFFLKHRNETRGVGGLFFDDLHE-----DFERDFTYLRAVGDGFLDAY 220

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V 
Sbjct: 221 LPIVERRKDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPRVR 280

Query: 306 W 306
           W
Sbjct: 281 W 281


>gi|289677577|ref|ZP_06498467.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           FF5]
          Length = 304

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGSAH----------FMEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEAVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|86610261|ref|YP_479023.1| coproporphyrinogen III oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558803|gb|ABD03760.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 337

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 119/333 (35%), Positives = 157/333 (47%), Gaps = 52/333 (15%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           L +     P D    ++   +  + LQ  IC   E L+ +A           F    W R
Sbjct: 2   LASSPTALPVDA---RQQVSQFMQRLQDDICARLEALDGKA----------KFREDRWER 48

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
                   GGGR   +  G VFE+  V  S V+G   P    +         F+ATG S+
Sbjct: 49  -----PGGGGGRSRVIQQGDVFEQGGVNFSEVFGSHLPPSILKQRPEAAGHPFYATGTSM 103

Query: 123 IVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           ++HP NP+VP VH N R       +WFGGG+DLTP      + ++ D   FH TLK  C 
Sbjct: 104 VLHPRNPYVPTVHLNYRYFEAGPVWWFGGGMDLTPY-----YLFEEDAAHFHRTLKAACD 158

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE------------------ 223
           +   A Y  +K WCDRYF+LPHR E+RG+GGIFFD+    P                   
Sbjct: 159 RLDPAYYPVFKIWCDRYFFLPHRGEARGVGGIFFDYQDERPGLLYRPEGQAEGDPEQLAS 218

Query: 224 ----------MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYA 273
                         +  F  +   GD F+  Y  +V R     + E++RQ QL RRGRY 
Sbjct: 219 EPPSLQVRVGSRSWEHLFQLVQTCGDAFLPAYVPIVERRQGMEWGERERQFQLYRRGRYV 278

Query: 274 EFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EFNL+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 279 EFNLVYDRGTIFGLQTQGRTESILMSLPPLVRW 311


>gi|119486200|ref|ZP_01620260.1| coproporphyrinogen III oxidase [Lyngbya sp. PCC 8106]
 gi|119456691|gb|EAW37820.1| coproporphyrinogen III oxidase [Lyngbya sp. PCC 8106]
          Length = 364

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 114/325 (35%), Positives = 156/325 (48%), Gaps = 44/325 (13%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
             ++  P   + +     +  + +Q  IC   E+L+ ++           F    W R  
Sbjct: 29  KTKMPNPPGADSQ-ARVSQFMKQIQDEICQGLEQLDGKS----------KFQEDSWER-- 75

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
               + GGGR   L  G VFE+  V  S V+G   P          +   F+ATG S+++
Sbjct: 76  ---PEGGGGRSRVLHDGDVFEQGGVNFSEVWGKNLPPSILAQRPEAEGHGFYATGTSMVL 132

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           HP NP++P VH N R       +WFGGG+DLTP        +  D   FH T K  C +H
Sbjct: 133 HPRNPYIPTVHLNYRYFEAGPVWWFGGGVDLTPYYP-----FAEDAAHFHKTFKVACDRH 187

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS----------------------S 221
               Y  +K WCD YFY+ HRQE+RGIGGIFFD+                         +
Sbjct: 188 HDEYYPVFKHWCDEYFYIKHRQEARGIGGIFFDYQDGQGELYRGPHSDSEAAKYSGHIGT 247

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
           PE    +A F+F+   G  F+  Y  +V R     + + +R  QL RRGRY EFNL+YD+
Sbjct: 248 PETRDWEALFAFVQDCGRAFLPGYQPIVERRRGTEYGDHERNFQLYRRGRYVEFNLVYDR 307

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 308 GTIFGLQTNGRTESILMSLPPLVRW 332


>gi|70733540|ref|YP_257179.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf-5]
 gi|123658957|sp|Q4KKQ4|HEM6_PSEF5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|68347839|gb|AAY95445.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas fluorescens
           Pf-5]
          Length = 305

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 108/299 (36%), Positives = 146/299 (48%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC   E  +  A           F    W R        GGG
Sbjct: 1   MTTRTEAVKAYLLDLQDRICAALETEDGGA----------RFIEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIGDGAVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP   +       D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGNI-----DDCVHWHRVAERACAPFGADV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF++ HR E RGIGG+FFD L+        D  F+F+ A+GD +I+ Y  
Sbjct: 161 YPRYKAWCDSYFHIKHRNEPRGIGGLFFDDLNEW----DFDTSFAFMRAIGDAYIEAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V+R     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVQRRKAAAYTAQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|37523445|ref|NP_926822.1| coproporphyrinogen III oxidase [Gloeobacter violaceus PCC 7421]
 gi|41017108|sp|Q7NEK3|HEM6_GLOVI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|35214449|dbj|BAC91817.1| coproporphyrinogen III oxidase [Gloeobacter violaceus PCC 7421]
          Length = 289

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 155/283 (54%), Gaps = 26/283 (9%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ  I +  E ++ E            F    W R++      GGGR   L  G+VF
Sbjct: 1   MQSLQDNITSRLEAVDGE----------GRFVEDLWEREEG-----GGGRSRILTEGRVF 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A +  S V+G   P    Q     +   F+ TG S+++HP NP+VP VH N R     
Sbjct: 46  ERAGIGFSEVHGSHLPPSILQQRPEAEGHPFYVTGTSMVLHPRNPYVPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP      + +  D   FH TLK  C  H    Y  +K+WCD YFYL H
Sbjct: 106 PVWWFGGGADLTPY-----YGFVEDAAHFHATLKAACDAHDPEYYPRFKKWCDEYFYLKH 160

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           RQE RG+GGIFFD++      G  +  F+F  + G+ F+  Y  +V R +   ++E++R 
Sbjct: 161 RQEPRGVGGIFFDYV-----QGDWEKIFAFAQSCGNAFLPAYLPIVERRHTLPYAERERN 215

Query: 264 EQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            QL RRGRY EFNL++D+GT FG +T G +ESIL SMPPLV W
Sbjct: 216 FQLYRRGRYVEFNLVWDRGTIFGLQTNGRIESILMSMPPLVRW 258


>gi|123441508|ref|YP_001005494.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166217822|sp|A1JL37|HEM6_YERE8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|122088469|emb|CAL11261.1| coproporphyrinogen III oxidase, aerobic HemF [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 308

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 156/294 (53%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC    + +  A           FT ++W+R++      GGGR   +
Sbjct: 7   DQIKTYLLDLQDKICAALAQADGSA----------KFTEENWVREEG-----GGGRSRVM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 52  VKGAVFEQAGVNFSHVSGAALPASATAHRPELAGRSFQALGVSLVIHPNSPYLPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H T   +C       Y+ YK
Sbjct: 112 RFFIAEKPDEDPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAYNLCQPFGEQLYSRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HR E+RGIGG+FFD L+S       D  F+F  AVGD F+  Y  +V R 
Sbjct: 167 KWCDDYFYIKHRNEARGIGGLFFDDLNSP----DFDTCFNFTQAVGDGFLDAYMPIVARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KALCWGEREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|322613807|gb|EFY10746.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619449|gb|EFY16325.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624954|gb|EFY21783.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629603|gb|EFY26379.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633967|gb|EFY30704.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635596|gb|EFY32307.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639959|gb|EFY36632.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644351|gb|EFY40892.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652123|gb|EFY48485.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655286|gb|EFY51595.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658332|gb|EFY54598.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664332|gb|EFY60529.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668437|gb|EFY64593.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673227|gb|EFY69333.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676619|gb|EFY72687.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683369|gb|EFY79383.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685745|gb|EFY81738.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192577|gb|EFZ77806.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196860|gb|EFZ82003.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202116|gb|EFZ87174.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208049|gb|EFZ92994.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212825|gb|EFZ97634.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217094|gb|EGA01816.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323226754|gb|EGA10947.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229217|gb|EGA13341.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235468|gb|EGA19552.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237346|gb|EGA21409.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245101|gb|EGA29102.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248993|gb|EGA32916.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253091|gb|EGA36923.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255890|gb|EGA39635.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261787|gb|EGA45355.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266429|gb|EGA49917.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269741|gb|EGA53191.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 299

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTQAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|289209439|ref|YP_003461505.1| coproporphyrinogen oxidase [Thioalkalivibrio sp. K90mix]
 gi|288945070|gb|ADC72769.1| Coproporphyrinogen oxidase [Thioalkalivibrio sp. K90mix]
          Length = 309

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 153/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
                  + LQ  IC   E L+ +A           F    W R        GGGR   +
Sbjct: 9   DRVIDYLQGLQDRICQGLEGLDGQA----------RFQEDAWER-----PAGGGGRTRVM 53

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V GD  P              F ATG+S+++HP+NP+VP  H N+
Sbjct: 54  HEGRVFEQAGVNFSHVMGDNLPASATAHRPEMAGRSFQATGVSLVIHPHNPYVPTSHANV 113

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + +D D I +H T +  C       Y  +K
Sbjct: 114 RFFIAEKPGEEPIWWFGGGFDLTPY-----YGFDEDCIHWHRTAEAACRPFGEHLYPAHK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GG+FFD        GG +  F ++ +VG+ ++  Y  +V R 
Sbjct: 169 QWCDEYFHLKHRDEPRGVGGLFFDDFSE----GGFEHAFGYMQSVGNAYLDAYGPIVERR 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 225 HATEYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 278


>gi|300717880|ref|YP_003742683.1| Coproporphyrinogen III oxidase, aerobic [Erwinia billingiae Eb661]
 gi|299063716|emb|CAX60836.1| Coproporphyrinogen III oxidase, aerobic [Erwinia billingiae Eb661]
          Length = 302

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++    LQ  IC +  K + +A+          F    W R+        GGR   L
Sbjct: 7   AQVKQFLLTLQDSICQQLAKADGKAN----------FEEDSWDREGGG-----GGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S V+GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  RNGAIFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSLVIHPENPYLPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG D+TP      + +  D + +H T  ++C       Y  YK
Sbjct: 112 RFFIAEKPGADPVWWFGGGFDMTPY-----YGFAEDAVHWHQTASDLCQPFGEEVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E RGIGG+FFD L++       D  F F  AVG+ F++ Y  ++ R 
Sbjct: 167 KWCDDYFFIKHRNEQRGIGGLFFDDLNTP----DFDHCFRFTQAVGEGFLQAYLPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KGLSWGERERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|168261517|ref|ZP_02683490.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205349335|gb|EDZ35966.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 299

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 153/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDYCFVFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|17228852|ref|NP_485400.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
 gi|21542081|sp|Q8YX58|HEM62_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic 2;
           Short=Coprogen oxidase 2; Short=Coproporphyrinogenase 2
 gi|17130704|dbj|BAB73314.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
          Length = 347

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 165/328 (50%), Gaps = 43/328 (13%)

Query: 2   NLCTIEIGCPDDI-EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           N   +     + I ++ ++ SQ+  +NLQ  ICT  E+L+ +A           F   HW
Sbjct: 14  NHTVLLTSPTNTIPKDSRQRSQQFMQNLQDEICTALEQLDGKAS----------FHQDHW 63

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R +      G GR   +  G+VFE+  V  S V+G+  P              F+ATG 
Sbjct: 64  ERAEG-----GEGRTRVIREGRVFEQGGVNFSAVWGNSLPASILAQRPEAAGHEFFATGT 118

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP NP+VP VH N R       +WFGGG DLTP      +++  D + FH TLK  
Sbjct: 119 SMVLHPRNPYVPTVHLNYRYFEAGPIWWFGGGADLTPY-----YAFKEDAVHFHQTLKNA 173

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEM--------------- 224
           C  H    Y  +K WCD YFYL HR+E RGIGGIFFD+  +S ++               
Sbjct: 174 CDVHNPEYYPTFKRWCDEYFYLRHREEQRGIGGIFFDYQDASGKLYVESQTDSSVAIYSQ 233

Query: 225 ------GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  F+F+ + G  F+  Y  +V R     + ++ R  QL RRGRY EFNL+
Sbjct: 234 KVGNVARNWEDIFAFVQSCGQAFLPAYLPIVERRQGIEYGDRQRNFQLYRRGRYVEFNLV 293

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           YD+GT FG +T G  ESIL S+PPL  W
Sbjct: 294 YDRGTVFGLQTKGRTESILMSLPPLARW 321


>gi|238912866|ref|ZP_04656703.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 299

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGNDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RG+GG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGVGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|168466808|ref|ZP_02700662.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194442975|ref|YP_002041712.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|197247962|ref|YP_002147405.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|226740893|sp|B5F0I0|HEM6_SALA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740898|sp|B4T0I0|HEM6_SALNS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194401638|gb|ACF61860.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|195630742|gb|EDX49334.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211665|gb|ACH49062.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 299

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|86139105|ref|ZP_01057676.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
 gi|85824336|gb|EAQ44540.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
          Length = 297

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 156/305 (51%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
              D+   K  +   F  L+  I   FE LE+       A   P  F V    R      
Sbjct: 1   MTADMSTEKAQAAAWFRTLRDEIVAAFEALEDRHDQGPFAELEPGRFEVTQTKRAAEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +S VYG        +   +  + G  ++P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISEVYGTLGERAQNAMAARKGLPGMKEDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P LE     YD D   FH T K    
Sbjct: 121 VAHMRNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDEDTAHFHATQKAHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            +    Y   K+W D YFY+PHR  +RG+GGIF D  +S    G    DF+    +G  F
Sbjct: 176 PYGADLYPRLKDWADEYFYIPHRNRARGVGGIFMDDHNS----GDWATDFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +     FSE D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVDKRRVQDFSEADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           P+  W
Sbjct: 292 PMAKW 296


>gi|149375614|ref|ZP_01893383.1| coproporphyrinogen III oxidase [Marinobacter algicola DG893]
 gi|149360016|gb|EDM48471.1| coproporphyrinogen III oxidase [Marinobacter algicola DG893]
          Length = 312

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 112/310 (36%), Positives = 150/310 (48%), Gaps = 35/310 (11%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +    I  P+         ++    LQ  IC     ++             +F    W R
Sbjct: 1   MSQHPIQHPEP-----HAVKQYLLGLQDRICERLAAVDG----------RGVFETDTWDR 45

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
                 + GGG    +  G VFEK  V  S V G+  P              + A G+S+
Sbjct: 46  -----PEGGGGISRVISDGGVFEKGGVNFSHVMGETMPASATAHRPHLAGAPWQAMGVSL 100

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP+VP  H N+R  V         YWFGGG DLTP      + +D D + +H   
Sbjct: 101 VMHPSNPYVPTSHANVRFFVATPEDAEPVYWFGGGYDLTPY-----YGFDEDCVHWHRVA 155

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           K  C       Y  YK WCD YFYL HR E RG+GG+FFD  ++    G    DF+ + +
Sbjct: 156 KAACDPFGDQLYREYKHWCDNYFYLKHRDEPRGVGGLFFDDHNT----GDFGRDFALMQS 211

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
           VGD FI+ Y  +V R     + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESI
Sbjct: 212 VGDSFIEAYEPIVARRKAMDWGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESI 271

Query: 297 LASMPPLVAW 306
           L S+PPLV W
Sbjct: 272 LMSLPPLVRW 281


>gi|16761369|ref|NP_456986.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29140934|ref|NP_804276.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213027732|ref|ZP_03342179.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213424311|ref|ZP_03357143.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213647109|ref|ZP_03377162.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213857596|ref|ZP_03384567.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289829709|ref|ZP_06547246.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|21362584|sp|Q8Z4U8|HEM6_SALTI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|25284542|pir||AH0812 coproporphyrinogen oxidase (EC 1.3.3.3) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503668|emb|CAD07682.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136559|gb|AAO68125.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 299

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFIEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|238752038|ref|ZP_04613522.1| Coproporphyrinogen III oxidase [Yersinia rohdei ATCC 43380]
 gi|238709738|gb|EEQ01972.1| Coproporphyrinogen III oxidase [Yersinia rohdei ATCC 43380]
          Length = 308

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 156/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD  + +         +LQ  IC    + +  A           FT ++W R++   
Sbjct: 1   MNLPDIAQIK-----TYLLDLQDKICAALSEADGSAE----------FTEENWAREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLTNGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + +  D I +H T  ++C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPGEDPVWWFGGGFDLTPF-----YGFAEDAIHWHQTAYQLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+FFD  +S       D  F F  AVGD F
Sbjct: 156 PFGEHLYPQYKKWCDDYFYIKHRNEARGIGGLFFDDFNSP----DFDTCFKFTQAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LDAYLPIVARRKALSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           P+V W
Sbjct: 272 PMVRW 276


>gi|330965117|gb|EGH65377.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 304

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 150/299 (50%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP++PHVP 
Sbjct: 46  RTRVVENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   ++ C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAEQACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|90413786|ref|ZP_01221774.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
 gi|90325255|gb|EAS41752.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
          Length = 301

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 112/296 (37%), Positives = 154/296 (52%), Gaps = 30/296 (10%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            K   +    +LQ  IC   E  +  A           F    W R++      GGGR  
Sbjct: 5   DKHAVKAFLLSLQDQICQSLENQDKGAV----------FEQDEWQREQG-----GGGRSR 49

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            L  G VFE+A V  S V+G   P              F A G+S+++HP +P++P  H 
Sbjct: 50  VLRQGSVFEQAGVNFSHVFGTKMPASATAHRPELAGRSFEAMGVSLVIHPNSPYIPTSHA 109

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP        ++ D   +HNT K +C+      Y  
Sbjct: 110 NVRFFIAEKEGEAPVWWFGGGFDLTPFYP-----FEEDCQHWHNTAKHLCAPFGDDIYDQ 164

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCD+YF+LPHR E+RG+GG+FFD L+      G +  F++  AVG+ FI  Y  +V+
Sbjct: 165 HKAWCDKYFFLPHRNETRGVGGLFFDDLNEW----GFEQSFAYTQAVGNGFIDGYLPIVQ 220

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 RRQDIPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|269103769|ref|ZP_06156466.1| coproporphyrinogen III oxidase aerobic [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163667|gb|EEZ42163.1| coproporphyrinogen III oxidase aerobic [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 303

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 115/297 (38%), Positives = 155/297 (52%), Gaps = 30/297 (10%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   +     LQ  IC   E+ +  A           F    W R++      GGGR 
Sbjct: 4   IDKEAVKTFLLQLQDQICRALEQQDGVAQ----------FEQDDWQREQG-----GGGRT 48

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G+VFE+A V  S V+G   P              F A G+S+++HP+NP+VP  H
Sbjct: 49  RVLRHGQVFEQAGVNFSHVFGVEMPASATAHRPELAGRRFEAMGVSLVIHPHNPYVPTSH 108

Query: 136 FNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R            +WFGGG DLTP        +  D + +H    ++C     A Y+
Sbjct: 109 ANVRFFIAEKEGEAPVWWFGGGFDLTPFYP-----FAEDCLHWHQVAHQLCQPFGDAVYS 163

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCDRYF+LPHR E+RGIGG+FFD L+        D  F++I AVG  +++ Y  +V
Sbjct: 164 QHKAWCDRYFFLPHRNETRGIGGLFFDDLNQWE----FDNCFAYIQAVGQGYLEAYLPIV 219

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   H F E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 220 EKRKSHCFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|157144630|ref|YP_001451949.1| coproporphyrinogen III oxidase [Citrobacter koseri ATCC BAA-895]
 gi|166217798|sp|A8ADF0|HEM6_CITK8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157081835|gb|ABV11513.1| hypothetical protein CKO_00350 [Citrobacter koseri ATCC BAA-895]
          Length = 299

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 158/299 (52%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  ++   +LQ  IC +   ++              F    W RD       GGG
Sbjct: 1   MKPDAQRVKQFLLSLQDDICQQLAAVDG-----------ADFVEDSWQRD-----AGGGG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP++P 
Sbjct: 45  RSRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYIPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      ++++ D I +H T +++C  +    
Sbjct: 105 SHANVRFFIAEKPGAEPVWWFGGGFDLTPY-----YAFEEDAIHWHRTARDLCQPYGEDV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+L HR E RGIGG+FFD L++       D+ F F+ AVG  +   +  
Sbjct: 160 YPRYKKWCDDYFFLKHRDEQRGIGGLFFDDLNTP----DFDSCFRFMQAVGKGYTDAFLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKAMVWGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|260428651|ref|ZP_05782630.1| coproporphyrinogen III oxidase, aerobic [Citreicella sp. SE45]
 gi|260423143|gb|EEX16394.1| coproporphyrinogen III oxidase, aerobic [Citreicella sp. SE45]
          Length = 298

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 120/306 (39%), Positives = 158/306 (51%), Gaps = 16/306 (5%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENE-AHENSANRSPKIFTVKHWLRDKSQ 66
           +   D   ERK  +   F +L+  I   FE LE   A    ++ +P  F V    R    
Sbjct: 1   MTDTDAFAERKSRASAWFRSLRDEIVAAFEGLEASHAEGPFSDMAPGSFEVTPTTRTADD 60

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLS 121
             D GGG M+ +  G+VFEK  V VSTVYG L    +  +      G   +P FWA+G+S
Sbjct: 61  GSDAGGGLMSVMRGGRVFEKVGVNVSTVYGTLGEAAQKSMAARGVPGIEADPRFWASGIS 120

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           ++ H  NPHVPAVH N RM  T   +WFGGG DL P LE     YD D   FH   +   
Sbjct: 121 LVAHMQNPHVPAVHMNTRMFWTPNAWWFGGGSDLNPCLE-----YDEDTAHFHAMQQAHL 175

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H  A Y   K W D YFY+PHR   RG+GGIF D  ++    G  +ADF+    +G  
Sbjct: 176 DPHDPALYPALKAWADEYFYIPHRARGRGVGGIFMDDRNT----GDWEADFALTQDIGRA 231

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  +  LV       F   ++  QL+ RG YAE+NL+YD+GT FG  TG +  ++L S+
Sbjct: 232 FLPAWVPLVESRRTLRFGTAEKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDANAVLMSL 291

Query: 301 PPLVAW 306
           PPL  W
Sbjct: 292 PPLAKW 297


>gi|296104096|ref|YP_003614242.1| coproporphyrinogen III oxidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058555|gb|ADF63293.1| coproporphyrinogen III oxidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 299

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 153/294 (52%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC +    +              F   +W R+       GGGR   L
Sbjct: 6   KRVKTFLLQLQDEICQKLAAADG-----------GNFQEDNWQRE-----AGGGGRSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S VYG+  P              F A G+S++VHP+NP VP  H N+
Sbjct: 50  RNGGIFEQAGVNFSHVYGEAMPASATAHRPELAGRSFQAMGVSLVVHPHNPFVPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG D+TP      + ++ D + +H T +++C       Y  YK
Sbjct: 110 RFFIAEKPGADPVWWFGGGFDMTPY-----YGFEEDAVHWHTTARDLCLPFGEDVYPKYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+FFD L++       D  FSF+ AVG+ +   Y  +V R 
Sbjct: 165 KWCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFDTAFSFMRAVGEGYTDAYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +  ++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 221 KNSDYGVREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|238756702|ref|ZP_04617979.1| Coproporphyrinogen III oxidase [Yersinia ruckeri ATCC 29473]
 gi|238705078|gb|EEP97518.1| Coproporphyrinogen III oxidase [Yersinia ruckeri ATCC 29473]
          Length = 310

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 156/294 (53%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
            I +    +LQ  IC +  + + +A           FT + W R++      GGGR   +
Sbjct: 7   NIIKTFLLSLQDDICAKLAQADGQAS----------FTEQQWEREEG-----GGGRSRVM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP NP++P  H N+
Sbjct: 52  VNGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPLNPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T K +C       Y  YK
Sbjct: 112 RFFIAEKPGEQPVWWFGGGFDLTPY-----YGFEDDAVHWHQTAKNLCQPFGDDLYDQYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HRQE+RGIGG+FFD L++          F+FI AVG  F   Y  +V R 
Sbjct: 167 KWCDEYFYIKHRQEARGIGGLFFDDLNTP----DFATCFAFIQAVGKGFSTAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 KQLAWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|167549538|ref|ZP_02343297.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325482|gb|EDZ13321.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 299

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPDADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|317049061|ref|YP_004116709.1| Coproporphyrinogen oxidase [Pantoea sp. At-9b]
 gi|316950678|gb|ADU70153.1| Coproporphyrinogen oxidase [Pantoea sp. At-9b]
          Length = 307

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 151/293 (51%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +     LQ  IC +    +  A           FT   W R        GGGR   L 
Sbjct: 8   RVKAFLLALQDDICAQLAAEDGTAD----------FTEDSWQR-----PGGGGGRSRVLR 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S+++HP NP+VP  H N+R
Sbjct: 53  NGAVFEQAGVNFSHVHGDQMPASATAHRPELAGRSFEAMGVSLVIHPENPYVPTSHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D + +H T  E+C       Y  +K+
Sbjct: 113 FFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDALHWHQTAFELCQPFGDEVYPRFKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFY+ HR E RGIGG+FFD L++       D  F+F  AVG+ F+  Y  +V +  
Sbjct: 168 WCDDYFYIKHRDEQRGIGGLFFDDLNTP----DFDHCFAFTQAVGNGFLHAYRPIVAKRK 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 224 ALPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|261345327|ref|ZP_05972971.1| coproporphyrinogen III oxidase [Providencia rustigianii DSM 4541]
 gi|282566661|gb|EFB72196.1| coproporphyrinogen III oxidase [Providencia rustigianii DSM 4541]
          Length = 305

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 159/294 (54%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   ++LQ  IC +  +L+ +          + F  + W R +      GGGR   L
Sbjct: 7   DRVKAFLQSLQDTICQKITELDGK----------ETFLEQTWERAEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S + GD  P              + A G+S+++HP NP++P  H N+
Sbjct: 52  TQGALFEQAGVNFSHIKGDKLPASASAHRPELAGRSYQAMGVSLVIHPLNPYIPTTHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H   +++C  +    Y  YK
Sbjct: 112 RFFIAEKEGTEPVWWFGGGFDLTPY-----YGFEEDAIHWHTVARDLCMPYGDDVYPKYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+F+D L+     GG ++ F+F   VG  F++ Y  +V R 
Sbjct: 167 KWCDEYFYLKHRNEPRGIGGLFYDDLN----QGGFESCFNFTQDVGHGFLQAYAPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 223 RYLSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|261340769|ref|ZP_05968627.1| coproporphyrinogen III oxidase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317192|gb|EFC56130.1| coproporphyrinogen III oxidase [Enterobacter cancerogenus ATCC
           35316]
          Length = 299

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 150/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC +    +              F    W RD       GGGR   L
Sbjct: 6   QRVKSFLMQLQDEICQKLAAEDG-----------GEFQEDSWQRD-----AGGGGRSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V+GD  P              F A G+S++VHP+NP VP  H N+
Sbjct: 50  RNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPFVPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK
Sbjct: 110 RFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHTTARDLCLPFGEDVYPTYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+FFD L++       D  F F+ AVG  F   Y  +V R 
Sbjct: 165 KWCDDYFYLKHRDEQRGIGGLFFDDLNTP----DFDTAFRFMQAVGQGFTDAYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +  ++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 221 KNTDYGVREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|207857864|ref|YP_002244515.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|226740895|sp|B5R4G0|HEM6_SALEP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|206709667|emb|CAR34017.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 299

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 156/292 (53%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC +   ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQKLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG+DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGLDLTPY-----YGFEEDAVHWHRTARDLCQPFGDNVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|182677062|ref|YP_001831208.1| coproporphyrinogen III oxidase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182632945|gb|ACB93719.1| Coproporphyrinogen oxidase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 301

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 151/300 (50%), Positives = 192/300 (64%), Gaps = 6/300 (2%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANR---SPKIFTVKHWLRDKSQK 67
           P  +E  K  ++  FE+LQ  I   FEK+E EA     +    +   FT + W R     
Sbjct: 3   PSILEACKAKAKPWFESLQDAIIAAFEKIEAEAPGPFLDDQTPAAGRFTKQPWTRKNPDG 62

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
           ED GGG M  L  G+VFEKA +  STV+G  +P+F  QI G   +P FWA+GLS+I HP 
Sbjct: 63  EDGGGGFMGLLK-GRVFEKAGIHASTVFGRFAPEFASQIPGAEADPRFWASGLSLIAHPV 121

Query: 128 NPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH-AVA 186
           NP+VP VH N R +VT   WFGGG DLTP L+ RR   D D I FH  ++E C +H  VA
Sbjct: 122 NPNVPTVHMNTRFVVTSKGWFGGGADLTPMLDRRRMQNDKDAIDFHAAMREACDKHKDVA 181

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
           +Y   K+WCD YFYL HR E RGIGG+FFD+     E    DA+F+F   +G  F+ +YP
Sbjct: 182 DYPRLKDWCDEYFYLKHRNEPRGIGGVFFDYFDCPDETI-FDANFAFAQEIGRAFLAIYP 240

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +VRRN+   ++E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVE+IL+S+PP+V W
Sbjct: 241 EIVRRNWAQPWTEADRDEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVEAILSSLPPVVKW 300


>gi|254507256|ref|ZP_05119392.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           16]
 gi|219549716|gb|EED26705.1| coproporphyrinogen III oxidase, aerobic [Vibrio parahaemolyticus
           16]
          Length = 305

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 114/297 (38%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K+  ++    LQ  IC + E  + +A           F    W R+  +K   GGGR 
Sbjct: 4   IDKQAVKQFLMELQDSICQKLEAADGQAE----------FVEDAWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMKEGAVFEQGGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D  ++HNT KE+C+      Y+
Sbjct: 113 ANVRFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDAQYWHNTAKEVCAPFGSEVYS 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG  +   Y  +V
Sbjct: 168 EHKAWCDKYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFEYIKAVGQGYTDAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETEYGERERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|200386561|ref|ZP_03213173.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199603659|gb|EDZ02204.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 299

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 155/292 (53%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC +   ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQKLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDYCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|78484363|ref|YP_390288.1| coproporphyrinogen III oxidase [Thiomicrospira crunogena XCL-2]
 gi|78362649|gb|ABB40614.1| coproporphyrinogen oxidase [Thiomicrospira crunogena XCL-2]
          Length = 323

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 115/296 (38%), Positives = 151/296 (51%), Gaps = 23/296 (7%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK--EDLGGGRMA 76
              +     LQ  IC +  + +              F V  W R+  +      GGGR  
Sbjct: 12  EKVKEYLLGLQDDICQQLAEEDGSND----------FIVDAWDREPDEGVMGLTGGGRSR 61

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            L  G++ EK  V  S V G   P              F A G+S+++HP NP+VP  H 
Sbjct: 62  VLEGGEIIEKGGVNFSHVRGKTLPASATAHRPELAGRSFQALGVSLVIHPRNPYVPTSHA 121

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R+           +WFGGG DLTP        +D D++ +H T KE C       Y  
Sbjct: 122 NVRLFIAEKEGEAPVWWFGGGFDLTPYYP-----FDQDILHWHLTSKEACDPFGTDVYAK 176

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YKEWCD YF+L HR E+RG+GG+F+D L+ S      D  F+F+ +VGD FIK Y  +V 
Sbjct: 177 YKEWCDEYFFLKHRNETRGVGGLFYDDLNESTFGWDFDKCFAFMQSVGDHFIKAYRPIVA 236

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  +  + E+ R  QL RRGRYAEFNL +D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 237 RRKNMDYGERQRDFQLYRRGRYAEFNLAFDRGTIFGLQTGGRTESILMSMPPLATW 292


>gi|330957380|gb|EGH57640.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 304

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 148/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  IC   E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICIALEQEDGNAH----------FIEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDTYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|153949579|ref|YP_001400260.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           31758]
 gi|167008826|sp|A7FG82|HEM6_YERP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|152961074|gb|ABS48535.1| coproporphyrinogen III oxidase, aerobic [Yersinia
           pseudotuberculosis IP 31758]
          Length = 309

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
            + +     LQ  IC    + +  A           FT + W+R++      GGGR   L
Sbjct: 7   ALIKTYLLTLQDNICGALAQADGHAE----------FTEECWVREEG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G + P              F A G+S+++HP NP++P  H N+
Sbjct: 52  VNGAVFEQAGVNFSHVSGAMLPASATAHRPELAGRSFQALGVSLVIHPLNPYLPTSHANV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D I +H     +C       Y  YK
Sbjct: 112 RFFIAEKPGEDAVWWFGGGFDLTPY-----YGFEEDAIHWHQVAHSLCQPFGEQIYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HRQE+RGIGG+FFD L+S          F+F  AVGD F+  Y  +V R 
Sbjct: 167 KWCDDYFYIKHRQEARGIGGLFFDDLNSP----DFMTCFNFTQAVGDGFLAAYMPIVARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 KALGWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|261856674|ref|YP_003263957.1| coproporphyrinogen oxidase [Halothiobacillus neapolitanus c2]
 gi|261837143|gb|ACX96910.1| Coproporphyrinogen oxidase [Halothiobacillus neapolitanus c2]
          Length = 313

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 101/294 (34%), Positives = 147/294 (50%), Gaps = 23/294 (7%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +    +LQ  I +  E  E          S   F    W R +++  + G GR   L
Sbjct: 5   QRVRDYLIDLQDRIVSGLEAFE----------STARFLQDDWQRPETEALN-GMGRGRVL 53

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A +  S V G   P              F A G+S+++HP NP+ P  H N+
Sbjct: 54  EGGEVFERAGINFSHVTGQKLPPSATAHRPDLAGGSFEALGVSLVIHPRNPYAPTSHANV 113

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP      + +  D + +H   +  C+      Y  +K
Sbjct: 114 RFFQAQKPGVEPVWWFGGGFDLTPY-----YGFTEDAVHWHEQSRAACTPFGDELYPRFK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GG+FFD   +  ++   +  F  + +VGD ++  Y  +V + 
Sbjct: 169 QWCDEYFWLKHRNEPRGVGGLFFDDYGADGQI-DFEQAFGLMRSVGDHYLPAYTPIVAKR 227

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP V W
Sbjct: 228 KDTPYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPEVRW 281


>gi|28867410|ref|NP_790029.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968420|ref|ZP_03396563.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato T1]
 gi|301384292|ref|ZP_07232710.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060146|ref|ZP_07251687.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           K40]
 gi|302130419|ref|ZP_07256409.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|38372328|sp|Q88B49|HEM6_PSESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|28850644|gb|AAO53724.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926708|gb|EEB60260.1| coproporphyrinogen III oxidase, aerobic [Pseudomonas syringae pv.
           tomato T1]
 gi|331017679|gb|EGH97735.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 304

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP++PHVP 
Sbjct: 46  RTRVVENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|75910777|ref|YP_325073.1| coproporphyrinogen III oxidase [Anabaena variabilis ATCC 29413]
 gi|75704502|gb|ABA24178.1| coproporphyrinogen oxidase [Anabaena variabilis ATCC 29413]
          Length = 347

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 145/312 (46%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K       + LQ  I     KL+              F    W R      + GGGR   
Sbjct: 24  KARVSNFMKQLQDEITQALTKLDG----------VGQFHEDSWER-----PEGGGGRSRV 68

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G +FE+A V  S V+G   P          +   F+ATG S+++HP NP+VP VH N
Sbjct: 69  LRDGAIFEQAGVNFSEVWGSHLPPSILAQRPEAEGHGFYATGTSLVLHPRNPYVPTVHLN 128

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH TLK  C +H    Y  +K WCD
Sbjct: 129 YRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHQTLKGACDEHHPEYYPVFKRWCD 183

Query: 197 RYFYLPHRQESRGIGGIFFDHLHS----------------------SPEMGGIDADFSFI 234
            YFYL HR E+RG+GG+FFD+                          P     +  FSF+
Sbjct: 184 EYFYLKHRDETRGVGGLFFDYQDGQGVLYRGPNPKGEAANYSNQVGEPAPRDWEDLFSFV 243

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
              G  F+  Y  +V R +   + ++ R  QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 244 QGSGKAFLPAYVPIVERRHGIEYGDRQRNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 303

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 304 SILMSLPPLVRW 315


>gi|260574200|ref|ZP_05842205.1| Coproporphyrinogen oxidase [Rhodobacter sp. SW2]
 gi|259023666|gb|EEW26957.1| Coproporphyrinogen oxidase [Rhodobacter sp. SW2]
          Length = 287

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 119/304 (39%), Positives = 162/304 (53%), Gaps = 23/304 (7%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             D+ + RK  +   F NL+  I T FE +E              F +    R      D
Sbjct: 1   MSDEFDARKTRAAAWFRNLRDQIVTAFEAIE---TAQGGPAPAGRFELTPTSR-----PD 52

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVIV 124
            GGG M+ +  G+VFEK  V VS V+G              + G  ++P FWA+G+S++ 
Sbjct: 53  GGGGLMSVMRHGRVFEKIGVAVSEVHGTLAPRAQQAMAARGVPGMAEDPRFWASGVSLVA 112

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPH PAVH N RM  T  A WFGGG DL P +E     Y  D  FFH  L++ C  H
Sbjct: 113 HMQNPHAPAVHLNTRMFWTPGACWFGGGSDLNPCIE-----YPEDTAFFHGVLRQACDAH 167

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
           A   Y  +K W D YFY+PHR  +RG+GGIFFD   +    G  +ADF+F   VG  F+ 
Sbjct: 168 APDYYPRFKAWADEYFYVPHRNRARGVGGIFFDDHAT----GDWEADFAFTQDVGRAFLP 223

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            +  +  R     ++E DR+ QL+ RG YAE+NL+YD+GT FG +TG +  ++L +MPP+
Sbjct: 224 AFLPITERRLGTPWTEADREAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMTMPPI 283

Query: 304 VAWP 307
             WP
Sbjct: 284 AKWP 287


>gi|198242264|ref|YP_002216521.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205353557|ref|YP_002227358.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226740894|sp|B5FQE4|HEM6_SALDC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740896|sp|B5RCS3|HEM6_SALG2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|197936780|gb|ACH74113.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273338|emb|CAR38309.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326624275|gb|EGE30620.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628653|gb|EGE34996.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 299

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 155/292 (53%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC +   ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQKLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYTEAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|170078434|ref|YP_001735072.1| coproporphyrinogen III oxidase [Synechococcus sp. PCC 7002]
 gi|169886103|gb|ACA99816.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. PCC
           7002]
          Length = 344

 Score =  328 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 107/326 (32%), Positives = 148/326 (45%), Gaps = 47/326 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
               +   D     K    +  + +Q  IC   E  + +            F    W R 
Sbjct: 13  SAKPVPPSDS----KERVSQFMQQIQDKICQGLEVADGK----------GKFQEDSWQRQ 58

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
           +      GGGR   +  G V E+  V  S V+GD  P    +         F+ATG S++
Sbjct: 59  EG-----GGGRSRVMREGNVLEQGGVNFSEVWGDQLPPSILKQRPEAAGHGFYATGTSMV 113

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP++P VH N R       +WFGGG DLTP        +  D   FH T +  C +
Sbjct: 114 LHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHKTYQAACDR 168

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------S 220
           H    Y  +K WCD YFYL HR E+RG+GG+FFD+                         
Sbjct: 169 HHKEYYNVFKRWCDEYFYLKHRDETRGVGGLFFDYQDGTGELYKGPHPDKAAAAYSKDLG 228

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
                  +  F+F+   G  F+  Y  ++ R  +  + +++RQ QL RRGRY EFNL+YD
Sbjct: 229 EQPQRSWEDIFAFVQDCGGSFLDSYVPIIERRRNTEYGDRERQFQLYRRGRYVEFNLVYD 288

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 289 RGTIFGLQTNGRTESILMSLPPLVRW 314


>gi|16765771|ref|NP_461386.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167991749|ref|ZP_02572848.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168243221|ref|ZP_02668153.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447386|ref|YP_002046516.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197264323|ref|ZP_03164397.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|462259|sp|P33771|HEM6_SALTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740897|sp|B4TCI1|HEM6_SALHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|310642|gb|AAA27139.1| oxygen-dependent coproporphyrinogen III oxidase [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|16420991|gb|AAL21345.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194405690|gb|ACF65909.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197242578|gb|EDY25198.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205329849|gb|EDZ16613.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337576|gb|EDZ24340.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261247651|emb|CBG25478.1| Coprogen oxidase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994556|gb|ACY89441.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159003|emb|CBW18516.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913439|dbj|BAJ37413.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222848|gb|EFX47919.1| Coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323130781|gb|ADX18211.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989379|gb|AEF08362.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 299

 Score =  328 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 153/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RG+GG+FFD L++       D  F F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGVGGLFFDDLNTP----DFDHCFDFMQAVGNGYTRAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|146276600|ref|YP_001166759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554841|gb|ABP69454.1| Coproporphyrinogen oxidase [Rhodobacter sphaeroides ATCC 17025]
          Length = 291

 Score =  328 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 170/304 (55%), Gaps = 21/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
             D ++ +K  +   F  L++ I   FE LE+ A   +  + +P  F V    R+     
Sbjct: 1   MNDAMDGQKARAADWFRELRNRILAAFEGLEDAAAGGSPTDPAPGRFEVSETTRE----- 55

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG-----DLSPDFKDQILGTTKNPYFWATGLSVI 123
             GGG M+ L  G+VFEK  V VSTV+G              + G  ++P FWA+G+S++
Sbjct: 56  AGGGGLMSVLRGGRVFEKVGVNVSTVHGTLAARAQQAMAARGVPGMAEDPRFWASGISLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPH PAVH N RM  T   +WFGGG DL P L+     +  D   FH TL+  C  
Sbjct: 116 AHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCLD-----HPEDTEHFHATLRRGCEA 170

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF++PHR  +RG+GGIF+D L+S    G  +ADF+F  AVG+ F+
Sbjct: 171 HGADYYPRFKAWADEYFFIPHRGRARGVGGIFYDDLNS----GDWEADFAFTRAVGEAFL 226

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R     ++E DR+ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 227 PAFVPLVERRMGTPWTEADREAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 286

Query: 303 LVAW 306
           L  W
Sbjct: 287 LAKW 290


>gi|146312598|ref|YP_001177672.1| coproporphyrinogen III oxidase [Enterobacter sp. 638]
 gi|167008823|sp|A4WD41|HEM6_ENT38 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|145319474|gb|ABP61621.1| coproporphyrinogen oxidase [Enterobacter sp. 638]
          Length = 299

 Score =  328 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 151/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  IC +   ++              F    W R+       GGGR   L
Sbjct: 6   QQVKTFLMQLQDDICQKLSAVDG-----------GEFHEDSWQRE-----AGGGGRSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V+GD  P              F A G+S++VHP +P VP  H N+
Sbjct: 50  RNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPQSPFVPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK
Sbjct: 110 RFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDICQPFGEEVYPKYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R 
Sbjct: 165 KWCDDYFYLKHRDEQRGIGGLFFDDLNAP----DFDTAFNFMQAVGQGYTDAYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +  ++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 221 RNTDYGVREREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|161612804|ref|YP_001586769.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|189028105|sp|A9N336|HEM6_SALPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|161362168|gb|ABX65936.1| hypothetical protein SPAB_00503 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 299

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 153/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFDFMQAVGNGYTRAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|307543968|ref|YP_003896447.1| coproporphyrinogen III oxidase [Halomonas elongata DSM 2581]
 gi|307215992|emb|CBV41262.1| coproporphyrinogen III oxidase [Halomonas elongata DSM 2581]
          Length = 367

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 145/292 (49%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  +C      + +A           F    W R++      GGGR   +  
Sbjct: 65  VKTYLLDLQDRLCDGLAAEDGKAG----------FREDSWRREEG-----GGGRSRVIEN 109

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFEK  V  S V+G   P              F A G+S ++HP NPHVP  H N+R 
Sbjct: 110 GAVFEKGGVNFSHVHGATLPASASAARPELAGRSFHAVGVSWVLHPENPHVPTSHGNVRF 169

Query: 141 I------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           +          +WFGGG DLTP           DV  +H   ++ C+      Y  YK W
Sbjct: 170 LIAEKEGEAPVWWFGGGYDLTPFYP-----VLDDVRHWHRVARDACAPFGEDVYPRYKAW 224

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF L HR E+RG+GG+FFD L+     GG +  F F  AVGD F+  Y  +V+R   
Sbjct: 225 CDDYFMLKHRDETRGVGGLFFDDLNE----GGFERCFDFQRAVGDSFLDAYLPIVQRRRD 280

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + +++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 281 TPWGQRERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARW 332


>gi|168231994|ref|ZP_02657052.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168817802|ref|ZP_02829802.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194468954|ref|ZP_03074938.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194455318|gb|EDX44157.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333631|gb|EDZ20395.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205344876|gb|EDZ31640.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320086941|emb|CBY96711.1| Coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 299

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 153/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDYCFDFMQAVGNGYTRAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|288934156|ref|YP_003438215.1| coproporphyrinogen oxidase [Klebsiella variicola At-22]
 gi|288888885|gb|ADC57203.1| Coproporphyrinogen oxidase [Klebsiella variicola At-22]
          Length = 299

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 153/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDNLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEKV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|226942192|ref|YP_002797265.1| coproporphyrinogen III oxidase [Azotobacter vinelandii DJ]
 gi|226717119|gb|ACO76290.1| coproporphyrinogen III oxidase [Azotobacter vinelandii DJ]
          Length = 309

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 110/303 (36%), Positives = 157/303 (51%), Gaps = 30/303 (9%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             + + +R    +    +LQ  ICT  E  +  AH          F  + WLR+      
Sbjct: 1   MGNAVNDRIEAVKAYLLDLQDRICTALETEDGGAH----------FREEAWLREGGG--- 47

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
             GGR   L  G + EK  V  S V+G   P              F A G+S+++HP NP
Sbjct: 48  --GGRTRVLENGALIEKGGVNFSHVHGAGLPPSASAHRPELAGRGFQALGVSLVIHPRNP 105

Query: 130 HVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +VP  H N+R+           +WFGGG DLTP      ++++ D +F+H   ++ C+  
Sbjct: 106 YVPTSHANVRLFVAEKAGEAPVWWFGGGFDLTPY-----YAFEEDCVFWHQVARDACAPF 160

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K WCDRYF+L HR E RGIGG+FFD L+        D  F+F+ AVGD +I+
Sbjct: 161 GADVYPRFKAWCDRYFHLKHRNEPRGIGGLFFDDLNEW----DFDTSFAFLRAVGDAYIQ 216

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  +V++     + E++R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+P  
Sbjct: 217 AYLPIVQKRKGAPYGEREREFQAYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPAE 276

Query: 304 VAW 306
           V W
Sbjct: 277 VRW 279


>gi|323493846|ref|ZP_08098964.1| coproporphyrinogen III oxidase [Vibrio brasiliensis LMG 20546]
 gi|323311980|gb|EGA65126.1| coproporphyrinogen III oxidase [Vibrio brasiliensis LMG 20546]
          Length = 305

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 114/297 (38%), Positives = 157/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++    LQ  IC + E+ + +A           F    W R+  +K   GGGR 
Sbjct: 4   IDKLAVKQFLMKLQDSICQQLEEADGQAV----------FVEDEWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMKDGAVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D  ++HNT KE+C+      Y 
Sbjct: 113 ANVRFFIAEKEGEDPIWWFGGGFDLTPFYP-----FEEDAQYWHNTAKEVCAPFGSEVYP 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCDRYFYLPHR E+RG+GG+FFD L+        D  F +I AVG+ + + Y  +V
Sbjct: 168 EHKAWCDRYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFDYIKAVGEGYTEAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + +++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETTYGDRERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|329894847|ref|ZP_08270647.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC3088]
 gi|328922741|gb|EGG30075.1| Coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           IMCC3088]
          Length = 298

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 114/299 (38%), Positives = 152/299 (50%), Gaps = 33/299 (11%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ R    +     LQ  IC E   L+              F    W R      + GGG
Sbjct: 1   MDIR--AVKNYLLGLQEAICHELSDLDG-----------AEFASDAWER-----PEGGGG 42

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G + EK  V  S V G   P              F A G+S+++HP NP+VP 
Sbjct: 43  RSRVLSEGALIEKGGVNFSHVQGASMPGSATAHRPELAGRSFQAMGVSLVIHPRNPYVPT 102

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+RM V         +WFGGG DLTP      + ++ D + +H T K  C     A 
Sbjct: 103 SHANVRMFVAEKEGEEPIWWFGGGYDLTPY-----YGFEEDCVEWHRTAKSACEPFGEAL 157

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YFYLPHRQE RG+GG+F+D L+     GG +  F F+ +VGD +++ Y  
Sbjct: 158 YPKYKRWCDDYFYLPHRQEPRGVGGLFYDDLNE----GGFERCFDFMRSVGDSYLRAYRP 213

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG ++ G  ESIL S+PPLV W
Sbjct: 214 IVERRRDIAYGERERNWQLYRRGRYVEFNLVFDRGTLFGLQSNGRTESILMSLPPLVRW 272


>gi|254429328|ref|ZP_05043035.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax sp. DG881]
 gi|196195497|gb|EDX90456.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax sp. DG881]
          Length = 302

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +    +LQ  IC      +  A           F    W R++      GGGR   L
Sbjct: 7   QAVKDYLLDLQDRICDALGAEDGSA----------TFREDSWEREQG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S V+GD  P              F A G+S+++HP NP+ P  H N+
Sbjct: 52  ENGAVIEKGGVNFSHVFGDQLPPSATAARPELAGRSFQAMGVSLVIHPKNPYAPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP      + ++ DV+ +H T ++ C       Y  +K
Sbjct: 112 RFFVAEKDGEDPVWWFGGGFDLTPY-----YGFEEDVVHWHQTARDACEPFGNEIYPEFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E RG+GG+FFD L+        D  F+ + +VGD ++  Y  ++ R 
Sbjct: 167 TWCDDYFYLKHRDEPRGVGGLFFDDLNR----FDFDTSFALMRSVGDAYVPAYQPILARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H + E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 223 KDHDYGERERQFQLYRRGRYVEFNLVYDRGTIFGLQSGGRTESILMSLPPLVRW 276


>gi|254483332|ref|ZP_05096563.1| coproporphyrinogen III oxidase, aerobic [marine gamma
           proteobacterium HTCC2148]
 gi|214036427|gb|EEB77103.1| coproporphyrinogen III oxidase, aerobic [marine gamma
           proteobacterium HTCC2148]
          Length = 302

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 113/294 (38%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC+   + +  A           F    W R      + GGGR   L
Sbjct: 4   DQVKAYLLSLQDSICSALAQEDGSAA----------FITDEWQR-----SEGGGGRSRVL 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P              + A G+S++VHP NP+VP  H N+
Sbjct: 49  AEGAVFEKAGVNFSHVMGENLPPSASASRPELAGRSYQAMGVSLVVHPNNPYVPTSHANV 108

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP   +R      D I +H    E C+      Y  YK
Sbjct: 109 RLFVAEKEGAEPVWWFGGGYDLTPYYGNR-----EDCIAWHQVASEACAPFGGELYPRYK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HRQE RG+GG+FFD L+        D  F F+ +VG+ F++ Y  +V R 
Sbjct: 164 AWCDEYFYLKHRQEPRGVGGLFFDDLNEW----DFDTSFGFMQSVGNSFLRAYRPIVSRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  F +++RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPLV W
Sbjct: 220 KNTPFGDRERQFQLYRRGRYVEFNLVFDRGTLFGLQSDGRTEAILMSLPPLVRW 273


>gi|145300979|ref|YP_001143820.1| coproporphyrinogen III oxidase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166217792|sp|A4ST50|HEM6_AERS4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|142853751|gb|ABO92072.1| coproporphyrinogen III oxidase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 302

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E+ +              F    W R+        GGR   +
Sbjct: 7   AQVKAFLLQLQDEICRSLEQADG----------VGRFVEDAWAREGGG-----GGRTRVM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + E+  V  S VYGD  P              F A G+S+++HP+NP+VP  H N+
Sbjct: 52  RHGDMIEQGGVNFSHVYGDAMPASATAHRPELAGRKFEAMGVSLVIHPHNPYVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        +  DV  +H   +++C       Y  +K
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----FAEDVQHWHRVSRDLCQPFGEDIYPEFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCDRYF+L HR E+RG+GG+FFD L+  P        F+F+ AVG  ++  Y  ++ R 
Sbjct: 167 SWCDRYFFLKHRNETRGVGGLFFDDLNRWP----FADCFAFMQAVGRGYLDAYLPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPL  W
Sbjct: 223 KAQPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|290508360|ref|ZP_06547731.1| coproporphyrinogen III oxidase, aerobic [Klebsiella sp. 1_1_55]
 gi|289777754|gb|EFD85751.1| coproporphyrinogen III oxidase, aerobic [Klebsiella sp. 1_1_55]
          Length = 299

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 153/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDNLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEKV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|161502397|ref|YP_001569509.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189028104|sp|A9MID0|HEM6_SALAR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|160863744|gb|ABX20367.1| hypothetical protein SARI_00431 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 299

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 108/292 (36%), Positives = 150/292 (51%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC     ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQTLSAVDG-----------ANFIEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V GD  P              F A G+S++VHP NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVNGDAMPASATAHRPELVGRSFEAMGVSLVVHPRNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGEDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF++ HR E RGIGG+FFD L++        + F+F+ AVG  + + Y  +V R   
Sbjct: 167 CDDYFFIKHRNEQRGIGGLFFDDLNTP----DFASCFAFMQAVGKGYTEAYLPIVERRKT 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MAWGERERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|311278640|ref|YP_003940871.1| Coproporphyrinogen oxidase [Enterobacter cloacae SCF1]
 gi|308747835|gb|ADO47587.1| Coproporphyrinogen oxidase [Enterobacter cloacae SCF1]
          Length = 299

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 115/299 (38%), Positives = 158/299 (52%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  +     LQ  IC +   ++ +            F+  +W RD        GG
Sbjct: 1   MKPDAQQVKTFLLALQDSICQQLAAVDGQ-----------TFSEDNWQRDGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP+NP+VP 
Sbjct: 45  RSRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEDV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLRHRQEQRGIGGLFFDDLNTP----DFDRCFAFMQAVGNGYTDAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     F E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKAMAFGERERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|206580251|ref|YP_002237218.1| coproporphyrinogen III oxidase, aerobic [Klebsiella pneumoniae 342]
 gi|226740885|sp|B5XVR1|HEM6_KLEP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|206569309|gb|ACI11085.1| coproporphyrinogen III oxidase, aerobic [Klebsiella pneumoniae 342]
          Length = 299

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 153/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDNLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLRDGNVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D I +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAIHWHRTARDLCLPFGEEV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKAMPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|91978227|ref|YP_570886.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB5]
 gi|91684683|gb|ABE40985.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisB5]
          Length = 310

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 122/303 (40%), Positives = 174/303 (57%), Gaps = 8/303 (2%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
             ++      +E ++  ++  FE+L+  IC E E LE EA       +P  FT K W R 
Sbjct: 15  TELDTATTSRVEHQRAQARTWFESLRDRICAEVEALEREAPAELFPGTPATFTYKPWQRK 74

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                 +GG     L  G++FEK  +  S+  G L+P+    + G  ++  + +T +S+I
Sbjct: 75  TGAGGGVGGF----LSNGRLFEKIGIHTSSANGRLTPEMAKTLPGDGQSLDYVSTSISLI 130

Query: 124 VHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           +HP +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C  H
Sbjct: 131 MHPRSPRVPTVHMNTRFLSTAQGWFGGGADLTPMLPEQRSQDAEDAVTFHAAMKRACDAH 190

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  +K W D YF+LPHR  +RG+GGIF+DHL+S    G  D DF+F   VG   + 
Sbjct: 191 DPGYYGKFKPWADTYFFLPHRGTARGVGGIFYDHLNS----GDFDRDFAFTRDVGLALLA 246

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
           +YP +VR+     ++E++R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SMPPL
Sbjct: 247 VYPKIVRQRMQESWTEEERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSMPPL 306

Query: 304 VAW 306
           V+W
Sbjct: 307 VSW 309


>gi|285016941|ref|YP_003374652.1| coproporphyrinogen 3 oxidase, aerobic protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472159|emb|CBA14666.1| probable coproporphyrinogen 3 oxidase, aerobic protein [Xanthomonas
           albilineans]
          Length = 299

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 149/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R +      GGGR   L
Sbjct: 5   DRVRDYLTGLQDRICATVEATDGQA----------RFAEDVWQRAEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              + A G+S++ HP +P++P  H N+
Sbjct: 50  RDGAVFEQAGVGFSDVSGTRLPPSASANRPELAGASWRAVGVSLVFHPLSPYIPTTHTNV 109

Query: 139 RMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R         T A+WFGGG DLTP        +D D   +H T  ++C+      Y  +K
Sbjct: 110 RYFEAEREGATVAWWFGGGFDLTPYYP-----FDEDARHWHQTAHDLCAPFGAERYPAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E+RG+GG+FFD LH+       + DF++  AVGD F+  Y  +V R 
Sbjct: 165 RWCDEYFYLKHRNETRGVGGLFFDDLHA-----DFERDFAYQRAVGDGFLDAYLPIVARR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 RALPWGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|254430328|ref|ZP_05044031.1| coproporphyrinogen III oxidase, aerobic [Cyanobium sp. PCC 7001]
 gi|197624781|gb|EDY37340.1| coproporphyrinogen III oxidase, aerobic [Cyanobium sp. PCC 7001]
          Length = 371

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 112/311 (36%), Positives = 151/311 (48%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ++ ++     LQ  IC   E+L+ E            F  + W R      + GGGR   
Sbjct: 39  RQRARALLLGLQDSICAGLEQLDGE----------GRFAEESWER-----PEGGGGRSRV 83

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V G   P          K   ++ATG S+++HP NP++P VH N
Sbjct: 84  MKEGRVFEQGGVNFSEVQGSELPPSILSQRPEAKGHPWFATGTSMVLHPRNPYIPTVHLN 143

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH TLK  C     A Y  +K WCD
Sbjct: 144 YRYFEAGPVWWFGGGADLTPYYP-----FLEDARHFHRTLKGACDSVNPAYYPVFKPWCD 198

Query: 197 RYFYLPHRQESRGIGGIFFDH---------------------LHSSPEMGGIDADFSFIS 235
            YF+L HRQE+RG+GGIF+D+                     L   P     +  F   S
Sbjct: 199 EYFFLRHRQETRGVGGIFYDYQDPRGVLYKGQNPEGPAAAASLRQGPLPQSWEQLFQLAS 258

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  +  +  H  + +++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 259 ACGHAFLPSYVPIAEKRQHTTYGDRERQFQLYRRGRYVEFNLVFDRGTIFGLQTNGRTES 318

Query: 296 ILASMPPLVAW 306
           IL S+PPLV W
Sbjct: 319 ILMSLPPLVRW 329


>gi|15832561|ref|NP_311334.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           Sakai]
 gi|168748507|ref|ZP_02773529.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4113]
 gi|168756207|ref|ZP_02781214.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4401]
 gi|168761044|ref|ZP_02786051.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4501]
 gi|168768527|ref|ZP_02793534.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4486]
 gi|168773652|ref|ZP_02798659.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4196]
 gi|168778401|ref|ZP_02803408.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4076]
 gi|168787782|ref|ZP_02812789.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC869]
 gi|168798806|ref|ZP_02823813.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC508]
 gi|195936587|ref|ZP_03081969.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208809242|ref|ZP_03251579.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4206]
 gi|208814040|ref|ZP_03255369.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4045]
 gi|208819013|ref|ZP_03259333.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4042]
 gi|209395878|ref|YP_002271913.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4115]
 gi|217326825|ref|ZP_03442908.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. TW14588]
 gi|254794389|ref|YP_003079226.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223122|ref|ZP_05937403.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259325|ref|ZP_05951858.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|21362581|sp|Q8XBI4|HEM6_ECO57 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740876|sp|B5YZY1|HEM6_ECO5E RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|13362777|dbj|BAB36730.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187770584|gb|EDU34428.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4196]
 gi|188017108|gb|EDU55230.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4113]
 gi|189003195|gb|EDU72181.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4076]
 gi|189356604|gb|EDU75023.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4401]
 gi|189362170|gb|EDU80589.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4486]
 gi|189368463|gb|EDU86879.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4501]
 gi|189372256|gb|EDU90672.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC869]
 gi|189378668|gb|EDU97084.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC508]
 gi|208729043|gb|EDZ78644.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4206]
 gi|208735317|gb|EDZ84004.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4045]
 gi|208739136|gb|EDZ86818.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4042]
 gi|209157278|gb|ACI34711.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC4115]
 gi|209764010|gb|ACI80317.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764012|gb|ACI80318.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764016|gb|ACI80320.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|217319192|gb|EEC27617.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. TW14588]
 gi|254593789|gb|ACT73150.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320188776|gb|EFW63435.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. EC1212]
 gi|326340239|gb|EGD64043.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. 1125]
 gi|326344924|gb|EGD68668.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O157:H7
           str. 1044]
          Length = 299

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+        GGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQREGGG-----GGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGKDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|166363411|ref|YP_001655684.1| coproporphyrinogen III oxidase [Microcystis aeruginosa NIES-843]
 gi|166085784|dbj|BAG00492.1| coproporphyrinogen III oxidase, aerobic [Microcystis aeruginosa
           NIES-843]
          Length = 315

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 159/305 (52%), Gaps = 43/305 (14%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            ++LQ  IC   E+++ +A           F    W R      + GGGR   L  G +F
Sbjct: 1   MKSLQDEICQGLEEVDGQA----------KFIEDSWQR-----PEGGGGRSRVLREGAIF 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S V+G   P    +         F+ATG S+++HP+NP++P VH N R     
Sbjct: 46  EQAGVNFSEVWGKELPPSIAKQRPEAAGHQFYATGTSMVLHPHNPYIPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP      ++++ D   FH T K++C QH    Y  +K WCD YFYL H
Sbjct: 106 PVWWFGGGADLTPY-----YAFEEDASHFHRTFKQVCDQHHPEYYPVFKRWCDEYFYLNH 160

Query: 204 RQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFISAVGDCF 241
           RQE+RGIGGIFFD+                        S  +    +  FSFI+  G  F
Sbjct: 161 RQEARGIGGIFFDYQDGLDPLYRGPFAESDAAIYSEKLSPQQPRNWEEIFSFINDCGRAF 220

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V++     + +++RQ QL RRGRY EFNL+YD+GT FG +T G  ESIL S+P
Sbjct: 221 LPAYVPIVQKRRSTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLP 280

Query: 302 PLVAW 306
           PLV W
Sbjct: 281 PLVRW 285


>gi|88705374|ref|ZP_01103085.1| Coproporphyrinogen III oxidase [Congregibacter litoralis KT71]
 gi|88700464|gb|EAQ97572.1| Coproporphyrinogen III oxidase [Congregibacter litoralis KT71]
          Length = 310

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 156/303 (51%), Gaps = 34/303 (11%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             + IE      +     LQ  IC    +++  A           FT++ W R      +
Sbjct: 1   MSEMIEP----IKEYLLGLQDSICESLAQVDGGAE----------FTIEEWDR-----PE 41

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGGR   L  G V EKA V  S V GD  P              + A G+S+++HP NP
Sbjct: 42  GGGGRSRVLSDGAVLEKAGVNFSHVMGDQLPGSATAARPELAGRSYQAMGVSLVIHPRNP 101

Query: 130 HVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           + P  H N+R+ +         +WFGGG DLTP      + ++ D + +H T  + C+  
Sbjct: 102 YAPTSHANVRLFIAEKPGEEPVWWFGGGYDLTPY-----YGFEEDCVHWHKTAADACAPF 156

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  YK+WCD YFYL HR E RGIGG+F+D L++       D  F+F+ A+GD ++ 
Sbjct: 157 GDEVYPKYKKWCDEYFYLKHRNEPRGIGGLFYDDLNTW----DFDTCFAFMRAIGDSYLA 212

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            Y  ++ R     + +++RQ QL RRGRY EFNL++D+GT FG ++ G  E+IL S+PPL
Sbjct: 213 AYRPILERRKDTPYDDRERQFQLYRRGRYVEFNLVFDRGTLFGLQSNGRTEAILMSLPPL 272

Query: 304 VAW 306
           V W
Sbjct: 273 VRW 275


>gi|126740635|ref|ZP_01756322.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
 gi|126718436|gb|EBA15151.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
          Length = 297

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 120/305 (39%), Positives = 165/305 (54%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKE 68
              +++E+K ++   F  L++ I   FE+LE        A   P  F V    R   +  
Sbjct: 1   MNAEMKEQKALAAAWFRELRNQIVAAFEELEQSHTTGPFAELEPGSFEVTETKRGSDEGA 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +S VYG       ++   +  + G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISEVYGTLGERAQMAMAARKGLPGMKDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NP VPAVH N RM  T   +WFGGG DL P +E     YD D   FH T K    
Sbjct: 121 VAHMRNPRVPAVHMNTRMFWTPHGWWFGGGSDLNPCIE-----YDEDTAHFHQTQKRHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y+  K+W D YFY+PHR  +RG+GGIF D  +S    G   ADF+    +G  F
Sbjct: 176 PHGEDLYSQLKDWADEYFYIPHRGRARGVGGIFMDDRNS----GDWQADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +     FSE DR+ QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYVPLVEKRRQQGFSEADREAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|312882746|ref|ZP_07742481.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369604|gb|EFP97121.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 305

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 117/297 (39%), Positives = 154/297 (51%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   +     LQ  IC + E+++  A           F    W R+  +K   GGGR 
Sbjct: 4   IDKNAVKAFLMELQDSICQQLERVDGRAA----------FEEDEWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G +FE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVLRNGAIFEQGGVNFSHVAGAQMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D   +HN  KE+C       Y 
Sbjct: 113 ANVRFFIAESEGKEPIWWFGGGFDLTPFYP-----FEEDARDWHNIAKELCLPFGEDVYR 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +KEWCD YF+LPHR E+RGIGG+FFD L+  P     +  F +I AVGD + K Y  +V
Sbjct: 168 QHKEWCDDYFFLPHRDETRGIGGLFFDDLNHWP----FEKCFDYIKAVGDGYTKAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +     F E++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 EKRKSIEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|168238244|ref|ZP_02663302.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194737732|ref|YP_002115518.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|226740900|sp|B4TR28|HEM6_SALSV RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194713234|gb|ACF92455.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197288914|gb|EDY28287.1| coproporphyrinogen III oxidase, aerobic [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 299

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC +    +              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQKLSAADG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RG+GG+FFD L++       D  F+F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGVGGLFFDDLNTP----DFDHCFAFMQAVGNGYTQAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|331653863|ref|ZP_08354864.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M718]
 gi|331048712|gb|EGI20788.1| coproporphyrinogen III oxidase, aerobic [Escherichia coli M718]
          Length = 299

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+        GGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQREGGG-----GGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCQPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|110832996|ref|YP_691855.1| coproporphyrinogen III oxidase [Alcanivorax borkumensis SK2]
 gi|123345891|sp|Q0VTD7|HEM6_ALCBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|110646107|emb|CAL15583.1| coproporphyrinogen III oxidase, aerobic [Alcanivorax borkumensis
           SK2]
          Length = 302

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +    +LQ  IC      +  A           F    W R++      GGGR   L
Sbjct: 7   QAVKDYLLDLQDRICDALGAEDGAA----------TFREDSWEREQG-----GGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S V+G+  P    +         F A G+S+++HP NP+VP  H N+
Sbjct: 52  ENGAVIEKGGVNFSHVFGEQLPPSATEARPELAGRSFQAMGVSLVIHPKNPYVPTSHANV 111

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP      + ++ DV+ +H T K  C       Y  +K
Sbjct: 112 RFFVAEKEGEAPVWWFGGGFDLTPY-----YGFEEDVVHWHQTAKVACQPFGKEIYPEFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E RG+GG+FFD L+        D  F+ + ++GD ++  Y  ++ R 
Sbjct: 167 TWCDDYFYLKHRNEPRGVGGLFFDDLNR----FDFDTSFALMRSIGDAYVPAYQPILARR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H F +++RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 223 KDHEFGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQSGGRTESILMSLPPLVRW 276


>gi|39934586|ref|NP_946862.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris CGA009]
 gi|39648435|emb|CAE26956.1| putative coproporphyrinogen III oxidase precursor [Rhodopseudomonas
           palustris CGA009]
          Length = 303

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 125/306 (40%), Positives = 174/306 (56%), Gaps = 10/306 (3%)

Query: 2   NLCTIEIGCPDD-IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           +L        ++ +E R+  ++  FE L+  IC E E LE EA        P  FT K W
Sbjct: 6   DLDRTPAASSENPVEARRTQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPW 65

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R       +GG     L  G++FEK  +  S+  G L+P+    + G   +  + +T +
Sbjct: 66  QRKTGAGGGVGGF----LSNGRLFEKIGIHTSSANGKLTPEMAKNVPGD-GSLDYVSTSI 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I+HP +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C
Sbjct: 121 SLIMHPRSPRVPTVHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDAVIFHTAMKHAC 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H  A Y  +K W D YF+LPHR  +RG+GGIFFD+L+S    G  D DF+F  AVG  
Sbjct: 181 DAHDPAYYDKFKPWADTYFFLPHRGVARGVGGIFFDYLNS----GDFDRDFAFTRAVGSA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            + +YP +VR+     +++ +R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SM
Sbjct: 237 LLDVYPKIVRKRMIEPWTDAERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSM 296

Query: 301 PPLVAW 306
           PPLV+W
Sbjct: 297 PPLVSW 302


>gi|268593177|ref|ZP_06127398.1| coproporphyrinogen III oxidase [Providencia rettgeri DSM 1131]
 gi|291311223|gb|EFE51676.1| coproporphyrinogen III oxidase [Providencia rettgeri DSM 1131]
          Length = 305

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 111/301 (36%), Positives = 161/301 (53%), Gaps = 34/301 (11%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            DIE      +   ++LQ  IC +  +L+ +          + F  + W R      + G
Sbjct: 4   PDIE----RVKTYLQSLQEAICQKITELDGK----------ETFLEQTWER-----SEGG 44

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GGR   L  G +FE+A V  S + G+  P              + A G+S+++HP NP++
Sbjct: 45  GGRSRVLTKGALFEQAGVNFSHIKGEKLPASASAHRPELAGRSYQAMGVSLVIHPLNPYI 104

Query: 132 PAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N+R            +WFGGG DLTP      + +  DVI +H   +++C  +  
Sbjct: 105 PTTHANVRFFIAEKEGCEPVWWFGGGFDLTPF-----YGFHEDVIHWHTVARDLCRPYGT 159

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  YK WCD YF+L HR E RG+GG+F+D L+     GG ++ F+F  AVG+ F+  Y
Sbjct: 160 DVYPKYKNWCDEYFFLKHRNEPRGVGGLFYDDLN----QGGFESCFNFTQAVGNGFLDAY 215

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V +   H + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 216 VPIVEKRKDHSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 275

Query: 306 W 306
           W
Sbjct: 276 W 276


>gi|261250596|ref|ZP_05943171.1| coproporphyrinogen III oxidase aerobic [Vibrio orientalis CIP
           102891]
 gi|260939165|gb|EEX95152.1| coproporphyrinogen III oxidase aerobic [Vibrio orientalis CIP
           102891]
          Length = 305

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 114/297 (38%), Positives = 155/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++    LQ  IC + E+ +  A           F    W R+  +K   GGGR 
Sbjct: 4   IDKLAVKQFLMTLQDSICQQLEQADGSAV----------FVEDEWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP NP+VP  H
Sbjct: 53  RVMKEGAVFEQGGVNFSHVQGKEMPASATAHRPELAGRRFEAMGVSLVMHPNNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D  ++HNT KE+C+      Y+
Sbjct: 113 ANVRFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDAQYWHNTAKEVCAPFGNEVYS 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG  +   Y  +V
Sbjct: 168 EHKAWCDKYFYLPHRDETRGVGGLFFDDLNHWE----FDKCFEYIKAVGQGYTDAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETEYGERERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|332304415|ref|YP_004432266.1| Coproporphyrinogen oxidase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171744|gb|AEE20998.1| Coproporphyrinogen oxidase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 307

 Score =  327 bits (839), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 115/292 (39%), Positives = 152/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++   NLQ  IC   E  + +            F   +W R+       GGGR   L  
Sbjct: 12  VKQFLLNLQDNICQTLEMADGK----------GCFIEDNWQRE-----LGGGGRTRVLTN 56

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G V E+  V  S VYG   P              F A G+S+++HP NPHVP  H N+R+
Sbjct: 57  GHVIEQGGVNFSHVYGGQLPASATASRPELAGRSFQAMGVSLVIHPKNPHVPTSHANVRI 116

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP           DV+ +H T K++C       Y+ YK+W
Sbjct: 117 FIAEKEGEEPIWWFGGGFDLTPFYP-----VHEDVLHWHQTAKDLCEPFGDGVYSKYKKW 171

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR E+RG+GG+FFD L+      G +  F F+ AVG+ F+  Y  ++ +   
Sbjct: 172 CDEYFYLKHRDETRGVGGLFFDDLNEW----GFERSFEFMQAVGNGFLDAYVPILEKRKD 227

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             FSEQ+R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 228 MSFSEQERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 279


>gi|330876385|gb|EGH10534.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 304

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 149/299 (49%), Gaps = 30/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTTLEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP++PHVP 
Sbjct: 46  RTRVVENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRW 275


>gi|317491256|ref|ZP_07949692.1| coproporphyrinogen III oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920803|gb|EFV42126.1| coproporphyrinogen III oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 305

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 153/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    NLQ  +C +    + ++           F   +W R+       GGGR   L
Sbjct: 7   AQVKAFLLNLQDSLCQQIAAADGQS----------TFREDNWQRE-----AGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G   P              F A G+S+++HP NP+VP  H N+
Sbjct: 52  TQGAVFEQAGVNFSHVTGGQLPASATAHRPELAGRSFEAMGVSLVIHPQNPYVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        +  DV+ +H T + +C       Y  YK
Sbjct: 112 RFFIAEKEGEEPVWWFGGGFDLTPFYP-----FKDDVLHWHRTARNLCLPFGEDVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFY+ HRQESRG+GG+FFD L++       D  F+F+ AVG  F   Y  +V + 
Sbjct: 167 KWCDEYFYIKHRQESRGVGGLFFDDLNTP----DFDHCFAFMQAVGAGFSDAYLPIVAKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               FS+++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KDMPFSDRERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|291283664|ref|YP_003500482.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O55:H7
           str. CB9615]
 gi|209764008|gb|ACI80316.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|209764014|gb|ACI80319.1| coproporphyrinogen III oxidase [Escherichia coli]
 gi|290763537|gb|ADD57498.1| Coproporphyrinogen III oxidase, aerobic [Escherichia coli O55:H7
           str. CB9615]
 gi|320640949|gb|EFX10433.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           G5101]
 gi|320646230|gb|EFX15157.1| coproporphyrinogen III oxidase [Escherichia coli O157:H- str.
           493-89]
 gi|320651736|gb|EFX20116.1| coproporphyrinogen III oxidase [Escherichia coli O157:H- str. H
           2687]
 gi|320657121|gb|EFX24930.1| coproporphyrinogen III oxidase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662880|gb|EFX30208.1| coproporphyrinogen III oxidase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667767|gb|EFX34678.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 299

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+        GGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQREGGG-----GGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|192290099|ref|YP_001990704.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris TIE-1]
 gi|192283848|gb|ACF00229.1| Coproporphyrinogen oxidase [Rhodopseudomonas palustris TIE-1]
          Length = 303

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 125/306 (40%), Positives = 175/306 (57%), Gaps = 10/306 (3%)

Query: 2   NLCTIEIGCPDD-IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           +L        ++ +E R+  ++  FE L+  IC E E LE EA        P  FT K W
Sbjct: 6   DLDRTPAASSENPVEARRTQARAWFEGLRDRICAEIETLEREAPAELFPGEPATFTYKPW 65

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R       +GG     L  G++FEK  +  S+  G L+P+    + G   +  + +T +
Sbjct: 66  QRKTGAGGGVGGF----LSNGRLFEKIGIHTSSANGKLTPEMAKNVPGD-GSLDYVSTSI 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I+HP +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C
Sbjct: 121 SLIMHPRSPRVPTVHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDALIFHTAMKHAC 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H  A Y  +K W D YF+LPHR  +RG+GGIFFD+L+S    G  D DF+F  AVG  
Sbjct: 181 DAHDPAYYDKFKPWADTYFFLPHRGVARGVGGIFFDYLNS----GDFDRDFAFTRAVGSA 236

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            + +YP +VR+     +++++R +QL  RG Y EFNLLYD+GT FG +TGGN E+I++SM
Sbjct: 237 LLDVYPKIVRKRMIEPWTDEERAQQLACRGLYVEFNLLYDRGTMFGLQTGGNTETIMSSM 296

Query: 301 PPLVAW 306
           PPLV+W
Sbjct: 297 PPLVSW 302


>gi|89092295|ref|ZP_01165249.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
 gi|89083383|gb|EAR62601.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
          Length = 304

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 147/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E+ +              F    W R+       GGGR   L
Sbjct: 7   EAVKEYLLGLQDAICDALEQADG----------GGKFIEDAWQRE-----AGGGGRTRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + EK  V  S V+GD  P              F A G+S+++HP+NP++P  H N+
Sbjct: 52  NNGSIIEKGGVNFSHVFGDKLPGSATAHRPELAGRSFQAMGVSLVIHPHNPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP   +     D D  F+H T KE C       Y  +K
Sbjct: 112 RFFIAEKEGEEPVWWFGGGFDLTPYYGN-----DEDCKFWHETAKEACDPFGEDIYPRFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           EWCD YFYL HR E RG+GG+FFD L+      G +  F+ + ++G+ + K Y  ++ +N
Sbjct: 167 EWCDEYFYLKHRDEPRGVGGLFFDDLNE----LGFEKSFALMQSIGNAYTKAYLPIIEKN 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E+ R  QL RRGRY EFNL++D+GT FG ++GG  ESIL S+PP V W
Sbjct: 223 KDKEYGERQRDFQLHRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPEVRW 276


>gi|62181020|ref|YP_217437.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224583014|ref|YP_002636812.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75481828|sp|Q57LQ6|HEM6_SALCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|254800276|sp|C0PZ88|HEM6_SALPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|62128653|gb|AAX66356.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224467541|gb|ACN45371.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322715502|gb|EFZ07073.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 299

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            ++    LQ  IC +   ++              F    W R+       GGGR   L  
Sbjct: 8   VKQFLLRLQDDICQKLSAVDG-----------ANFVEDSWRRE-----AGGGGRSRVLRN 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S V+GD  P              F A G+S++VHP+NP++P  H N+R 
Sbjct: 52  GGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRF 111

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T +++C       Y  YK+W
Sbjct: 112 FIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCQPFGDDVYPRYKKW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E RGIGG+FFD L++       D  F F+ AVG+ + + Y  +V R   
Sbjct: 167 CDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFDFMQAVGNGYTRAYLPIVERRKA 222

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|330831503|ref|YP_004394455.1| Coproporphyrinogen-III oxidase [Aeromonas veronii B565]
 gi|328806639|gb|AEB51838.1| Coproporphyrinogen-III oxidase, aerobic [Aeromonas veronii B565]
          Length = 302

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E+ +              F    W R+        GGR   L
Sbjct: 7   AQVKAFLLQLQDEICRGLEQADGS----------GHFVEDAWSREGGG-----GGRTRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S VYGD  P              F A G+S+++HP+NP+VP  H N+
Sbjct: 52  RHGAVIEQGGVNFSHVYGDAMPASATAHRPELAGRKFEAMGVSLVIHPHNPYVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        +  DV  +H   +++C       Y  +K
Sbjct: 112 RFFIAEKEGEDPIWWFGGGFDLTPFYP-----FAEDVQHWHQVSRDLCQPFGDEIYPEFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCDRYF+L HR E+RG+GG+FFD L+  P        F+F+ AVG  ++  Y  ++ R 
Sbjct: 167 SWCDRYFFLKHRNETRGVGGLFFDDLNRWP----FADCFAFMQAVGRGYLDAYLPIIERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPL  W
Sbjct: 223 KALPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|15802967|ref|NP_288997.1| coproporphyrinogen III oxidase [Escherichia coli O157:H7 EDL933]
 gi|12516817|gb|AAG57554.1|AE005474_2 coproporphyrinogen III oxidase [Escherichia coli O157:H7 str.
           EDL933]
          Length = 299

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+        GGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQREGGG-----GGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGKDVYPRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AXAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|283786069|ref|YP_003365934.1| coproporphyrinogen III oxidase [Citrobacter rodentium ICC168]
 gi|282949523|emb|CBG89138.1| coproporphyrinogen III oxidase [Citrobacter rodentium ICC168]
          Length = 299

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 155/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++   +  ++    LQ  IC +   ++              F    W R+       GGG
Sbjct: 1   MKPDAQRVKQFLLTLQESICGQLCAVDG-----------AQFVEDSWQRE-----AGGGG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G VFE+A V  S V+GD  P              F A G+S++VHP NP++P 
Sbjct: 45  RSRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYIPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + +  D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFAEDAVHWHRTARDLCLPFGEEV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YF+L HR E RGIGG+FFD L++       D  F+F+ AVG  + + Y  
Sbjct: 160 YPRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTEAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R    ++ E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKAMIWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|271499349|ref|YP_003332374.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech586]
 gi|270342904|gb|ACZ75669.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech586]
          Length = 312

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++    LQ  +C + E  +  A           F    W          GGGR   L
Sbjct: 7   NAIKQFLLGLQDTLCRQLELADGTAS----------FIEDAWQ-----HASGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V G   P              F A G+S+++HP NP+VP  H NI
Sbjct: 52  RQGRVFEQAGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANI 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK
Sbjct: 112 RFFIAEKPGEPAVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFDLCQPFGDDVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R 
Sbjct: 167 KWCDDYFFLKHRNEARGVGGLFFDDLNTP----DFDTSFAFMRAVGEGFQHAYLPIVNRR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 223 KDIPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|238895905|ref|YP_002920641.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae NTUH-K2044]
 gi|238548223|dbj|BAH64574.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 299

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/299 (37%), Positives = 155/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDNLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEEV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     +SE++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKATPYSERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|330013618|ref|ZP_08307704.1| coproporphyrinogen III oxidase [Klebsiella sp. MS 92-3]
 gi|328533442|gb|EGF60177.1| coproporphyrinogen III oxidase [Klebsiella sp. MS 92-3]
          Length = 299

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 154/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDNLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEEV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|325923783|ref|ZP_08185398.1| coproporphyrinogen oxidase [Xanthomonas gardneri ATCC 19865]
 gi|325545716|gb|EGD16955.1| coproporphyrinogen oxidase [Xanthomonas gardneri ATCC 19865]
          Length = 299

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 146/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++  A           F    W R++      GGGR   L
Sbjct: 5   DRVRDYLTGLQDRICAAVEAIDGSA----------RFAEDLWQREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NPH+P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGSRLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP         D DV+ +H T + +C+      Y   K
Sbjct: 110 RYFRAERDGDVVAAWFGGGFDLTPFYP-----VDEDVLHWHRTAQALCAPFGEERYAAQK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLD-----KDFERDFAYQRAVGDGFLDAYLPIVERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|152971310|ref|YP_001336419.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|262042059|ref|ZP_06015236.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|166217801|sp|A6TC68|HEM6_KLEP7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|150956159|gb|ABR78189.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259040599|gb|EEW41693.1| coproporphyrinogen III oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 299

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 154/299 (51%), Gaps = 31/299 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++      +     LQ  +C +   ++              F    W R+        GG
Sbjct: 1   MKPDAAQVKTFLLQLQDSLCQQLSAVDG-----------APFIEDAWQREGGG-----GG 44

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+VFE+A V  S V+GD  P              F A G+S++VHP NP+VP 
Sbjct: 45  RSRVLREGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYVPT 104

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      + ++ D + +H T +++C       
Sbjct: 105 SHANVRFFIAEKPGADPVWWFGGGFDLTPY-----YGFEEDAVHWHRTARDLCLPFGEEV 159

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK+WCD YFYL HRQE RGIGG+FFD L++       D  F+F+ AVG+ +   Y  
Sbjct: 160 YPRYKKWCDDYFYLKHRQEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGNGYADAYLP 215

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +V R     + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 216 IVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|323496968|ref|ZP_08101996.1| coproporphyrinogen III oxidase [Vibrio sinaloensis DSM 21326]
 gi|323318042|gb|EGA71025.1| coproporphyrinogen III oxidase [Vibrio sinaloensis DSM 21326]
          Length = 305

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 114/297 (38%), Positives = 156/297 (52%), Gaps = 26/297 (8%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K   ++    LQ  IC + E+ + +A           F    W R+  +K   GGGR 
Sbjct: 4   IDKHAVKQFLMELQDSICQQLEQADGKAE----------FIEDAWHREPGEK-LGGGGRT 52

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G VFE+  V  S V G   P              F A G+S+++HP+NP+VP  H
Sbjct: 53  RVMRDGAVFEQGGVNFSHVEGKEMPASATAHRPELAGRRFEAMGVSLVMHPHNPYVPTSH 112

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP        ++ D  ++HNT KE+C+      Y 
Sbjct: 113 ANVRFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDAQYWHNTAKEVCAPFGSEVYA 167

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD+YFYLPHR E+RG+GG+FFD L+        D  F +I AVG  + + Y  +V
Sbjct: 168 EHKVWCDKYFYLPHRDETRGVGGLFFDDLNHWQ----FDKCFDYIKAVGQGYCQAYLPIV 223

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E+ RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 ERRKETEYGERQRQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 280


>gi|254281629|ref|ZP_04956597.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR51-B]
 gi|219677832|gb|EED34181.1| coproporphyrinogen III oxidase, aerobic [gamma proteobacterium
           NOR51-B]
          Length = 305

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +    +LQ  IC    +++            K FT + W R      + GGG    +
Sbjct: 4   KAVEHYLRDLQGRICDGLAEIDG----------AKTFTEESWDR-----PEGGGGTTRVI 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEK  V  S V G   P    +         F A G+S+++HP NP+VP  H N+
Sbjct: 49  ADGNVFEKGGVNFSHVTGTNLPPSATESRPELAGRSFRAMGVSLVIHPKNPYVPTSHANV 108

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM V         +W GGG DLTP           D + +H T +E C       Y  +K
Sbjct: 109 RMFVAEKPGEEPVWWMGGGFDLTPYYGDA-----DDAVSWHRTAQEACEPFGDDVYPRFK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HRQE+RG+GG+F+D L+      G D  F+F+ +VGD +++ Y  +VR++
Sbjct: 164 KWCDDYFYLKHRQEARGVGGLFYDDLNEW----GFDRTFAFMRSVGDAYLEAYAPIVRKH 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL+YD+GT FG ++ G  E+IL S+PPLV W
Sbjct: 220 KDDAYGERERQWQLYRRGRYVEFNLVYDRGTLFGLQSNGRTEAILMSLPPLVRW 273


>gi|259907799|ref|YP_002648155.1| coproporphyrinogen III oxidase [Erwinia pyrifoliae Ep1/96]
 gi|224963421|emb|CAX54909.1| Coproporphyrinogen III oxidase [Erwinia pyrifoliae Ep1/96]
 gi|283477669|emb|CAY73585.1| coproporphyrinogen III oxidase [Erwinia pyrifoliae DSM 12163]
          Length = 302

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++   NLQ  IC + E+ +  A           F    W R        GGGR   L
Sbjct: 7   AQVKQFLLNLQDEICHKLEQADGAA----------RFAEDSWQR-----PGGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V+GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  RHGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEALGVSLVIHPENPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T   +C       +  YK
Sbjct: 112 RFFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFNLCQPFGPEVWPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RGIGG+FFD L++     G +  F F+ AVG  F   Y  +V R 
Sbjct: 167 KWCDDYFHLKHRNEQRGIGGLFFDDLNAD----GFEQSFRFMQAVGRGFSDAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KGLPWGQRERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|255263112|ref|ZP_05342454.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
 gi|255105447|gb|EET48121.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
          Length = 296

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 117/304 (38%), Positives = 157/304 (51%), Gaps = 16/304 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKE 68
             +     K  +   FE L+  I T FE+LE+ +    +A+     F      R      
Sbjct: 1   MTEPFASEKAQAAAWFETLRDEIVTAFERLEDTQTDGPTAHLPAGRFEQTATTRSSDNGA 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLSVI 123
           D GGG M+ +  G+VFEK  V  STVYG L    +  +      G   +P FWA+G+S++
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNTSTVYGQLGESAQKAMAARGVPGMAVDPRFWASGISLV 120

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH   K    +
Sbjct: 121 AHVQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDDDTAHFHAVQKRHLDR 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H  A+Y   K W D YFY+PHR  +RG+GGIF D   +    G    DF+    +G  F+
Sbjct: 176 HDTAHYPKLKAWADEYFYIPHRNRARGVGGIFMDDYCT----GDWATDFALTQDIGCAFL 231

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV       +S+ D+  QLI RG YAE+NL+YD+GT FG  TG +  ++L S+PP
Sbjct: 232 PAYVPLVENRRTLGWSDADKDTQLIHRGLYAEYNLVYDRGTKFGLTTGHDANAVLMSLPP 291

Query: 303 LVAW 306
           +  W
Sbjct: 292 MAKW 295


>gi|238788090|ref|ZP_04631885.1| Coproporphyrinogen III oxidase [Yersinia frederiksenii ATCC 33641]
 gi|238723677|gb|EEQ15322.1| Coproporphyrinogen III oxidase [Yersinia frederiksenii ATCC 33641]
          Length = 308

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 158/305 (51%), Gaps = 35/305 (11%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD         +    +LQ  I T   + +  A           FT ++W R++   
Sbjct: 1   MNLPDI-----TQVKAYLLDLQDKISTALSEADGRAE----------FTEENWTREEG-- 43

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP 
Sbjct: 44  ---GGGRSRVLINGAVFEQAGVNFSHVSGATLPASATAHRPELAGRSFQALGVSLVIHPL 100

Query: 128 NPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +P++P  H N+R  +         +WFGGG DLTP      + ++ D I +H T  ++C 
Sbjct: 101 SPYLPTSHANVRFFIAEKPGEEPVWWFGGGFDLTPF-----YGFEEDAIHWHQTAWQLCQ 155

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  YK+WCD YFY+ HR E+RGIGG+FFD L+S       D  F+F  AVGD F
Sbjct: 156 PFGEDIYPRYKKWCDDYFYIKHRNEARGIGGLFFDDLNSP----DFDTCFNFTQAVGDGF 211

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P
Sbjct: 212 LDAYLPIVARRKALSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLP 271

Query: 302 PLVAW 306
           PLV W
Sbjct: 272 PLVRW 276


>gi|242240615|ref|YP_002988796.1| coproporphyrinogen oxidase [Dickeya dadantii Ech703]
 gi|242132672|gb|ACS86974.1| Coproporphyrinogen oxidase [Dickeya dadantii Ech703]
          Length = 311

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 114/302 (37%), Positives = 153/302 (50%), Gaps = 34/302 (11%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
             DI+      +     LQ  IC + E+++  A           F    W          
Sbjct: 6   SPDID----AIKHFLLTLQDSICRQLEQVDGNAV----------FQEDAWQ-----HASG 46

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPH 130
           GGGR   L  G VFE+A V  S V G   P              F A G+S+++HP NP+
Sbjct: 47  GGGRSRVLRQGTVFEQAGVNFSHVSGAALPPSASMHRPELAGRRFQAMGVSLVIHPLNPY 106

Query: 131 VPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
           VP  H N+R  +         +WFGGG DLTP      + +  D I +H T   +C    
Sbjct: 107 VPTSHANVRFFIAEKDGEPPVWWFGGGFDLTPF-----YGFKEDAIHWHQTAFALCRPFG 161

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
              Y  YK+WCD YF+L HR E+RGIGG+FFD L++       D  F+F+ AVG+ F+  
Sbjct: 162 DDVYPRYKKWCDDYFFLKHRGEARGIGGLFFDDLNAP----DFDTSFAFMRAVGEGFLHA 217

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V R     + +++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV
Sbjct: 218 YLPIVNRRKPLAWGDRERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLV 277

Query: 305 AW 306
            W
Sbjct: 278 RW 279


>gi|21233441|ref|NP_639358.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770405|ref|YP_245167.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|24211744|sp|Q8P3Q0|HEM6_XANCP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|81303648|sp|Q4UP76|HEM6_XANC8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|21115285|gb|AAM43240.1| coproporphyrinogen III oxidase, aerobic [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575737|gb|AAY51147.1| coproporphyrinogen III oxidase, aerobic [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 299

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 146/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E ++ +A           F    W R +      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAIDGKA----------RFAEDLWQRAEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NPH+P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGARLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP         D DV+ +H T + +C+      Y  +K
Sbjct: 110 RYFRAERDGEMVAAWFGGGFDLTPFYP-----VDEDVMHWHRTAQALCAPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLGQ-----DFERDFAYQRAVGDGFLDAYLPIVERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPYGEAERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPQVRW 273


>gi|310815395|ref|YP_003963359.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
 gi|308754130|gb|ADO42059.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
          Length = 301

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 160/300 (53%), Gaps = 16/300 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLE-NEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +EE ++ +   F +L+  I T FE  E  +    +A+  P  F V    R     EDLGG
Sbjct: 10  MEEERKTAADWFRSLRDEIVTAFEAAEHGDLAGPTADLPPARFEVTPTPRHGENGEDLGG 69

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGD-----LSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
           G M+ +  G+VFEK  V  S V G      +    +  + G   +P FWA G+S++ H  
Sbjct: 70  GIMSVMRGGRVFEKVGVNFSAVEGTLGEGAIRSMAQRGVPGIEADPRFWAAGISLVAHMQ 129

Query: 128 NPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPHVPAVH N RM  T + +WFGGG DL P +      Y  D   FH T +   + H   
Sbjct: 130 NPHVPAVHMNTRMFWTPSAWWFGGGADLNPPIP-----YAEDTAHFHATQESFIAPHGEG 184

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y   K W D YF++PHR  +RG+GG F D  ++    G   ADF+    +G  F+  Y 
Sbjct: 185 LYPQLKAWADEYFFIPHRGRARGVGGTFMDDRNT----GDWAADFALTRDIGRAFLPSYL 240

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L+ R  +  ++E DR  QLI RG YAE+NL++D+GT FG  TG N +++L S+PPL  W
Sbjct: 241 PLIERRRNTPWTEADRDTQLIYRGLYAEYNLVWDRGTKFGLATGHNADAVLMSLPPLAKW 300


>gi|284929730|ref|YP_003422252.1| coproporphyrinogen oxidase [cyanobacterium UCYN-A]
 gi|284810174|gb|ADB95871.1| coproporphyrinogen oxidase [cyanobacterium UCYN-A]
          Length = 344

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 120/330 (36%), Positives = 165/330 (50%), Gaps = 47/330 (14%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           N  + +I  P   E+ K    +  +NLQ  IC   EK +              F   +W 
Sbjct: 8   NSSSYKISTPP--EDAKTRVSQFMKNLQDEICHSLEKADR----------RGQFQEDNWQ 55

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R++      GGGR   L  G + E+  V  S V+G+  P    +     +   F+ATG S
Sbjct: 56  REEG-----GGGRSRVLKNGDLLEQGGVNFSEVWGEKLPLSIIKQRPEAQGHKFYATGTS 110

Query: 122 VIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP+NP++P VH N R       +WFGGGIDLTP        +  D  FFH TLK+ C
Sbjct: 111 MVLHPHNPYIPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FAEDATFFHKTLKQTC 165

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH--------------------- 219
            +H    Y  +K WCD YFYL HRQE+RG+GGIFFD+                       
Sbjct: 166 DKHHEQYYPTFKSWCDEYFYLKHRQETRGVGGIFFDYQDGSYPLYRGSSTDKTVSKDDAQ 225

Query: 220 ---SSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFN 276
              S  +    +  F+F+S  G  F+  Y  +V +     + +++RQ QL RRGRY EFN
Sbjct: 226 ISISESKPRTWEDIFAFVSDCGQTFLPAYLPIVEKRRDLQYGDRERQFQLYRRGRYVEFN 285

Query: 277 LLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           L+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 286 LVYDRGTIFGLQTNGRTESILMSLPPLVRW 315


>gi|292488970|ref|YP_003531857.1| coproporphyrinogen III oxidase [Erwinia amylovora CFBP1430]
 gi|292900107|ref|YP_003539476.1| coproporphyrinogen III oxidase [Erwinia amylovora ATCC 49946]
 gi|291199955|emb|CBJ47079.1| coproporphyrinogen III oxidase [Erwinia amylovora ATCC 49946]
 gi|291554404|emb|CBA21853.1| coproporphyrinogen III oxidase [Erwinia amylovora CFBP1430]
 gi|312173133|emb|CBX81388.1| coproporphyrinogen III oxidase [Erwinia amylovora ATCC BAA-2158]
          Length = 302

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++   NLQ  IC + E+ +  A           F    W R        GGGR   L
Sbjct: 7   AQVKQFLLNLQDEICQKLEQADGAA----------RFAEDSWQR-----PGGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V+GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  RHGQVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEALGVSLVIHPENPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T   +C       +  YK
Sbjct: 112 RFFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFNLCQPFGAEVWPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RGIGG+FFD L++     G +  F F+ AVG  F   Y  +V R 
Sbjct: 167 KWCDDYFHLKHRNEQRGIGGLFFDDLNAE----GFEQSFRFMQAVGRGFSDAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KGLPWGQRERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|113474939|ref|YP_721000.1| coproporphyrinogen III oxidase [Trichodesmium erythraeum IMS101]
 gi|110165987|gb|ABG50527.1| coproporphyrinogen oxidase [Trichodesmium erythraeum IMS101]
          Length = 343

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 115/323 (35%), Positives = 152/323 (47%), Gaps = 43/323 (13%)

Query: 7   EIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQ 66
           EI       + K    +  + LQ  IC   E+L+              F    W R    
Sbjct: 9   EISLSVPASDTKERVSQFMQTLQDEICQGLEELDG----------VSKFKEDSWKR---- 54

Query: 67  KEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
               GGG+   +  G VFE+  V  S V+GD  P    +         F+ATG S+++HP
Sbjct: 55  -PGGGGGKSRVIRDGGVFEQGGVNFSEVWGDKLPPSVLKQRPEAAGNSFYATGTSMVLHP 113

Query: 127 YNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NP+VP VH N R       +WFGGG+DLTP        Y  D   FH T+K  C +   
Sbjct: 114 KNPYVPTVHLNYRYFEAGSVWWFGGGVDLTPYYP-----YAEDAAHFHQTIKAACDKSHK 168

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE---------------------- 223
             Y  +K WCD YFYL HRQE+RG+GGIFFD+     E                      
Sbjct: 169 EYYPIFKRWCDEYFYLKHRQETRGVGGIFFDYQDGQGELYKGPDNQGPAATYSKDLGILE 228

Query: 224 MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
               ++ F+F+   G  F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT
Sbjct: 229 SRSWESLFTFVQNCGVSFLPAYKIIVERRQPMKYGDRERNFQLYRRGRYVEFNLVYDRGT 288

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG +T G  ESIL S+PPLV W
Sbjct: 289 IFGLQTNGRTESILMSLPPLVRW 311


>gi|253687157|ref|YP_003016347.1| Coproporphyrinogen oxidase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259709755|sp|C6D9M5|HEM6_PECCP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|251753735|gb|ACT11811.1| Coproporphyrinogen oxidase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 310

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC +   ++  A           F    W R +      GGG    L
Sbjct: 5   NAVKHFLLSLQKDICQQLAAIDGGAD----------FAEDEWQRAEG-----GGGCSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 50  SGGRVFERAGVNFSHVTGKSLPPSASTHRPDLAGRSFQAMGVSLVIHPLSPYIPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ +         +WFGGG DLTP      + +  D + +H T  ++C       Y  YK
Sbjct: 110 RLFIAEKPGEEPVWWFGGGFDLTPY-----YGFKEDAVHWHQTAHDLCQPFGDEVYPRYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGG+FFD L+           F+FI AVG+ F+  Y  +V R 
Sbjct: 165 KWCDDYFFLKHRNEARGIGGLFFDDLNEP----DFATSFAFIRAVGNGFLDGYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 KDLPWGEREREFQLYRRGRYVEFNLIWDRGTLFGLQSGGRTESILMSMPPLARW 274


>gi|81299485|ref|YP_399693.1| coproporphyrinogen III oxidase [Synechococcus elongatus PCC 7942]
 gi|81168366|gb|ABB56706.1| coproporphyrinogen oxidase [Synechococcus elongatus PCC 7942]
          Length = 317

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 145/306 (47%), Gaps = 44/306 (14%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ  IC   E L+              F    W R      + GGGR   +  G VF
Sbjct: 1   MQTLQDEICAGLEALDG----------GGQFREDSWER-----PEGGGGRSRVIREGNVF 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+  V  S V+G+  P              ++ATG S+++HP NP++P VH N R     
Sbjct: 46  EQGGVNFSEVWGEKLPPSILAQYPEAAGHGYFATGTSMVLHPRNPYIPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP        +  D   FH++ K  C +H    Y  +K WCD YF+L H
Sbjct: 106 PVWWFGGGADLTPYYP-----FAEDAKHFHSSFKAACDRHYPQFYDVFKLWCDEYFFLKH 160

Query: 204 RQESRGIGGIFFDHLHSSPEMGG-----------------------IDADFSFISAVGDC 240
           R E+RGIGGIFFD+     ++                          +  F+F    G  
Sbjct: 161 RGETRGIGGIFFDYQDGRGDLYNKGPAPSGPAGQKAAEVGIVSDLNWEKLFAFAQDCGRT 220

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+  Y  +V R     + +++RQ QL RRGRY EFNL+YD+GT FG +T G  ESIL S+
Sbjct: 221 FLPAYSPIVERRKDTPWGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSL 280

Query: 301 PPLVAW 306
           PPLV W
Sbjct: 281 PPLVRW 286


>gi|157273512|gb|ABV27411.1| coproporphyrinogen III oxidase aerobic [Candidatus
           Chloracidobacterium thermophilum]
          Length = 317

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 123/290 (42%), Positives = 165/290 (56%), Gaps = 23/290 (7%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +  ++  F++LQ  IC   E+L+  A           F    W      +E  GGGR   
Sbjct: 20  RERAEAFFKDLQDEICMALEQLDGGAQ----------FREDLWE-----REGGGGGRTRV 64

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFEK  V  S+VYG +S     ++    +   F+ATG+S+++HP NP VP VH N
Sbjct: 65  IVEGRVFEKGGVNFSSVYGIMSEKLAARM-MPDEGRNFYATGISLVIHPRNPMVPTVHAN 123

Query: 138 IRMIVTGAY-WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R +  G   WFGGG DLTP    R      DVI FH TLKE C +H    Y  +K+WCD
Sbjct: 124 FRYLEQGNSAWFGGGADLTPYYPYR-----EDVIHFHQTLKEACDKHHPDYYPRFKQWCD 178

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YF+LPHR E+RG+ GIFFD+L +      ++A F+F+   G  F+  Y  +V R  H  
Sbjct: 179 EYFFLPHRNETRGVSGIFFDYLKADEHT-DLEAIFAFVQTAGRAFLPAYLPIVERRQHEP 237

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E +R+ QLIRRGRY EFNL+YD+GT FG +T G  ESIL S+PPL  W
Sbjct: 238 YGEAEREFQLIRRGRYVEFNLIYDRGTVFGLETRGRTESILMSLPPLAKW 287


>gi|310768287|gb|ADP13237.1| coproporphyrinogen III oxidase [Erwinia sp. Ejp617]
          Length = 302

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++   NLQ  IC + E+ +  A           F    W R        GGGR   L
Sbjct: 7   AQVKQFLLNLQDEICHKLEQADGAA----------RFAEDRWQR-----PGGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V+GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  RHGRVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEALGVSLVIHPENPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T   +C       +  YK
Sbjct: 112 RFFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFNLCQPFGPEVWPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RGIGG+FFD L++     G +  F F+ AVG  F   Y  +V R 
Sbjct: 167 KWCDDYFHLKHRNEQRGIGGLFFDDLNAD----GFEQSFRFMQAVGRGFSDAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KGLPWGQRERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|86751117|ref|YP_487613.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris HaA2]
 gi|86574145|gb|ABD08702.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris HaA2]
          Length = 303

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 124/305 (40%), Positives = 171/305 (56%), Gaps = 8/305 (2%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           +L        D +E R+  ++  FE L+  IC E E LE EA        P  F+ K W 
Sbjct: 6   DLDRTPAVSDDPVEARRTQARAWFEGLRDRICAEIETLEREAPAALFPGEPATFSYKPWQ 65

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R       +GG         ++FEK  +  S+  G L+P+    + G      + +T +S
Sbjct: 66  RKTGAGGGVGGFLSGG----RLFEKIGIHTSSANGTLTPEMAKNLPGDGVTRDYVSTSIS 121

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           +I+HP +P VP VH N R + T   WFGGG DLTP L  +R     D + FH  +K  C 
Sbjct: 122 LIMHPRSPRVPTVHMNTRFLSTSQGWFGGGADLTPMLPEQRSQDAEDAVMFHAAMKAACD 181

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H  A Y  +K W D YF+LPHR  +RG+GGIF+DHL+S    G  + DF+F   VG   
Sbjct: 182 AHDPAYYAKFKPWADTYFFLPHRGTARGVGGIFYDHLNS----GDFERDFAFTRDVGAAL 237

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +++YP +VR+     ++EQ+R +QL  RG Y EFNLLYDKGT FG +TGGN E+I++SMP
Sbjct: 238 LEIYPRIVRKRMVEPWTEQERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNTETIMSSMP 297

Query: 302 PLVAW 306
           PLV+W
Sbjct: 298 PLVSW 302


>gi|226939646|ref|YP_002794719.1| coproporphyrinogen III oxidase [Laribacter hongkongensis HLHK9]
 gi|226714572|gb|ACO73710.1| Hem6 [Laribacter hongkongensis HLHK9]
          Length = 304

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 145/291 (49%), Gaps = 30/291 (10%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           +  F +LQ+ I    E L+              F    W R        GGG    L  G
Sbjct: 10  KNYFTSLQARIVDALESLDG----------GGRFHRDGWQR-----PAGGGGLSCVLEEG 54

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            +FE+  V  S V G   P              F A G+S+++HP NP+VP  H N+R+ 
Sbjct: 55  ALFERGGVNFSHVQGGALPASATAARPELAGRAFEAMGVSLVLHPRNPYVPTTHMNVRVF 114

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG+DLTP      +    D + FH   ++  +      Y  YK WC
Sbjct: 115 MATAEGQPPVWWFGGGMDLTPY-----YGEAEDAVHFHRVCRDALAPFGADRYPAYKAWC 169

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           DRYF+L HR E RGIGG+FFD L+      G +  F+   +VGD F++ Y  +V++    
Sbjct: 170 DRYFFLRHRNEPRGIGGVFFDDLND----LGFEQSFALTRSVGDAFLEAYVPIVQKRQQQ 225

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            F  Q R+ Q IRRGRY EFNL++D+GT FG ++GG  ESIL SMPP V W
Sbjct: 226 PFGAQQREWQAIRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPQVQW 276


>gi|148243182|ref|YP_001228339.1| coproporphyrinogen III oxidase [Synechococcus sp. RCC307]
 gi|147851492|emb|CAK28986.1| Coproporphyrinogen III oxidase, aerobic [Synechococcus sp. RCC307]
          Length = 346

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 107/323 (33%), Positives = 148/323 (45%), Gaps = 41/323 (12%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
            + +       + +   +     LQ  ICT  E+L+ +            F  + W+R  
Sbjct: 2   QVPLSAVTPPADSRSRMKALLMGLQDSICTGLEQLDGD----------GRFQEESWVR-- 49

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
               + GGGR   L  G + E+  V  S V G   P              ++A G S+++
Sbjct: 50  ---PEGGGGRSRVLREGSLLEQGGVNFSEVQGKNLPPSILNQRPEAAGHPWYAVGTSMVL 106

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           HP NP++P VH N R       +WFGGG DLTP        +  D   FH TLK  C   
Sbjct: 107 HPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLEDAKHFHQTLKGACDSV 161

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP--------------------E 223
             A Y  +K WCD YF+L HR E+RGIGGIF+D+                          
Sbjct: 162 NPAYYPVFKPWCDEYFFLKHRNETRGIGGIFYDYQSPGGAIYKGPDAQGPAAAVGSEQVP 221

Query: 224 MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGT 283
               ++ F   SA G+ F+  Y  +  R     + +++RQ QL RRGRY EFNL++D+GT
Sbjct: 222 ERDWESLFQLASACGNAFLPSYVPIAERRKGLSYGDRERQFQLYRRGRYVEFNLVFDRGT 281

Query: 284 NFGFKTGGNVESILASMPPLVAW 306
            FG +T G  ESIL S+PPLV W
Sbjct: 282 IFGLQTNGRTESILMSLPPLVRW 304


>gi|186685247|ref|YP_001868443.1| coproporphyrinogen III oxidase [Nostoc punctiforme PCC 73102]
 gi|186467699|gb|ACC83500.1| coproporphyrinogen III oxidase [Nostoc punctiforme PCC 73102]
          Length = 346

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 114/326 (34%), Positives = 154/326 (47%), Gaps = 47/326 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            +  +  PD     +    +  + LQ  I     KL+  A           F    W R 
Sbjct: 14  SSKSLPAPDA----QIRVSQFMKQLQDEITESLAKLDGVA----------KFNEDSWER- 58

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   L  G +FE+A V  S V+G   P              F+ATG S++
Sbjct: 59  ----PEGGGGRSRVLREGAIFEQAGVNFSEVWGSHLPASILTQRPEAAGHGFYATGTSMV 114

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP+NP+VP VH N R       +WFGGGIDLTP        +  D    H TLK+ C +
Sbjct: 115 LHPHNPYVPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FAEDAAHLHKTLKQACDK 169

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS---------------------- 220
           H    Y  +K+WCD YFYL HR E+RG+GG+FFD+                         
Sbjct: 170 HHPEYYPVFKKWCDEYFYLKHRDETRGVGGLFFDYQDGQGALYRGPNPNGEAAIYSNQVG 229

Query: 221 SPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYD 280
           +P     +  F+F+   G  F+  Y  +V R +   + ++ R  QL RRGRY EFNL+YD
Sbjct: 230 TPATRNWEDLFAFVQGCGRAFLPAYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVYD 289

Query: 281 KGTNFGFKTGGNVESILASMPPLVAW 306
           +GT FG +T G  ESIL S+PPLV W
Sbjct: 290 RGTIFGLQTNGRTESILMSLPPLVRW 315


>gi|255262623|ref|ZP_05341965.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
 gi|255104958|gb|EET47632.1| coproporphyrinogen III oxidase, aerobic [Thalassiobium sp. R2A62]
          Length = 297

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 161/305 (52%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKE 68
             D + + K  + + F  L+  I   F + EN +      ++    F V    R      
Sbjct: 1   MTDMLSDNKARAAQWFRELRDQIVARFVEFENTQVAGPFVDQPVGAFEVTATTRTSDDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STVYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGEMSVMRGGRVFEKVGVNISTVYGTLAPRAQAAMAARKGIPGMVDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPHVPAVH N RM  T   +WFGGG DL P LE     YD D   FH T KE   
Sbjct: 121 VAHMQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDDDTAHFHATQKEHLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   KEW D YFY+ HR  +RG+GGIF D   +    G  +ADF+    +G  F
Sbjct: 176 PHGADLYPRLKEWADEYFYILHRHRARGVGGIFMDDHCT----GDWEADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +  +  + ++++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYAPLVEKRRNDPWGDEEKHAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|188533231|ref|YP_001907028.1| coproporphyrinogen III oxidase [Erwinia tasmaniensis Et1/99]
 gi|226740883|sp|B2VI13|HEM6_ERWT9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|188028273|emb|CAO96131.1| Coproporphyrinogen III oxidase [Erwinia tasmaniensis Et1/99]
          Length = 302

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 116/294 (39%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +R   NLQ  IC + E+ +  A           F    W R        GGGR   L
Sbjct: 7   AQVKRFLLNLQDEICQKLEQADGAA----------RFAEDSWQR-----PGGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V+GD  P              F A G+S+++HP NP++P  H N+
Sbjct: 52  RQGRVFEQAGVNFSHVHGDEMPASATAHRPELAGRSFEALGVSLVIHPENPYIPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + +  D + +H T  ++C       Y  YK
Sbjct: 112 RFFIAEKPGADPVWWFGGGFDLTPF-----YGFTEDAVHWHQTAFDLCLPFGAEVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RGIGG+FFD L++     G D  F F+ AVG  F   Y  +V R 
Sbjct: 167 KWCDDYFHLKHRNEQRGIGGLFFDDLNA----HGFDQSFRFMQAVGRGFCDAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 KALTWGERERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 276


>gi|209886116|ref|YP_002289973.1| coproporphyrinogen III oxidase, aerobic [Oligotropha
           carboxidovorans OM5]
 gi|209874312|gb|ACI94108.1| coproporphyrinogen III oxidase, aerobic [Oligotropha
           carboxidovorans OM5]
          Length = 295

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 154/295 (52%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E RK  ++  FE L+  IC  +E+LE+EA  +        F  K W R        GGG
Sbjct: 6   LENRKTTARAWFEKLRDDICVSYERLEDEAPASLYGDQAGRFERKAWERTDH-TGAPGGG 64

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            M ++  G++FEK  V  STV+G+ +P+F+ QI G   +P FWA+G+S+I HP NP+VPA
Sbjct: 65  GMMSMMRGRLFEKVGVHCSTVFGEFAPEFRAQIPGAADDPRFWASGISLIAHPRNPNVPA 124

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA-VANYTHYK 192
           VH N R +VT   WFGGG DLTP LE RR   D D I FH   ++ C  HA VA Y  +K
Sbjct: 125 VHMNTRFVVTTKRWFGGGADLTPVLERRRTQEDSDTIAFHEAFRKTCHAHAAVAPYDKFK 184

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR+E RGIGGIF+D L S    G  DADF+F   VG  F  +YP LVRRN
Sbjct: 185 KWCDDYFFLAHRKEPRGIGGIFYDWLES----GDWDADFAFTQDVGRAFTAIYPELVRRN 240

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           +   +   DR+EQLIRRGRY EFNLLYD+GT FG KTGGNVESIL+SMPP V WP
Sbjct: 241 FEAPWQAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSMPPEVKWP 295


>gi|149190427|ref|ZP_01868698.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
 gi|148835681|gb|EDL52647.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
          Length = 301

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 111/298 (37%), Positives = 155/298 (52%), Gaps = 30/298 (10%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           +  K   +     LQ  IC + E  +  A           F    WLR++      GGGR
Sbjct: 3   QVDKHQVKAFLLQLQDDICQKLEHEDGGA----------TFQQDEWLREQG-----GGGR 47

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              L  G VFE+  V  S V+GD  P              F A G+S+++HP NP++P  
Sbjct: 48  SRVLKDGVVFEQGGVNFSHVFGDKMPASATAHRPELAGRKFEAMGVSLVIHPKNPYIPTS 107

Query: 135 HFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R            +WFGGG DLTP        ++ D   +H   K++C+      Y
Sbjct: 108 HANVRFFIAEKEGEAPIWWFGGGFDLTPFYP-----FEEDCQHWHQVAKDICAPFGEQVY 162

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K+WCD YF+LPHR E+RG+GG+FFD L+      G +  F+++ AVG  +   Y  +
Sbjct: 163 NEHKKWCDEYFFLPHRNETRGVGGLFFDDLNQW----GFERSFAYMKAVGSSYTDAYLPI 218

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           V++  H  F E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 219 VQKRKHTEFGERERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLARW 276


>gi|188993607|ref|YP_001905617.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|226740907|sp|B0RYP5|HEM6_XANCB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|167735367|emb|CAP53581.1| Aerobic coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris]
          Length = 299

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 146/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E ++ +A           F    W R +      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAIDGKA----------RFAEDLWQRAEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NPH+P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGARLPPSASAHRPELAGATWRACGVSLVFHPHNPHIPTTHANV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP         D DV+ +H T + +C+      Y  +K
Sbjct: 110 RYFRAERDGEMVAAWFGGGFDLTPFYP-----VDEDVMHWHRTAQALCAPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 165 RWCDEYFFLRHRDETRGVGGLFFDDLGQ-----DFERDFAYQRAVGDGFLDAYLPIVERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E +R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPYGEAERAFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPQVRW 273


>gi|87124934|ref|ZP_01080781.1| Coproporphyrinogen oxidase [Synechococcus sp. RS9917]
 gi|86167254|gb|EAQ68514.1| Coproporphyrinogen oxidase [Synechococcus sp. RS9917]
          Length = 351

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 109/311 (35%), Positives = 150/311 (48%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +  ++    +LQ  IC   E+L+              F  + W R      + GGGR   
Sbjct: 19  RDRARALVLDLQDEICAGLERLDG----------LGRFQEESWER-----PEGGGGRSRV 63

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V+G   P    +     K   ++ATG S+++HP NP+VP VH N
Sbjct: 64  MRDGRVFEQGGVNFSEVHGQELPPSILRQRPEAKGHAWFATGTSMVLHPRNPYVPTVHLN 123

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH   K+ C Q +   Y  +K WCD
Sbjct: 124 YRYFEAGPVWWFGGGADLTPFYP-----FLDDARHFHRQHKQACDQVSPDLYPVFKPWCD 178

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSS---------------------PEMGGIDADFSFIS 235
            YF+L HR E+RGIGGIF+D+   +                           DA      
Sbjct: 179 EYFFLKHRGETRGIGGIFYDYQDGNGQLYKGQDPEGPAAAMAQTIGSRPLDWDALHDLAR 238

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  +V + +H  + E++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 239 ACGQAFLPAYAPIVEKRHHLPYGERERQFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTES 298

Query: 296 ILASMPPLVAW 306
           IL S+PPL  W
Sbjct: 299 ILMSLPPLARW 309


>gi|163740376|ref|ZP_02147770.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
 gi|161386234|gb|EDQ10609.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
          Length = 297

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
              D+ ++K  +   F++L+  I   FE LE+       ++++   F +    R      
Sbjct: 1   MSTDMIDQKARAAAWFKSLRDDIVAAFEALEDSHDTGPFSDQTAGRFEISETKRTAEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +S VYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISEVYGTLGARAQSAMAARKGIPGMQDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P +E     YD D   FH T ++  +
Sbjct: 121 VAHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHRTQEQHLA 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   KEW D YFY+PHR  +RG+GGIF D  +S    G  +ADF+    +G  F
Sbjct: 176 PHGDTLYGELKEWADEYFYIPHRNRARGVGGIFMDDRNS----GDWEADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +    +F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVEKRRPMVFGAAEKDIQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           P+  W
Sbjct: 292 PMAKW 296


>gi|53803045|ref|YP_115186.1| coproporphyrinogen III oxidase [Methylococcus capsulatus str. Bath]
 gi|62510600|sp|Q603L4|HEM6_METCA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|53756806|gb|AAU91097.1| coproporphyrinogen III oxidase, aerobic [Methylococcus capsulatus
           str. Bath]
          Length = 304

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 152/301 (50%), Gaps = 34/301 (11%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            DIE      +    +LQ  IC   E  E              F    W     +    G
Sbjct: 4   PDIE----AVKSYLLDLQESICNALETEE----------PRARFVEDRW-----EHAAGG 44

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GGR   L  G+ FE+  V  S V G   P              F ATG+S+++HP NP+V
Sbjct: 45  GGRTRVLSGGETFEQGGVNFSHVRGASLPASATAHRPELAGRGFQATGVSLVIHPLNPYV 104

Query: 132 PAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N+R         T  +WFGGG DLTP        ++ DVI +H T +  C     
Sbjct: 105 PTSHANVRFFLAEKEGETPIWWFGGGFDLTPFYP-----FEEDVIHWHRTARNACLPFGE 159

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  +K WCD YF+L HR E+RG+GG+FFD L+      G +  F+F+ +VGD ++K Y
Sbjct: 160 DVYPRFKRWCDEYFFLNHRNETRGVGGLFFDDLNEW----GFERSFAFLRSVGDHYLKAY 215

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V+R     + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP+  
Sbjct: 216 LPIVQRRKAIPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPVAH 275

Query: 306 W 306
           W
Sbjct: 276 W 276


>gi|118602507|ref|YP_903722.1| coproporphyrinogen III oxidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567446|gb|ABL02251.1| coproporphyrinogen oxidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 302

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 117/294 (39%), Positives = 158/294 (53%), Gaps = 29/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++    LQ  IC + E++++ A           F    W +      + G G    L
Sbjct: 3   EEIKKYLLMLQFNICEQLEQVDDNAE----------FIKDVWEKP----NNTGNGLTKVL 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S ++G+  P     +        F A G+S++VHP NP+VP  H N+
Sbjct: 49  SNGAVFEQAGVNFSIIHGNDMPASATVLRPELSGRSFTALGVSLVVHPQNPYVPTSHANV 108

Query: 139 RMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R         T  +WFGGG DLTP      + +D D IF+H + K+ C       Y+ YK
Sbjct: 109 RFFFAEKEGETPIWWFGGGFDLTPY-----YGFDEDAIFWHQSAKQACDPFGKDVYSKYK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+FFD L+     G  D  FSF+ +VGD +I  Y  +V R 
Sbjct: 164 KWCDDYFYLKHRSEQRGIGGLFFDDLNE----GSFDECFSFMKSVGDGYINAYRPIVERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +++ +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 220 KDTPYTDHERQFQLYRRGRYVEFNLIYDRGTLFGLQTGGRSESILMSLPPLVRW 273


>gi|209919917|ref|YP_002294001.1| coproporphyrinogen III oxidase [Escherichia coli SE11]
 gi|226740881|sp|B6I512|HEM6_ECOSE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|209913176|dbj|BAG78250.1| coproporphyrinogen III oxidase [Escherichia coli SE11]
 gi|324020115|gb|EGB89334.1| coproporphyrinogen III oxidase [Escherichia coli MS 117-3]
          Length = 299

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 152/293 (51%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             ++   NLQ  IC +   ++              F    W R+        GGR   L 
Sbjct: 7   QVKQFLLNLQDTICQQLTAVDG-----------AEFVEDSWQREGGG-----GGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+G+  P              F A G+S++VHP+NP+VP  H N+R
Sbjct: 51  NGGVFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ D I +H T +++C       Y  YK+
Sbjct: 111 FFIAEKPGAEPVWWFGGGFDLTPF-----YGFEEDAIHWHRTARDLCLPFGEDVYLRYKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD L++       D  F+F+ AVG  +   Y  +V R  
Sbjct: 166 WCDDYFYLKHRNEQRGIGGLFFDDLNTP----DFDHCFAFMQAVGKGYTDAYLPIVERRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 222 AMAYGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 274


>gi|282898283|ref|ZP_06306274.1| Coproporphyrinogen III oxidase [Raphidiopsis brookii D9]
 gi|281196814|gb|EFA71719.1| Coproporphyrinogen III oxidase [Raphidiopsis brookii D9]
          Length = 348

 Score =  325 bits (833), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 119/322 (36%), Positives = 154/322 (47%), Gaps = 47/322 (14%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD     +  + +  + LQ  I TE E L+  +           FT   W R +   
Sbjct: 18  LPPPDS----QTRASQFMKQLQDKITTELELLDGGS----------KFTEDSWERIEG-- 61

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V+GD  P              F+ATG S+++HP 
Sbjct: 62  ---GGGRSRVLREGAVFEQAGVNFSQVWGDQLPPSILVQRPEATGHGFYATGTSLVLHPR 118

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NP++P VH N R       +WFGGG DLTP        +  D I FH TLK  C +H   
Sbjct: 119 NPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAIHFHQTLKNACDKHHGD 173

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------SSPEM 224
            Y  +K WCD YFYL HR E+RG+GGIF D+                        +    
Sbjct: 174 YYPVFKRWCDEYFYLKHRGETRGVGGIFLDYQDGQGDIYRGPDSQGEAANYNRNLTPLPR 233

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +  FS I   G  FI  Y  +V+R  +  + ++ R  QL RRGRY EFNL+YD+GT 
Sbjct: 234 RTWEQVFSLIQDCGQAFIPAYAPIVQRRRNMEYGDRQRSFQLYRRGRYVEFNLVYDRGTI 293

Query: 285 FGFKTGGNVESILASMPPLVAW 306
           FG +T G  ESIL S+PPLV W
Sbjct: 294 FGLQTNGRTESILMSLPPLVRW 315


>gi|163737213|ref|ZP_02144631.1| Coproporphyrinogen oxidase [Phaeobacter gallaeciensis BS107]
 gi|161389817|gb|EDQ14168.1| coproporphyrinogen 3 oxidase, aerobic [Phaeobacter gallaeciensis
           BS107]
          Length = 297

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKE 68
              D+ ++K  +   F++L+  I   FE LE+       ++++   F +    R      
Sbjct: 1   MSTDMIDQKARAAAWFKSLRDDIVAAFEALEDSHDTGPFSDQTAGRFEISETKRTAEDGS 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +S VYG        +   +  I G   +P FWA+G+S+
Sbjct: 61  DAGGGLMSVMRGGRVFEKVGVNISEVYGTLGARAQSAMAARKGIPGMQDDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P +E     YD D   FH T ++  +
Sbjct: 121 VAHMQNPHAPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDEDTAHFHRTQEQHLA 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H    Y   KEW D YFY+PHR  +RG+GGIF D  +S    G  +ADF+    +G  F
Sbjct: 176 PHGDTLYGQLKEWADEYFYIPHRNRARGVGGIFMDDRNS----GDWEADFALTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  LV +    +F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYLPLVEKRRPMVFGAAEKDIQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           P+  W
Sbjct: 292 PMAKW 296


>gi|190576372|ref|YP_001974217.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia K279a]
 gi|226740906|sp|B2FND0|HEM6_STRMK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|190014294|emb|CAQ47941.1| putative coproporphyrinogen III oxidase, aerobic [Stenotrophomonas
           maltophilia K279a]
          Length = 298

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 152/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E ++  A           F    W R +      GGGR   L
Sbjct: 5   ERVRAYLTDLQDRICAAIEAVDGRA----------RFQEDLWQRAEG-----GGGRTRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + ATG+S++ HP NP+VP  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANV 109

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   +++C+      Y  +K
Sbjct: 110 RFFQAQRDGEVVASWFGGGFDLTPFYP-----FDEDVQHWHQVARDLCAPFGDERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD LH     G  + DF+++ AVGD F+  Y  +V++ 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLH-----GDFERDFAYLRAVGDGFLDAYLPIVQQR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++ E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDAIYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|194367710|ref|YP_002030320.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia
           R551-3]
 gi|226740905|sp|B4SNL7|HEM6_STRM5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|194350514|gb|ACF53637.1| Coproporphyrinogen oxidase [Stenotrophomonas maltophilia R551-3]
          Length = 298

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 150/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R +      GGGR   L
Sbjct: 5   ERVRAYLTDLQDRICAAIEAADGQA----------RFQEDLWQRAEG-----GGGRTRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + ATG+S++ HP NP+VP  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVAGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANV 109

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   +++C+      Y  +K
Sbjct: 110 RFFQAQRDGEVVASWFGGGFDLTPFYP-----FDEDVQHWHRVARDLCAPFGDERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD LH     G  + DF ++ AVGD F+  Y  +V++ 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLH-----GDFERDFDYLRAVGDGFLDAYLPIVQQR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|67459788|ref|YP_247412.1| coproporphyrinogen III oxidase [Rickettsia felis URRWXCal2]
 gi|75535824|sp|Q4UJP2|HEM6_RICFE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|67005321|gb|AAY62247.1| Coproporphyrinogen III oxidase precursor [Rickettsia felis
           URRWXCal2]
          Length = 279

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 121/290 (41%), Positives = 171/290 (58%), Gaps = 16/290 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F +L+ ++C EFEK+E E  + +    P  F    W R+      +     
Sbjct: 4   ENKEIASNWFTDLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRTSWQRNGGGGGIMS---- 58

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +PA+H
Sbjct: 59  --LMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP         + +   FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYP-----KENETAKFHAAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTQDVGRALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 228 PWTTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|78049754|ref|YP_365929.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325924861|ref|ZP_08186295.1| coproporphyrinogen oxidase [Xanthomonas perforans 91-118]
 gi|123583851|sp|Q3BMT4|HEM6_XANC5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|78038184|emb|CAJ25929.1| Aerobic coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325544706|gb|EGD16055.1| coproporphyrinogen oxidase [Xanthomonas perforans 91-118]
          Length = 299

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R++      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAADGKA----------RFAEDLWKREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NP++P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPYIPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   + +C       Y  +K
Sbjct: 110 RYFRAERDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCEPFGQERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V+R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLGQ-----DFERDFAYQRAVGDGFLDAYIPIVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|297183544|gb|ADI19673.1| coproporphyrinogen III oxidase [uncultured Alteromonadales
           bacterium HF4000_16C08]
          Length = 310

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 155/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +            F    W+R++      GGGR   +
Sbjct: 17  EQVKHYLLSLQDNICQTLELADGK----------GQFVEDSWIREEG-----GGGRSRVI 61

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP+NP+VP  H N+
Sbjct: 62  KNGAVIEQGGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYVPTSHANV 121

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP        +  DV+ +H+T K++C+      Y  YK
Sbjct: 122 RFFIAEKEGEAPIWWFGGGFDLTPFYP-----FKEDVVHWHDTAKKLCAPFGEEVYQTYK 176

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD+YFYL HR E+RG+GG+FFD L+      G +  F+++ AVG+ ++  Y  +V + 
Sbjct: 177 DWCDKYFYLKHRDETRGVGGLFFDDLNEW----GFEKSFAYMQAVGNGYLDAYIPIVEKR 232

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + +S ++R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 233 KENQYSARERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARW 286


>gi|21244826|ref|NP_644408.1| coproporphyrinogen III oxidase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|24211747|sp|Q8PF76|HEM6_XANAC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|21110528|gb|AAM38944.1| aerobic coproporphyrinogen III oxidase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 299

 Score =  325 bits (832), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R++      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAADGKA----------RFAEDLWKREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NP++P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPYIPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   + +C       Y  +K
Sbjct: 110 RYFRAERDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCVPFGQERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V+R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLGQ-----DFERDFAYQRAVGDGFLDAYIPIVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|255067648|ref|ZP_05319503.1| coproporphyrinogen III oxidase, aerobic [Neisseria sicca ATCC
           29256]
 gi|255048122|gb|EET43586.1| coproporphyrinogen III oxidase, aerobic [Neisseria sicca ATCC
           29256]
          Length = 301

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 109/287 (37%), Positives = 151/287 (52%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            +NLQ+ IC   E+ +  A           F  K W         LG G    L  G VF
Sbjct: 10  LKNLQNQICAALEQEDGGAV----------FARKEWT------GKLGVGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGSKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   +++C+    A Y  +K+WCD Y
Sbjct: 114 PEGGEPVWWFGGGFDLTPFYP-----FEEDILHWHTVARDVCAPFGEAVYPEFKKWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I  Y  +V +  +  + 
Sbjct: 169 FYLKHRGETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIGAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|241760070|ref|ZP_04758168.1| coproporphyrinogen III oxidase, aerobic [Neisseria flavescens
           SK114]
 gi|241319524|gb|EER55954.1| coproporphyrinogen III oxidase, aerobic [Neisseria flavescens
           SK114]
          Length = 302

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 150/287 (52%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ+ IC   E+ + EA           F  + W         LG G    L  G VF
Sbjct: 10  LKTLQNQICAALEQEDGEA----------KFVHEAWT------GKLGIGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGTKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   + +C+    + Y  +K+WCD Y
Sbjct: 114 PENAEPVWWFGGGFDLTPFYP-----FEEDIVHWHTVARNVCAPFGESVYPEFKQWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I  Y  +V +  +  + 
Sbjct: 169 FYLKHRNETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIAAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|296283258|ref|ZP_06861256.1| coproporphyrinogen III oxidase [Citromicrobium bathyomarinum JL354]
          Length = 284

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 128/295 (43%), Positives = 171/295 (57%), Gaps = 13/295 (4%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            D   + + ++  FE+L+  IC EFE +E EA  +        F    W R++   +  G
Sbjct: 2   PDWSAQTQQARTWFESLRDQICAEFEAIEREAGSD------ATFQYTPWEREEEGNDSPG 55

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GG    L  GKVFEK  V VSTV+G  +P+F   I G   +P F ATG+S++ H  NPHV
Sbjct: 56  GGVQG-LMKGKVFEKVGVNVSTVHGTFAPEFAKTINGAEDDPSFSATGISLVAHMANPHV 114

Query: 132 PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
           PAVH N R +VTG  WFGGG DL P +      Y+ D   FH   +  C++H    Y  +
Sbjct: 115 PAVHMNTRFLVTGKAWFGGGADLNPPIP-----YEEDAQEFHAAFRAACAKHNPTYYERF 169

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
            +W D YFY+PHR   RG+GGIF+DHL       G   +  F   VG  F++++P LVRR
Sbjct: 170 SKWADDYFYIPHRGVHRGVGGIFYDHLECDD-ESGFARNLDFTQDVGRAFLEIFPKLVRR 228

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                ++E D++ QL  RGRYAEFNL+YD+GT FG KTGGNV++IL S+PP   W
Sbjct: 229 RMESEWTEADKRTQLEWRGRYAEFNLVYDRGTLFGLKTGGNVDAILMSLPPEAVW 283


>gi|67922276|ref|ZP_00515789.1| Coproporphyrinogen oxidase [Crocosphaera watsonii WH 8501]
 gi|67855852|gb|EAM51098.1| Coproporphyrinogen oxidase [Crocosphaera watsonii WH 8501]
          Length = 343

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 114/325 (35%), Positives = 154/325 (47%), Gaps = 43/325 (13%)

Query: 5   TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDK 64
           T          + K       + LQ  IC   E  +  +           F    W R++
Sbjct: 9   TTPQQTSLPPTDAKTRVSDFMKTLQDEICQGLETADGGS----------TFRQDSWDREE 58

Query: 65  SQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIV 124
                 GGGR   +  G   E+  V  S V+G   P    +     +   F+ATG S+++
Sbjct: 59  G-----GGGRSRVIRDGNFLEQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTSMVL 113

Query: 125 HPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           HP NP+VP VH N R       +WFGGGIDLTP        +  DV  FH TLKE C +H
Sbjct: 114 HPRNPYVPTVHLNYRYFEAGPVWWFGGGIDLTPYYP-----FAEDVKQFHQTLKETCDKH 168

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------SS 221
               Y+ +K WCD YFYL HRQE+RG+GG+FFD+                          
Sbjct: 169 HPEYYSVFKPWCDEYFYLKHRQETRGVGGLFFDYQDGTDPLYRGPHADKAAAKYSNQLPP 228

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
            E    +  F+F++  G  F+  Y  +V +  +  + ++ RQ QL RRGRY EFNL+YD+
Sbjct: 229 QENRTWEDLFAFVNDCGRAFLTAYLPIVEKRRNTEYEDKQRQFQLYRRGRYVEFNLVYDR 288

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 289 GTIFGLQTNGRTESILMSLPPLVRW 313


>gi|225076482|ref|ZP_03719681.1| hypothetical protein NEIFLAOT_01528 [Neisseria flavescens
           NRL30031/H210]
 gi|224952161|gb|EEG33370.1| hypothetical protein NEIFLAOT_01528 [Neisseria flavescens
           NRL30031/H210]
          Length = 302

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 108/287 (37%), Positives = 152/287 (52%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ+ ICT  E+ + EA           F  + W         LG G    L  G VF
Sbjct: 10  LKTLQNQICTALEQEDGEA----------KFVHEAWT------GKLGIGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGTQMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   +++C+    + Y  +K+WCD Y
Sbjct: 114 PENAEPVWWFGGGFDLTPFYP-----FEEDIVHWHTVARDVCAPFGESVYPEFKQWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I  Y  +V +  +  + 
Sbjct: 169 FYLKHRNETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIAAYLPIVTKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|298368720|ref|ZP_06980038.1| coproporphyrinogen III oxidase, aerobic [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282723|gb|EFI24210.1| coproporphyrinogen III oxidase, aerobic [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 301

 Score =  324 bits (831), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 151/287 (52%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            +NLQ+ IC   E+ +  A           F  + W         LG G    L  G VF
Sbjct: 10  LKNLQNQICAALEQEDGGAV----------FAREEWT------GKLGVGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGSKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   +++C+      Y  +K+WCD Y
Sbjct: 114 PEGGEPVWWFGGGFDLTPFYP-----FEEDILHWHTVARDVCAPFGEGVYPEFKKWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I+ Y  +V +  +  + 
Sbjct: 169 FYLKHRGETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIEAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|296536751|ref|ZP_06898807.1| coproporphyrinogen III oxidase [Roseomonas cervicalis ATCC 49957]
 gi|296262918|gb|EFH09487.1| coproporphyrinogen III oxidase [Roseomonas cervicalis ATCC 49957]
          Length = 303

 Score =  324 bits (831), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 170/310 (54%), Gaps = 12/310 (3%)

Query: 3   LCTIEIGCPDDIEERKRIS---QRKFENLQSIICTEFEKLENEAHENSANRSP-KIFTVK 58
           +         D   + R++   +  FE+L+  +C EFE +E+          P   F   
Sbjct: 1   MPETAAPASTDAAPQHRLAGPARAWFESLRDRLCAEFEAIEDALQGGPHGALPAGRFART 60

Query: 59  HWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWAT 118
            W R       +   R         FEK  V VSTV+G+ SP+F+ QI G  ++P F AT
Sbjct: 61  AWERPGGGGGVMSVMRGRV------FEKVGVNVSTVWGEFSPEFRKQIPGAEEDPRFLAT 114

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKE 178
           G+S++ H  +P VPA H N R IVT   WFGGG DLTP       S   D   FH   + 
Sbjct: 115 GVSLVAHMRSPRVPAAHMNTRFIVTRRAWFGGGGDLTPMTMDSPESLA-DGAAFHAAFQA 173

Query: 179 MCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGG-IDADFSFISAV 237
            C +H  A Y  +K WCD YF+LPHR E RG+GGIF+D L      G  +D  F+F   V
Sbjct: 174 ACERHDPAYYPRFKAWCDEYFFLPHRNEPRGLGGIFYDWLGRDEPEGERLDGHFAFTRDV 233

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G+ F+  YP+++RR     ++E +R+ QL+RRGRY EFNLL+D+GT FG KTGGN E+IL
Sbjct: 234 GEAFLAAYPAIIRRRMGESWTEAEREHQLVRRGRYVEFNLLHDRGTLFGLKTGGNTEAIL 293

Query: 298 ASMPPLVAWP 307
            SMPP V WP
Sbjct: 294 MSMPPEVRWP 303


>gi|282901464|ref|ZP_06309389.1| Coproporphyrinogen III oxidase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193743|gb|EFA68715.1| Coproporphyrinogen III oxidase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 349

 Score =  324 bits (831), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 155/322 (48%), Gaps = 47/322 (14%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD     +  + +  + LQ  I TE E L+  +           FT   W R +   
Sbjct: 18  LPPPDS----QTRASQFMKQLQDKITTELELLDGGS----------KFTEDSWERIEG-- 61

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
              GGGR   L  G VFE+A V  S V+GD  P              F+ATG S+++HP 
Sbjct: 62  ---GGGRSRVLREGAVFEQAGVNFSQVWGDQLPPSILVQRPEAAGHGFYATGTSLVLHPR 118

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NP++P VH N R       +WFGGG DLTP        +  D I FH TLK  C +H V 
Sbjct: 119 NPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDPIHFHQTLKNACDKHHVD 173

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLH----------------------SSPEM 224
            Y  +K WCD YFYL HR E+RG+GGIF D+                        +    
Sbjct: 174 YYPVFKRWCDEYFYLKHRGETRGVGGIFLDYQDGQGDIYRGPDSQGEAANYSRNLTPLPR 233

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +  FS I   G  FI  Y  +V+R  +  + ++ R  QL RRGRY EFNL+YD+GT 
Sbjct: 234 RTWEQVFSLIQDCGQAFIPAYAPIVQRRRNTEYGDRQRSFQLYRRGRYVEFNLVYDRGTI 293

Query: 285 FGFKTGGNVESILASMPPLVAW 306
           FG +T G  ESIL S+PPLV W
Sbjct: 294 FGLQTNGRTESILMSLPPLVRW 315


>gi|300112980|ref|YP_003759555.1| Coproporphyrinogen oxidase [Nitrosococcus watsonii C-113]
 gi|299538917|gb|ADJ27234.1| Coproporphyrinogen oxidase [Nitrosococcus watsonii C-113]
          Length = 310

 Score =  324 bits (831), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 114/292 (39%), Positives = 153/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC+  E+ + EA           F  + W R        GGGR   L  
Sbjct: 13  VKNYLLDLQDHICSTLEQEDGEAP----------FMEETWQRA-----AGGGGRSRVLSE 57

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+  V  S V+G+  P              F A G+S+++HP NP+VP  H NIR 
Sbjct: 58  GAVFEQGGVNFSHVFGEGLPASATAQRPELAGRRFEALGVSLVIHPRNPYVPTSHANIRF 117

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ D I +H   +E C       Y+ YK+W
Sbjct: 118 FMASKEDAAPIWWFGGGFDLTPYYP-----FEEDAIHWHRMAREACLPFGETVYSRYKKW 172

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR E+RGIGG+FFD L+      G    F F+ +VG+ ++  Y  +VR+   
Sbjct: 173 CDEYFYLKHRDETRGIGGLFFDDLNEW----GFPRCFDFMQSVGNHYLLAYVPIVRQRKS 228

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 229 LTYGERERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLPPLVKW 280


>gi|330824920|ref|YP_004388223.1| Coproporphyrinogen-III oxidase [Alicycliphilus denitrificans K601]
 gi|329310292|gb|AEB84707.1| Coproporphyrinogen-III oxidase, aerobic [Alicycliphilus
           denitrificans K601]
          Length = 308

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 148/289 (51%), Gaps = 19/289 (6%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   E LQ+ I    E++E E            F    W R+       G G    L
Sbjct: 12  ARVRGYLEGLQARITGALEEVEGEGG--------ARFRSDAWRREAGS-PLQGDGITRIL 62

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+
Sbjct: 63  EGGRVFERAGCGFSHVSGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNV 122

Query: 139 RMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
           RMI    A WFGGG+DLTP      + ++ D + FH   ++  +      Y  +K WCD 
Sbjct: 123 RMIAAGDACWFGGGMDLTPY-----YGFEEDAVHFHRACRDALAPFGEGQYPRFKTWCDE 177

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF+L HR E RG+GGIFFD         G +   +   +VGD F+  Y  +V+R     +
Sbjct: 178 YFFLKHRGEQRGVGGIFFDDFSE----LGFEQSLAMTQSVGDAFLGAYLPIVQRRMDMPW 233

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL AW
Sbjct: 234 GERERDFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLAAW 282


>gi|254512236|ref|ZP_05124303.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           KLH11]
 gi|221535947|gb|EEE38935.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           KLH11]
          Length = 294

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 159/302 (52%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKEDLG 71
             E  K  +   F  L+  I   FE LE+       ++  P  F VK   R      D G
Sbjct: 1   MFETEKATASAWFRQLRDDIVNAFEALEDSHDTGPFSDAQPGRFEVKDTKRRSDDGSDAG 60

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V VSTVYG        +   +  I G   +P FWA+G+S++ H
Sbjct: 61  GGLMSVMRGGRVFEKVGVNVSTVYGTLGERAQNAMAARKGIAGMKDDPRFWASGISLVAH 120

Query: 126 PYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH T K     H 
Sbjct: 121 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YDDDTAHFHATQKAHLDPHG 175

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A+Y   K+W D YFY+PHR+ +RG+GGIF D   +    G    DF+    +G  F+  
Sbjct: 176 PAHYPRLKDWADEYFYIPHRKRARGVGGIFMDDYCT----GDWQVDFALTQDIGRAFLPA 231

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           +  LV +     F E  +  QLI RG YAE+NL+YD+GT FG +TG + +++L S+PPL 
Sbjct: 232 FVPLVEKRRVQGFDETAKNTQLIHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPPLA 291

Query: 305 AW 306
            W
Sbjct: 292 KW 293


>gi|194477076|ref|YP_002049255.1| coproporphyrinogen III oxidase [Paulinella chromatophora]
 gi|171192083|gb|ACB43045.1| coproporphyrinogen III oxidase [Paulinella chromatophora]
          Length = 342

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 114/319 (35%), Positives = 153/319 (47%), Gaps = 43/319 (13%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
            P  I  R+   +    NLQ  IC   E  + +A           F  + W R      +
Sbjct: 3   PPPSINSRQ-RVKALLMNLQDTICKGLETADGKA----------FFQEETWER-----SE 46

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGGR   +  G +FE+  V  S V GD  P          K   ++ATG S+++HP NP
Sbjct: 47  GGGGRSRVIQNGGIFEQGGVNFSEVEGDQLPPSILNQRPEAKGQRWYATGTSMVLHPRNP 106

Query: 130 HVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           ++P VH N R       +WFGGG DLTP        +  D   FH+TLK  C       Y
Sbjct: 107 YIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLEDAQHFHSTLKNACDNRNPNYY 161

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP---------------------EMGGI 227
             +K WCD YFYLPHR E+RG+GGIF+D+   S                      +    
Sbjct: 162 KVFKPWCDEYFYLPHRGETRGVGGIFYDYQDPSGLLYKGQNPNGLASVASQQLGVQTHNW 221

Query: 228 DADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGF 287
           +  F    A G+ F+  Y  ++ +  H  + +++RQ QL RRGRY EFNL++D+GT FG 
Sbjct: 222 EDLFQLTQACGNAFLPSYVPIISKRNHFSYGDRERQFQLYRRGRYVEFNLVFDRGTIFGL 281

Query: 288 KTGGNVESILASMPPLVAW 306
           +T G  ESIL SMPPLV W
Sbjct: 282 QTNGRTESILMSMPPLVRW 300


>gi|319762841|ref|YP_004126778.1| coproporphyrinogen oxidase [Alicycliphilus denitrificans BC]
 gi|317117402|gb|ADU99890.1| Coproporphyrinogen oxidase [Alicycliphilus denitrificans BC]
          Length = 308

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 148/289 (51%), Gaps = 19/289 (6%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   E LQ+ I    E++E E            F    W R+       G G    L
Sbjct: 12  ARVRGYLEGLQARITGALEEVEGEGG--------ARFRSDAWRREAGS-PLQGDGITRIL 62

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+
Sbjct: 63  EGGRVFERAGCGFSHVSGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNV 122

Query: 139 RMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
           RMI    A WFGGG+DLTP      + ++ D + FH   ++  +      Y  +K WCD 
Sbjct: 123 RMIAAGDACWFGGGMDLTPY-----YGFEEDAVHFHRACRDALAPFGEGLYPRFKTWCDE 177

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF+L HR E RG+GGIFFD         G +   +   +VGD F+  Y  +V+R     +
Sbjct: 178 YFFLKHRGEQRGVGGIFFDDFSE----LGFEQSLAMTQSVGDAFLGAYLPIVQRRMDMPW 233

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++R  QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL AW
Sbjct: 234 GERERDFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLAAW 282


>gi|261820311|ref|YP_003258417.1| coproporphyrinogen III oxidase [Pectobacterium wasabiae WPP163]
 gi|261604324|gb|ACX86810.1| Coproporphyrinogen oxidase [Pectobacterium wasabiae WPP163]
          Length = 310

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 149/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC +   ++  A           F    W R +      GGG    L
Sbjct: 5   NAVKHFLLSLQKDICQQLAAIDGGAD----------FAEDEWQRAEG-----GGGCSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FE+A V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 50  SGGRIFERAGVNFSHVAGKSLPPSASTHRPELAGRSFQAMGVSLVIHPLSPYIPTSHANV 109

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+           +WFGGG DLTP      + +  D + +H T  ++C       Y  YK
Sbjct: 110 RLFVAEKPGEAPVWWFGGGFDLTPY-----YGFKEDAVHWHQTAHDLCQPFGDDVYPRYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGG+FFD L+           F+FI AVG+ F+  Y  +V R 
Sbjct: 165 KWCDDYFFLKHRNEARGIGGLFFDDLNEP----DFATSFAFIRAVGNGFLDGYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 KDLAWGEREREFQLYRRGRYVEFNLIWDRGTLFGLQSGGRTESILMSMPPLARW 274


>gi|85711000|ref|ZP_01042061.1| Coproporphyrinogen III oxidase [Idiomarina baltica OS145]
 gi|85695404|gb|EAQ33341.1| Coproporphyrinogen III oxidase [Idiomarina baltica OS145]
          Length = 310

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 119/290 (41%), Positives = 148/290 (51%), Gaps = 30/290 (10%)

Query: 23  RKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGK 82
               +LQ  IC + E ++              F    W R++      GGGR   +  G+
Sbjct: 12  NYLLSLQDSICQQLETVDG----------GGRFQQDEWQREQG-----GGGRSRVMKEGE 56

Query: 83  VFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV 142
            FE+A V  S VYG+  P          +   F A G+S+++HP NPHVP VH N+R  +
Sbjct: 57  TFEQAGVGFSHVYGEQLPKSATAHRPELEGRDFNACGVSLVIHPRNPHVPTVHLNVRFFI 116

Query: 143 T------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
                    +WFGGG DLTP           D I +H   K    +   A Y  YK WCD
Sbjct: 117 AEKEGEDPVWWFGGGFDLTPYYPYTN-----DCIEWHKKAKASLDKVDPALYDKYKVWCD 171

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFYL HR E+RGIGGIFFD L+        D  F  I AVGD F + Y  +V R     
Sbjct: 172 DYFYLKHRNEARGIGGIFFDDLND----RSFDEAFDVIKAVGDAFCEAYVPIVERRKKTE 227

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +SE  RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 228 YSEHQRQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 277


>gi|261364748|ref|ZP_05977631.1| coproporphyrinogen III oxidase, aerobic [Neisseria mucosa ATCC
           25996]
 gi|288567051|gb|EFC88611.1| coproporphyrinogen III oxidase, aerobic [Neisseria mucosa ATCC
           25996]
          Length = 301

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 154/287 (53%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            +NLQ+ IC   E+ +  A           FT + W         LG G    L  G VF
Sbjct: 10  LKNLQNQICAALEQEDGGAV----------FTREEWT------GKLGVGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V GD  P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGDKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   +++C+    A Y  +K+WCD Y
Sbjct: 114 PEGGDPVWWFGGGFDLTPFYP-----FEEDILHWHTVARDVCAPFGEAVYPEFKKWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I+ Y  +V +  +  + 
Sbjct: 169 FYLKHRSETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIEAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|307129661|ref|YP_003881677.1| coproporphyrinogen III oxidase [Dickeya dadantii 3937]
 gi|306527190|gb|ADM97120.1| coproporphyrinogen III oxidase [Dickeya dadantii 3937]
          Length = 312

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  +C + E  +  A           F    W          GGGR   L
Sbjct: 7   NAIKHFLLTLQDDLCRQLELTDGSA----------TFIEDAWQ-----HASGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A V  S V G   P              F A G+S+++HP NP+VP  H NI
Sbjct: 52  RQGRVFEQAGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVMHPLNPYVPTSHANI 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK
Sbjct: 112 RFFIAEKPGEPAVWWFGGGFDLTPY-----YGFEEDAVHWHQTAFDLCKPFGDDVYPRYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R 
Sbjct: 167 QWCDDYFFLKHRNEARGVGGLFFDDLNAP----DFDTSFAFMRAVGEGFRHAYLPIVNRR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 223 KDIPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPLVRW 276


>gi|300866327|ref|ZP_07111030.1| coproporphyrinogen III oxidase [Oscillatoria sp. PCC 6506]
 gi|300335670|emb|CBN56190.1| coproporphyrinogen III oxidase [Oscillatoria sp. PCC 6506]
          Length = 316

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 147/305 (48%), Gaps = 43/305 (14%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + +Q  IC   E L+              F  + W R      + GGGR   +  G VF
Sbjct: 1   MQGIQDEICQGLEALDG----------IGKFKEESWER-----PEGGGGRSRVMTQGDVF 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+  V  S V+G+  P              F+ATG S+++HP NP++P VH N R     
Sbjct: 46  EQGGVNFSEVWGETLPPSILHQYPELAGKGFYATGTSMVLHPRNPYIPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP        +  D   FH TLK  C +H    Y  +K WCD YFYL H
Sbjct: 106 HVWWFGGGADLTPYYP-----FAEDAAHFHQTLKAACDRHHPEYYPTFKLWCDEYFYLKH 160

Query: 204 RQESRGIGGIFFDHLHSS----------------------PEMGGIDADFSFISAVGDCF 241
           RQE+RG+GG+FFD+                          PE    +  F+F+   G  F
Sbjct: 161 RQETRGVGGLFFDYQDGQTQLYRGPDPKGPAANYSNQIGIPEPRSWEDLFAFVQECGRAF 220

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T G  ESIL S+P
Sbjct: 221 LPAYSPIVERRRSMEYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLP 280

Query: 302 PLVAW 306
           PLV W
Sbjct: 281 PLVRW 285


>gi|259417249|ref|ZP_05741168.1| coproporphyrinogen III oxidase, aerobic [Silicibacter sp.
           TrichCH4B]
 gi|259346155|gb|EEW57969.1| coproporphyrinogen III oxidase, aerobic [Silicibacter sp.
           TrichCH4B]
          Length = 300

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 115/303 (37%), Positives = 157/303 (51%), Gaps = 17/303 (5%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKEDL 70
            ++   K  +   F  L+  I   FE LE+       A      F V    R      D 
Sbjct: 6   TEMRAEKARAAAWFRELRDQIVAAFEGLEDSHTDGPFAEMEAGRFDVSETKRTAEDGSDA 65

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIV 124
           GGG M+ +  G+VFEK  V +S VYG        +   +  + G  ++P FWA+G+S++ 
Sbjct: 66  GGGLMSVMRGGRVFEKVGVNISEVYGTLGERAQNAMAARKGLPGMKEDPRFWASGISLVA 125

Query: 125 HPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NPHVPAVH N RM  T   +WFGGG DL P LE     YD D + FH   +     H
Sbjct: 126 HMRNPHVPAVHMNTRMFWTPHGWWFGGGSDLNPCLE-----YDEDTVHFHGVQQAHLDPH 180

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y   K W D YF++PHR  +RG+GGIF D  ++    G   ADF+ +  +G  F+ 
Sbjct: 181 GGDLYPRLKAWADEYFFIPHRGRARGVGGIFLDDHNT----GDWAADFALVQDIGRAFLP 236

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            +  LV +   H  SE D+  QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PPL
Sbjct: 237 AFVPLVEKRRVHSCSEADKDAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPL 296

Query: 304 VAW 306
             W
Sbjct: 297 AKW 299


>gi|115523338|ref|YP_780249.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisA53]
 gi|115517285|gb|ABJ05269.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisA53]
          Length = 300

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 126/306 (41%), Positives = 174/306 (56%), Gaps = 12/306 (3%)

Query: 5   TIEIGCPDDI----EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           TI+   P  +    E+++  ++  FE L+  IC E E+LE EA  N    +P  FT K W
Sbjct: 2   TIDTDAPPQLGTQVEQQRAQARAWFEGLRDRICAEIEQLEREAPANLYPGAPATFTYKPW 61

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R   Q   +GG         ++FEK  +  S+  G LSP+    + G  K   + +T +
Sbjct: 62  QRQTGQGGGVGGFLSGG----RLFEKIGIHTSSANGRLSPEMAKTLPGDGKQLDYVSTSI 117

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S+I+HP +P VP  H N R + T   WFGGG DLTP L   R     D + FH  +K  C
Sbjct: 118 SLIMHPRSPRVPTTHMNTRFLCTSQGWFGGGSDLTPMLPEHRSQDAEDAVIFHAAMKRAC 177

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H    Y  +K W D YFYLPHRQ +RG+GGIF+DHL++    G  + DF+F   VG  
Sbjct: 178 DAHDPGYYAKFKPWADDYFYLPHRQAARGVGGIFYDHLNT----GSFERDFAFTRDVGLA 233

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
            + +YP +VR+     ++E +R +QL  R  Y EFNLLYD+GT FG +TGGNVE+I++SM
Sbjct: 234 LLDVYPRIVRKRMVEPWTEAERAQQLACRALYVEFNLLYDRGTMFGLQTGGNVETIMSSM 293

Query: 301 PPLVAW 306
           PPLV+W
Sbjct: 294 PPLVSW 299


>gi|89056339|ref|YP_511790.1| coproporphyrinogen III oxidase [Jannaschia sp. CCS1]
 gi|88865888|gb|ABD56765.1| Coproporphyrinogen oxidase [Jannaschia sp. CCS1]
          Length = 292

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 121/303 (39%), Positives = 170/303 (56%), Gaps = 18/303 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             D   + K  +   F +L+  I   FE++E        +    +F V +  R      D
Sbjct: 1   MSDLTPDHKTRAAAWFRSLRDDIVAAFEQVEETHGG---DAPAGVFEVTNTKRTSDDGSD 57

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQI-----LGTTKNPYFWATGLSVIV 124
            GGG M+ +  G+VFEK  V VS VYG+L    +  +      G   +P FWA+G+S++ 
Sbjct: 58  AGGGLMSVMRGGRVFEKVGVNVSEVYGELGERAQKAMAARGVPGMESDPRFWASGISLVA 117

Query: 125 HPYNPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
           H  NP VPAVH N RM  T  A+WFGGG DL P++E     YD D  FFH TLK+ C  H
Sbjct: 118 HMQNPRVPAVHMNTRMFWTPGAWWFGGGSDLNPAIE-----YDEDTAFFHQTLKDHCDPH 172

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
               Y  YK W D YFY+PHR  +RG+GGIF+D  ++    G  +ADF+F   VG  F+ 
Sbjct: 173 GADLYDRYKAWADEYFYVPHRNRARGVGGIFYDDHNT----GDWNADFAFTQDVGRAFLP 228

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPL 303
            +   V +  H  F++ DR++QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+
Sbjct: 229 AFLGCVEKRRHEAFTDDDREKQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPI 288

Query: 304 VAW 306
             W
Sbjct: 289 AKW 291


>gi|30249828|ref|NP_841898.1| coproporphyrinogen III oxidase [Nitrosomonas europaea ATCC 19718]
 gi|41017163|sp|Q82TL0|HEM6_NITEU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|30180865|emb|CAD85787.1| Coproporphyrinogen III oxidase [Nitrosomonas europaea ATCC 19718]
          Length = 301

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ+ I T  E+++ ++           F    W R      + GGG    +
Sbjct: 4   AQVKDYLVDLQNRIVTGLEQVDGQS-----------FRRDTWDR-----PEGGGGTSCVI 47

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NP+ P VH N+
Sbjct: 48  EEGNVLERGGVNFSHVFGKGLPASATAARPELAGRAFEAAGVSLVLHPRNPYAPTVHMNV 107

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG+DLTP      + ++ D + FH   K+         Y  +K
Sbjct: 108 RFFAATKEGAEPVWWFGGGMDLTPY-----YGFEEDAVHFHQACKDALQPSGEEYYPRFK 162

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR+E RGIGG+FFD L+           F+   +VGD F+  Y  ++++ 
Sbjct: 163 KWCDEYFYLKHRKEPRGIGGVFFDDLNQP----DFATCFNLTRSVGDHFLAAYVPILQKR 218

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 219 RDLPYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPVVKW 272


>gi|319638141|ref|ZP_07992904.1| coproporphyrinogen 3 oxidase [Neisseria mucosa C102]
 gi|317400414|gb|EFV81072.1| coproporphyrinogen 3 oxidase [Neisseria mucosa C102]
          Length = 302

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 151/287 (52%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ+ IC   E+ + EA           F  + W         LG G    L  G VF
Sbjct: 10  LKTLQNQICAALEQEDGEAE----------FVHEAWT------GKLGIGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGSKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H   +++C+    + Y  +K+WCD Y
Sbjct: 114 PENAEPVWWFGGGFDLTPFYP-----FEEDIVHWHTVARDVCAPFGESVYPEFKQWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I  Y  +V +  +  + 
Sbjct: 169 FYLKHRNETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIAAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|114798887|ref|YP_759079.1| coproporphyrinogen III oxidase [Hyphomonas neptunium ATCC 15444]
 gi|114739061|gb|ABI77186.1| coproporphyrinogen III oxidase, aerobic [Hyphomonas neptunium ATCC
           15444]
          Length = 297

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 138/292 (47%), Positives = 170/292 (58%), Gaps = 7/292 (2%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           RK  +   F  LQ  I   FE +E+ A           F +K W R    ++  GG    
Sbjct: 12  RKAQASAWFRALQEEIIGRFEAIEDAAVPPLYRGEAGRFDLKAWRRGDGSEDLGGGRMGL 71

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNPHVPAVH 135
               GKVFEK  V  S V+G  S  F  QI G  K    FWA+G+S+I HP NP VPA H
Sbjct: 72  --MRGKVFEKVGVHFSEVHGTFSEAFAAQIPGADKSGGRFWASGISLIAHPLNPRVPAAH 129

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
            N RM+VT   WFGGG DLTP L  +R     D + FH  +K  C  H  A+Y H KE C
Sbjct: 130 MNTRMLVTSEAWFGGGGDLTPLLAYQRDQDFVDTVDFHAAMKAACDTHPGADYAHMKEHC 189

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           + YF+LPHR E RG GGIF+D  ++    G  +ADF+F   VG  F  +YP LVRR    
Sbjct: 190 ETYFHLPHRSEPRGTGGIFYDRFNT----GDWEADFAFTQEVGRKFADIYPGLVRRRMIE 245

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
            +SE +R+ QLI+RGRY E+NLLYD+GT FG KTGGN+ESIL+SMPP+V WP
Sbjct: 246 PWSEAEREAQLIQRGRYVEYNLLYDRGTTFGLKTGGNIESILSSMPPVVKWP 297


>gi|298491452|ref|YP_003721629.1| Coproporphyrinogen oxidase ['Nostoc azollae' 0708]
 gi|298233370|gb|ADI64506.1| Coproporphyrinogen oxidase ['Nostoc azollae' 0708]
          Length = 348

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 111/322 (34%), Positives = 147/322 (45%), Gaps = 47/322 (14%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  PD     +    +  + LQ  I    + L+              F    W R     
Sbjct: 18  LPAPDA----QARVSQFMQQLQDEITQALKALDG----------VGKFQEDSWQR----- 58

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGGR   L  G +FE+A V  S V+G   P          K   F+ATG S+++HP 
Sbjct: 59  PEGGGGRSRILRDGAIFEQAGVNFSEVWGSNLPPSILAQRPEAKGHGFYATGTSLVLHPR 118

Query: 128 NPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NP+VP VH N R       +WFGGG DLTP        +  D   FH TLK+ C QH   
Sbjct: 119 NPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHQTLKQACDQHHSE 173

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE----------------------M 224
            Y  +K WCD YFYL HR E+RGIGG+F D+                             
Sbjct: 174 YYPVFKRWCDEYFYLKHRDETRGIGGLFLDYQDGQGSIYRGPDPNGEAADYSNQVGTIAP 233

Query: 225 GGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTN 284
              +  F+ +   G   +  Y  +V+R +   + + +R  QL RRGRY EFNL+YD+GT 
Sbjct: 234 RTWEELFALVQDCGRALLPAYVPIVKRRHGIEYGDHERNFQLYRRGRYVEFNLVYDRGTI 293

Query: 285 FGFKTGGNVESILASMPPLVAW 306
           FG +T G  ESIL S+PPLV W
Sbjct: 294 FGLQTNGRTESILMSLPPLVRW 315


>gi|157826380|ref|YP_001494100.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
 gi|166217812|sp|A8GQB7|HEM6_RICAH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157800338|gb|ABV75592.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
          Length = 279

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 123/290 (42%), Positives = 168/290 (57%), Gaps = 16/290 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E  +      P  F    W R+      +     
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIEEEYAQTKC-LKPAKFVRTSWQRNGGGGGIMS---- 58

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F ATG+S++ H  +P +PA+H
Sbjct: 59  --LMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFSATGISLVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP         + +   FH   KE C ++    Y  +K+ C
Sbjct: 117 FNTRYIETSKSWFGGGGDLTPFYPE-----ENETEKFHAAFKEACDKYDSGYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR     
Sbjct: 172 DEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGMALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|294626789|ref|ZP_06705382.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665757|ref|ZP_06731029.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598905|gb|EFF43049.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604452|gb|EFF47831.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 299

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 145/292 (49%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC   E  + +A           F    W R++      GGGR   L  
Sbjct: 7   VRDYLTDLQDRICAAVEAADGKA----------RFAEDLWKREEG-----GGGRTRILRD 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A +  S V G   P              + A G+S++ HP+NP +P  H N+R 
Sbjct: 52  GAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPSIPTTHMNVRY 111

Query: 141 IVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
                       WFGGG DLTP        +D DV  +H   + +C       Y  +K W
Sbjct: 112 FRAERDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCVPFGQERYAAHKRW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R   
Sbjct: 167 CDEYFFLRHRNETRGVGGLFFDDLGQ-----DFERDFAYQRAVGDGFLDAYLPIVERRKD 221

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 222 TPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|93005074|ref|YP_579511.1| coproporphyrinogen III oxidase [Psychrobacter cryohalolentis K5]
 gi|92392752|gb|ABE74027.1| coproporphyrinogen oxidase [Psychrobacter cryohalolentis K5]
          Length = 336

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 154/293 (52%), Gaps = 18/293 (6%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +    +LQ+ IC   E  E++   ++  +    F    W R      + GGGR   L 
Sbjct: 28  RVREFLVDLQARICQALEAQESDGCTDA--QKATTFVPDDWER-----PEGGGGRSCVLA 80

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G+V EKA V+ S ++    P                A G+S++VHP NPHVP  H N+R
Sbjct: 81  DGEVIEKAGVMFSHIHVQNLPASATARHPDIAGRKAQAMGVSLVVHPKNPHVPTSHANVR 140

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           + +         +WFGGG DLTP           D + +H    ++C+    + Y  +K+
Sbjct: 141 LFIAEAEGKDPIWWFGGGFDLTPFYP-----VLADCVHWHQVCHDLCAPFGDSIYPDFKQ 195

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+L HR E RGIGG+F+D +++       +  F F+ AVG+ +++    +  +  
Sbjct: 196 WCDEYFHLRHRDEQRGIGGLFYDDVNTESRGWDFETCFKFMQAVGNGYLEGMLPIFEQRK 255

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  ++E +R+ QL RRGRY E+NL+YD+GT FG ++ G +ESIL SMPPL +W
Sbjct: 256 NLSYTEAEREFQLYRRGRYVEYNLVYDRGTLFGLQSNGRIESILVSMPPLASW 308


>gi|241766065|ref|ZP_04763980.1| Coproporphyrinogen oxidase [Acidovorax delafieldii 2AN]
 gi|241363921|gb|EER59215.1| Coproporphyrinogen oxidase [Acidovorax delafieldii 2AN]
          Length = 322

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 148/292 (50%), Gaps = 24/292 (8%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +   + LQ+ I    E +E E            F    W +   +    G G    L  
Sbjct: 15  VRSYLQGLQARITDALEAVEGEGG--------ARFLADAWSKAPGE-PLQGDGLTKILEN 65

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G+VFE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+RM
Sbjct: 66  GRVFERAGCGFSHVRGPQLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRM 125

Query: 141 I------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
           I           WFGGG+DLTP      +  + D + FH T ++  +      Y  +K+W
Sbjct: 126 IAAGHPGHAPTCWFGGGMDLTPY-----YGLEEDAVHFHRTCRDALAPFGDDKYPRFKQW 180

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR E RG+GG+F+D         G +   +   AVGD F+K Y  +V +   
Sbjct: 181 CDEYFYLKHRNEQRGVGGVFYDDFSE----LGFEQSLAMTQAVGDAFLKAYLPIVEKRQD 236

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPLVAW
Sbjct: 237 TPYGERERDFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLVAW 288


>gi|77166276|ref|YP_344801.1| coproporphyrinogen III oxidase [Nitrosococcus oceani ATCC 19707]
 gi|254435989|ref|ZP_05049496.1| coproporphyrinogen III oxidase, aerobic [Nitrosococcus oceani
           AFC27]
 gi|76884590|gb|ABA59271.1| coproporphyrinogen oxidase [Nitrosococcus oceani ATCC 19707]
 gi|207089100|gb|EDZ66372.1| coproporphyrinogen III oxidase, aerobic [Nitrosococcus oceani
           AFC27]
          Length = 317

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 113/292 (38%), Positives = 152/292 (52%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC+  E+ +  A           F    W R        GGGR   L  
Sbjct: 13  VKSYLLDLQDRICSTLEQEDGAAP----------FMEDTWRRA-----AGGGGRSRVLSE 57

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+  V  S V+G+  P              F A G+S+++HPYNP+VP  H NIR 
Sbjct: 58  GALFEQGGVNFSHVFGEGLPASATAQRPELAGRRFEALGVSLVIHPYNPYVPTSHANIRF 117

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        ++ D I +H   +E C       Y+ YK+W
Sbjct: 118 FMASKEDAAPIWWFGGGFDLTPYYP-----FEEDAIHWHRMAREACIPFGETVYSRYKKW 172

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HR E+RGIGG+FFD L+      G    F F+ +VGD ++  Y  +V++   
Sbjct: 173 CDEYFYLKHRDETRGIGGLFFDDLNEW----GFSRCFDFMQSVGDHYLLAYLPIVQQRKT 228

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  QL RRGRY EFNLLYD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 229 LTYGERERDFQLYRRGRYVEFNLLYDRGTLFGLQSGGRTESILMSLPPLVKW 280


>gi|182414511|ref|YP_001819577.1| coproporphyrinogen III oxidase [Opitutus terrae PB90-1]
 gi|177841725|gb|ACB75977.1| Coproporphyrinogen oxidase [Opitutus terrae PB90-1]
          Length = 333

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 111/319 (34%), Positives = 147/319 (46%), Gaps = 55/319 (17%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    NLQ  IC   E  +              F    W R +      GGGR   L
Sbjct: 11  AAVRTYLLNLQDRICAALEAEDG----------TGRFREDTWQRAEG-----GGGRSRVL 55

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G   P              + A G+S+++HP NP+VP  H N+
Sbjct: 56  ADGAVFEKAGVGFSHVRGSALPASATAQRPELAGRSWEALGVSLVIHPRNPYVPTSHANV 115

Query: 139 RMIVTGA-------------------------------YWFGGGIDLTPSLESRRHSYDP 167
           R                                     +WFGGG DLTP      + ++ 
Sbjct: 116 RFFCAQPATNQNGDATPSSRSKVHGEGAAAPGEIENSLWWFGGGFDLTPF-----YGFEE 170

Query: 168 DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGI 227
           D I +H T ++  +      Y  +K WCD YF+L HRQE RGIGGIFFD  +      G 
Sbjct: 171 DAIHWHRTARDALAPFGAGLYPRFKRWCDDYFFLKHRQEPRGIGGIFFDDFNE----LGF 226

Query: 228 DADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGF 287
           +  F+ + AVG+ ++  Y  +VR+     F E++RQ QL RRGRY EFNL++D+GT FG 
Sbjct: 227 EPSFALMRAVGEAYLPAYLPIVRQRKATPFGERERQFQLYRRGRYVEFNLVWDRGTLFGL 286

Query: 288 KTGGNVESILASMPPLVAW 306
           +T G  ESIL S+PPLV W
Sbjct: 287 QTSGRTESILMSLPPLVRW 305


>gi|148652221|ref|YP_001279314.1| coproporphyrinogen III oxidase [Psychrobacter sp. PRwf-1]
 gi|148571305|gb|ABQ93364.1| coproporphyrinogen oxidase [Psychrobacter sp. PRwf-1]
          Length = 332

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 103/313 (32%), Positives = 153/313 (48%), Gaps = 23/313 (7%)

Query: 1   MNLCTIEIGCPDDIEERK-RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKH 59
           +N     +  PD    +  +  +     LQ+ IC   E+ E +   +        F    
Sbjct: 8   INNAAPIVDNPDSPTAKDIQRVRDFLIQLQANICQALEQQEIDGGGS------ATFVPDD 61

Query: 60  WLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATG 119
           W R      + GGGR   +  G V EKA V+ S ++    P                A G
Sbjct: 62  WQR-----PEGGGGRSCVMADGAVIEKAGVMFSHIHISNLPATATARHPDIAGRKAQAMG 116

Query: 120 LSVIVHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           +S++VHP NP+VP  H N+R+ V         +WFGGG DLTP           D + +H
Sbjct: 117 VSLVVHPRNPNVPTSHANVRLFVAEKEGEDPIWWFGGGFDLTPFYP-----VLEDCVHWH 171

Query: 174 NTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSF 233
           +   E+C+      Y  +K+WCD YFYL HR E RG+GG+F+D +++       +  F F
Sbjct: 172 HVCHELCAPFGEEIYPEFKKWCDDYFYLRHRNEQRGVGGLFYDDVNTQSRGWDFETCFKF 231

Query: 234 ISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
           + AVG  ++     +  +     ++EQ R+ QL RRGRY E+NL+YD+GT FG ++ G +
Sbjct: 232 MQAVGQGYLDGIIPIFEKRKQLPYTEQQREFQLYRRGRYVEYNLVYDRGTLFGLQSNGRI 291

Query: 294 ESILASMPPLVAW 306
           ESIL S+PPL  W
Sbjct: 292 ESILVSLPPLTGW 304


>gi|119503590|ref|ZP_01625673.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
 gi|119460652|gb|EAW41744.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
          Length = 308

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++   +LQ  IC     ++              F  + W R      + GGG    L
Sbjct: 4   NAVEQYLRSLQKSICDRLTTIDGS----------GSFEEETWDR-----PEGGGGVSRVL 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P     +        F A G+S+++HP+NP+VP  H N+
Sbjct: 49  AEGAVFEKAGVNFSHVRGESLPGSATAVRPQLAGRSFQAMGVSLVIHPHNPYVPTAHANV 108

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +W GGG DLTP      + +  D + +H T    C  +    Y  YK
Sbjct: 109 RLFVAEQPGKEPIWWMGGGFDLTPY-----YGFFDDAVHWHQTAAAACEPYGPEVYPKYK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E RG+GG+FFD L+      G D  FSF+  VGD F++ Y  +V R 
Sbjct: 164 AWCDEYFHLKHRNEPRGVGGLFFDDLNEW----GFDKTFSFMRNVGDHFLEGYVPIVERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL+YD+GT FG ++ G  ESIL S+PPLV W
Sbjct: 220 KDEFWGERERQWQLYRRGRYVEFNLVYDRGTLFGLQSNGRTESILMSLPPLVRW 273


>gi|254474344|ref|ZP_05087730.1| coproporphyrinogen III oxidase, aerobic [Ruegeria sp. R11]
 gi|214028587|gb|EEB69422.1| coproporphyrinogen III oxidase, aerobic [Ruegeria sp. R11]
          Length = 293

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 115/299 (38%), Positives = 158/299 (52%), Gaps = 17/299 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEA-HENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           + K  +   F++L+  I   FE LE+       +++    F V    R      D GGG 
Sbjct: 3   DEKARAAAWFKSLRDSIVAAFEGLEDSHDTGPFSDQPAGRFDVSETKRTAEDGSDAGGGL 62

Query: 75  MATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
           M+ +  G+VFEK  V +S VYG        +   +  I G   +P FWA+G+S++ H  N
Sbjct: 63  MSVMRGGRVFEKVGVNISEVYGTLGERAQHAMAARKGIPGMKDDPRFWASGISLVAHMQN 122

Query: 129 PHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
           PHVPAVH N RM  T   +WFGGG DL P LE     YD D   FH+  K     H    
Sbjct: 123 PHVPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YDEDTAHFHHVQKRHLGPHGEDL 177

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y   K W D YFY+PHR+ +RG+GGIF D  +S    G  +ADF+    +G  F+  Y  
Sbjct: 178 YPRLKAWADDYFYIPHRKRARGVGGIFMDDRNS----GDWEADFALTQDIGRAFLPAYLP 233

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           LV +     F   ++  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PPL  W
Sbjct: 234 LVEQRRTLAFGAAEKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPLAKW 292


>gi|251790867|ref|YP_003005588.1| Coproporphyrinogen oxidase [Dickeya zeae Ech1591]
 gi|247539488|gb|ACT08109.1| Coproporphyrinogen oxidase [Dickeya zeae Ech1591]
          Length = 312

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 111/292 (38%), Positives = 150/292 (51%), Gaps = 30/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +     LQ  +C + E  +  A           F    W          GGGR   L  
Sbjct: 9   IKHFLLKLQDTLCRQLELADGSA----------TFIEDAWQ-----HASGGGGRSRVLRQ 53

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G+VFE+A V  S V G   P              F A G+S+++HP NP+VP  H NIR 
Sbjct: 54  GRVFEQAGVNFSHVSGASLPPSASTHRPELAGRSFQAMGVSLVIHPLNPYVPTSHANIRF 113

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP      + ++ D + +H T  ++C       Y  YK+W
Sbjct: 114 FIAEKPGEPAVWWFGGGFDLTPF-----YGFEEDAVHWHQTAFDLCRPFGDDVYPRYKKW 168

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E+RG+GG+FFD L++       D  F+F+ AVG+ F   Y  +V R   
Sbjct: 169 CDDYFFLKHRNEARGVGGLFFDDLNTP----DFDTSFAFMRAVGEGFQHAYLPIVNRRKD 224

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 225 IPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|254523147|ref|ZP_05135202.1| coproporphyrinogen III oxidase, aerobic [Stenotrophomonas sp.
           SKA14]
 gi|219720738|gb|EED39263.1| coproporphyrinogen III oxidase, aerobic [Stenotrophomonas sp.
           SKA14]
          Length = 298

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 151/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E ++ +A           F    W R +      GGGR   L
Sbjct: 5   ERVRAYLTDLQDRICAAIEAVDGQA----------RFQEDLWQRAEG-----GGGRTRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + ATG+S++ HP NP+VP  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVAGSRLPPSASANRPELAGASWRATGVSLVFHPLNPYVPTTHANV 109

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   +++C+      Y  +K
Sbjct: 110 RFFQAQRDGDVVASWFGGGFDLTPFYP-----FDEDVQHWHRVARDLCTPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD LH     G  + DF ++ AVGD F++ Y  +V++ 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLH-----GDFERDFDYLRAVGDGFLEAYLPIVQQR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                 E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTPHGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRW 273


>gi|74318479|ref|YP_316219.1| coproporphyrinogen III oxidase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057974|gb|AAZ98414.1| coproporphyrinogen III oxidase [Thiobacillus denitrificans ATCC
           25259]
          Length = 303

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 140/292 (47%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQS I    E  +              F    W R      + GGG    +  
Sbjct: 11  VKTWLLDLQSRIVAALEAADG-----------LPFRTDSWDR-----PEGGGGISRLIEE 54

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G V E+  V  S V G   P              + A G+S+++HP NP+VP VH N+R 
Sbjct: 55  GNVLERGGVNFSHVTGVQLPPSASAHRPELAGRRWEAMGVSLVLHPRNPYVPTVHMNVRC 114

Query: 141 I------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
                      +WFGGG+DLTP      + ++ D   FH   K          +  +K+W
Sbjct: 115 FSALKDGEAPVWWFGGGMDLTPY-----YGFEQDARHFHLACKSALDPFGPGLHARFKDW 169

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CDRYF+L HR E+RG+GGIFFD        GG D  F+   +VGD FI  Y  ++ R   
Sbjct: 170 CDRYFFLKHRNEARGVGGIFFDDFSE----GGFDHAFAMTRSVGDAFIDAYLPILERRKD 225

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  Q  RRGRY EFNL+ D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 226 IAYGERERDFQAYRRGRYVEFNLVLDRGTLFGLQSGGRTESILMSLPPLVKW 277


>gi|152979898|ref|YP_001352232.1| coproporphyrinogen III oxidase [Janthinobacterium sp. Marseille]
 gi|151279975|gb|ABR88385.1| coproporphyrinogen III oxidase [Janthinobacterium sp. Marseille]
          Length = 332

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 146/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ I    E ++ +A           F    W R      + GGG    +
Sbjct: 38  AAVKEYLLGLQARIVAALEAVDGKA-----------FGTDSWQR-----PEGGGGISRII 81

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+  V  S V G   P              + A G+S+++HP NP+ P VH N+
Sbjct: 82  ENGNVFERGGVGFSHVMGKNLPPSAAANRPELAGRNWEAMGVSLVLHPRNPYAPTVHMNV 141

Query: 139 RMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG+DLTP      + ++ D + FH T ++         +  YK
Sbjct: 142 RFFTATAEGQDAIWWFGGGMDLTPY-----YGFEEDALHFHQTCRDALQAFGDDVHPRYK 196

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HRQE RG+GGIFFD L++          F+   +VGD FI  Y  L+++ 
Sbjct: 197 KWCDDYFYLKHRQEPRGVGGIFFDDLNTP----DFAQCFALQQSVGDHFIAAYLPLLQKR 252

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+V W
Sbjct: 253 MDTPYGERERDFQTYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVVTW 306


>gi|119475273|ref|ZP_01615626.1| Coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2143]
 gi|119451476|gb|EAW32709.1| Coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2143]
          Length = 302

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 113/298 (37%), Positives = 153/298 (51%), Gaps = 30/298 (10%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           E      +    NLQ+ IC + E+ +  A           F    WLR      + GGGR
Sbjct: 3   EIPVDQVKAYLLNLQNTICDQLEQEDGGA----------TFLQDEWLR-----PEGGGGR 47

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              L  G V EK  V  S V+G   P    Q         F A G+S+++HP NP+VP  
Sbjct: 48  SRVLTDGAVIEKGGVNFSHVFGKGLPPSATQARPELAGRSFQAMGVSLVIHPKNPYVPTS 107

Query: 135 HFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+R+ +         +WFGGG DLTP         + D I +H T KE C       Y
Sbjct: 108 HANVRLFIAEKEGEDPVWWFGGGYDLTPYYAD-----EDDCIAWHRTAKEACEPFGEKVY 162

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             YK+WCD YF+LPHR E RGIGG+FFD L+     GG +  F  + A+G+ +++ Y  +
Sbjct: 163 QDYKQWCDDYFFLPHRNEPRGIGGLFFDDLNE----GGFERCFGLMQAIGNSYVEAYRPI 218

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + +     F  ++R  QL RRGRY EFNL+ D+GT FG ++ G  ESIL S+PPLV+W
Sbjct: 219 MAKKKEMPFGARERDFQLYRRGRYVEFNLVQDRGTIFGLQSNGRTESILMSLPPLVSW 276


>gi|71082810|ref|YP_265529.1| coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762767|ref|ZP_01264732.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|71061923|gb|AAZ20926.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91718569|gb|EAS85219.1| Coproporphyrinogen III oxidase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 275

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 129/294 (43%), Positives = 180/294 (61%), Gaps = 21/294 (7%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           D E +K+++   F+ LQ+ IC + EKLE +            F  K W R + +  D GG
Sbjct: 2   DKEIKKKLASNWFKLLQNTICNDIEKLEGKKS---------KFKSKTWNRSEIK--DEGG 50

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G    L  GK+FEK  V  S V+G  S     +I G +KNP FWA+G+S+++H  NPHVP
Sbjct: 51  GEFRILKNGKIFEKVGVNFSEVHGKFSKKMSKKIPGASKNPNFWASGISIVMHMKNPHVP 110

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG+D+TP ++  +        F H  LK+MC +H    Y  YK
Sbjct: 111 AIHFNTRFIYTTHGWFGGGMDVTPCIQDLKEKS-----FLHTELKKMCDRHDKKFYKKYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYLPHR+E+RGIGGIFFD+          + DF F++ +G  F  L+ S+++  
Sbjct: 166 KWCDEYFYLPHRKETRGIGGIFFDYKK-----KDWEKDFKFVTDLGVTFQMLFNSIIQLK 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   ++ + ++ Q I+RGRYAEFNLLYD+GT FG +TGGNVE+IL S+PP+  W
Sbjct: 221 HKKKWTVKQKEIQYIKRGRYAEFNLLYDRGTKFGLQTGGNVEAILMSLPPIAKW 274


>gi|166710295|ref|ZP_02241502.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 299

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 146/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R++      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAADGKA----------RFAEDLWKREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP NP++P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPRNPYIPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   + +C       Y  +K
Sbjct: 110 RYFRAERDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCEPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  +V+R 
Sbjct: 165 RWCDEYFFLCHRNETRGVGGLFFDDL-----GKEFEHDFAYQQAVGNGFLDAYMPIVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|261380674|ref|ZP_05985247.1| coproporphyrinogen III oxidase [Neisseria subflava NJ9703]
 gi|284796382|gb|EFC51729.1| coproporphyrinogen III oxidase [Neisseria subflava NJ9703]
          Length = 302

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 153/287 (53%), Gaps = 31/287 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ+ IC   E+ + EA           F  + W         LG G    L  G VF
Sbjct: 10  LKTLQNQICAALEQEDGEA----------KFVHEAWT------GKLGIGETRVLKNGAVF 53

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG 144
           E+A V  S V G   P              F A G+S+++HP NP+VP  H N+R  +  
Sbjct: 54  EQAGVNFSHVKGTKMPASATAHRPELAGAAFEAMGVSLVIHPKNPYVPTSHANVRFFIAY 113

Query: 145 A------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        ++ D++ +H  ++++C+    + Y+ +K+WCD Y
Sbjct: 114 PENAEPVWWFGGGFDLTPFYP-----FEEDIVHWHTVVRDVCTPFGESVYSEFKQWCDEY 168

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FYL HR E+RG+GG+FFD L+        D   +FI AVG+ +I  Y  +V +  +  + 
Sbjct: 169 FYLKHRNETRGVGGLFFDDLNRW----DFDTCLNFIKAVGEGYIAAYLPIVAKRKNTPYG 224

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV 
Sbjct: 225 ERERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVR 271


>gi|152994103|ref|YP_001338938.1| coproporphyrinogen III oxidase [Marinomonas sp. MWYL1]
 gi|150835027|gb|ABR69003.1| Coproporphyrinogen oxidase [Marinomonas sp. MWYL1]
          Length = 314

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 106/311 (34%), Positives = 151/311 (48%), Gaps = 33/311 (10%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +         D++ +    +    +LQ  IC+  E +E              F    W R
Sbjct: 1   MSASSPAMVTDLDVQ--AVKDYLLSLQDHICSTLESVE----------PSARFKEDAWDR 48

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
                 + GGGR   +  G V EK  V  S V GD  P              F A G+S+
Sbjct: 49  -----PNGGGGRTRVIAGGDVIEKGGVNFSHVMGDNLPPSATADRPELAGGRFEAMGVSL 103

Query: 123 IVHPYNPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           ++HP NP  P  H N+R+       +   +WFGGG DLTP      + +D D I +H   
Sbjct: 104 VIHPNNPMAPTSHANVRLFIVYKDGMAPVWWFGGGFDLTPY-----YGFDEDCIHWHQAS 158

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
            +         Y+ +K+WCD YFYL HR E RGIGG+FFD  +     G  +  F  + +
Sbjct: 159 YDAVEPFGEGYYSRFKKWCDEYFYLKHRGEPRGIGGLFFDDFNE----GSFEHCFGMMES 214

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG-GNVES 295
           VG+ + + Y ++++R     F+EQ R  QL RRGRY EFNL++D+GT+FG ++G G  ES
Sbjct: 215 VGNAYTEAYLAILKRRKDLPFTEQQRDFQLHRRGRYVEFNLVFDRGTHFGLQSGLGRTES 274

Query: 296 ILASMPPLVAW 306
           IL S+PP V W
Sbjct: 275 ILMSLPPEVRW 285


>gi|114331929|ref|YP_748151.1| coproporphyrinogen III oxidase [Nitrosomonas eutropha C91]
 gi|122313349|sp|Q0AEP6|HEM6_NITEC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|114308943|gb|ABI60186.1| coproporphyrinogen oxidase [Nitrosomonas eutropha C91]
          Length = 301

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 101/294 (34%), Positives = 143/294 (48%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    NLQ+ I    E+ +              F    W R      + GGG    +
Sbjct: 4   AQVKDYLVNLQNNIVAGLEQADG-----------GSFRRDSWDR-----PEGGGGTSCVI 47

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NP+ P VH N+
Sbjct: 48  EEGNVLERGGVNFSHVHGKGLPASATAARPELAGRAFEAAGVSLVLHPRNPYAPTVHMNV 107

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG+DLTP      + ++ D I FH   K          Y  +K
Sbjct: 108 RFFAAIKEGAEPVWWFGGGMDLTPY-----YGFEEDAIHFHQICKHALQPSGSEYYPRFK 162

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR+E RGIGG+FFD L+           F+   +VGD F+  Y  ++++ 
Sbjct: 163 KWCDEYFYLKHRKEPRGIGGVFFDDLNQP----DFVTCFNLTKSVGDQFLAAYVPILQKR 218

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 219 CNLPYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPIVKW 272


>gi|227114526|ref|ZP_03828182.1| coproporphyrinogen III oxidase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 310

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC +   ++ EA           F    W R +      GGG    L
Sbjct: 5   NAVKHFLLSLQEDICQQLAAIDGEAD----------FAKDEWQRAEG-----GGGCSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FE+A V  S + G   P              F A G+S+++HP +P++P  H N+
Sbjct: 50  SGGRIFERAGVNFSHIIGKSLPPSASTHRPDLAGRSFQAMGVSLVIHPLSPYIPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ +         +WFGGG DLTP      + +  D + +H T  ++C       Y  YK
Sbjct: 110 RLFIAEKPGEEPVWWFGGGFDLTPY-----YGFKEDAVHWHQTAHDLCQPFGDDVYPRYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RG+GG+FFD L+           F+FI AVG  F+  Y  +V R 
Sbjct: 165 KWCDDYFFLKHRNEARGVGGLFFDDLNEP----DFATSFAFIRAVGKGFLDGYLPIVERC 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 KDLSWGEREREFQLYRRGRYVEFNLIWDRGTLFGLQSGGRTESILMSMPPLARW 274


>gi|183599731|ref|ZP_02961224.1| hypothetical protein PROSTU_03234 [Providencia stuartii ATCC 25827]
 gi|188021990|gb|EDU60030.1| hypothetical protein PROSTU_03234 [Providencia stuartii ATCC 25827]
          Length = 305

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 152/293 (51%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +     LQ  IC +  +L+ +          + F  + W R +      GGGR   L 
Sbjct: 8   QVKTFLLELQETICQKITELDGK----------ETFLEQTWERAEG-----GGGRSRVLT 52

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G +FE+A V  S + G   P              + A G+S+++HP NP++P  H N+R
Sbjct: 53  QGAIFEQAGVNFSHIQGTKLPSSATAHRPELAGRSYQAMGVSLVIHPLNPYIPTTHANVR 112

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG DLTP      + ++ DVI +H    ++C+      Y  YK 
Sbjct: 113 FFIAEKEGQDPVWWFGGGFDLTPY-----YGFEDDVIHWHTIAHDLCAPFGSETYRKYKA 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+L HR E RG+GG+F+D L+        +  F F  AVG  F+  Y  +V +  
Sbjct: 168 WCDDYFFLKHRNEPRGVGGLFYDDLNQP----DFETCFDFTQAVGHGFLDAYVPIVEKRR 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           HH + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 224 HHQWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLVRW 276


>gi|58583862|ref|YP_202878.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84625659|ref|YP_453031.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188574815|ref|YP_001911744.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75433775|sp|Q5GUY0|HEM6_XANOR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123520709|sp|Q2NY70|HEM6_XANOM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|226740908|sp|B2SK75|HEM6_XANOP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|58428456|gb|AAW77493.1| aerobic coproporphyrinogen III oxidase [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84369599|dbj|BAE70757.1| aerobic coproporphyrinogen III oxidase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188519267|gb|ACD57212.1| coproporphyrinogen III oxidase, aerobic [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 299

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R++      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAADGKA----------RFAEDLWKREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NP++P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPYIPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   + +C       Y  +K
Sbjct: 110 RYFRAERDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCEPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  +V+R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDL-----GKEFEHDFAYQQAVGNGFLDAYMPIVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDTAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|50119816|ref|YP_048983.1| coproporphyrinogen III oxidase [Pectobacterium atrosepticum
           SCRI1043]
 gi|62510609|sp|Q6D8U8|HEM6_ERWCT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|49610342|emb|CAG73786.1| coproporphyrinogen III oxidase, aerobic [Pectobacterium
           atrosepticum SCRI1043]
          Length = 310

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC +   ++  A           F    W R +      GGG    L
Sbjct: 5   NAVKHFLLSLQKDICQQLAAIDGGAD----------FAEDEWQRAEG-----GGGCSRVL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++FE+  V  S V G   P              F A G+S+++HP +P++P  H N+
Sbjct: 50  SGGRIFERTGVNFSHVTGKSLPPSASTHRPDLAGRSFQAMGVSLVIHPLSPYIPTSHANV 109

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      + +  D + +H T  ++C       Y  YK
Sbjct: 110 RLFVAEKPGEEPVWWFGGGFDLTPY-----YGFKEDAVHWHQTAHDLCQPFGDDVYPRYK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGG+FFD L+           F+FI AVG+ F+  Y  +V R 
Sbjct: 165 KWCDDYFFLKHRNEARGIGGLFFDDLNEP----DFATSFAFIRAVGNGFLDGYLPIVERR 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 221 KDLAWGERERDFQLYRRGRYVEFNLIWDRGTLFGLQSGGRTESILMSMPPLARW 274


>gi|157804279|ref|YP_001492828.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
 gi|157785542|gb|ABV74043.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
          Length = 277

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 125/293 (42%), Positives = 179/293 (61%), Gaps = 17/293 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +E RK I+   F +L+ ++C EFEK+E E  +   +  P  F   +W R+       GGG
Sbjct: 1   MENRK-ITSNWFTDLRDLLCAEFEKIEEEYTKEK-DIEPAKFVRSNWERN------GGGG 52

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
            + +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+SV+ H  +P +PA
Sbjct: 53  GVMSLMKGEVFEKVGVNISTVFGEFSPEFRTEIPGGELDGKFFATGISVVAHLKSPLIPA 112

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +HFN R I T   WFGGG DLTP         + +   FH   K+ C ++  + Y  +K+
Sbjct: 113 MHFNTRYIETSKSWFGGGGDLTPYYPE-----ENETTKFHAAFKKACDKYDFSYYPKFKK 167

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
            C+ YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR   
Sbjct: 168 QCNEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTKDVGKALLSVYPKIVRNKL 223

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 224 FLPWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTYGNVEAILMSLPPEVKW 276


>gi|15893292|ref|NP_361006.1| coproporphyrinogen III oxidase [Rickettsia conorii str. Malish 7]
 gi|34581044|ref|ZP_00142524.1| coproporphyrinogen III oxidase precursor [Rickettsia sibirica 246]
 gi|21362588|sp|Q92FV8|HEM6_RICCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|15620514|gb|AAL03907.1| coproporphyrinogen III oxidase precursor [Rickettsia conorii str.
           Malish 7]
 gi|28262429|gb|EAA25933.1| coproporphyrinogen III oxidase precursor [Rickettsia sibirica 246]
          Length = 279

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 125/293 (42%), Positives = 177/293 (60%), Gaps = 17/293 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE  K I+   F NL+ ++C EFEK+E E  + +    P  F    W R+       GG
Sbjct: 2   NIEN-KEITSSWFTNLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRSSWQRN------GGG 53

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +P
Sbjct: 54  GGVMSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIP 113

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K
Sbjct: 114 AMHFNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIF+D+L+     G  + DF+F   VG   + +YP +VR  
Sbjct: 169 KQCDEYFYLKHRKEPRGVGGIFYDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSK 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
               ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 225 LFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|229587257|ref|YP_002845758.1| coproporphyrinogen III oxidase [Rickettsia africae ESF-5]
 gi|259709757|sp|C3PM25|HEM6_RICAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|228022307|gb|ACP54015.1| Coproporphyrinogen III oxidase precursor [Rickettsia africae ESF-5]
          Length = 279

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 124/293 (42%), Positives = 176/293 (60%), Gaps = 17/293 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE  K I+   F NL+ ++C EFEK+E E  + +    P  F    W R+       GG
Sbjct: 2   NIEN-KEITSSWFTNLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRSSWQRN------GGG 53

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G VFEK  V +STV+G +S +F+++I G   +  F+ATG+S++ H  +P +P
Sbjct: 54  GGVMSLMKGAVFEKVGVNISTVFGKISSEFRNEIPGAELDGKFFATGISLVAHLKSPLIP 113

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K
Sbjct: 114 AMHFNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIF+D+L+     G  + DF+F   VG   + +YP +VR  
Sbjct: 169 KQCDEYFYLKHRKEPRGVGGIFYDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSK 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
               ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 225 LFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|325917394|ref|ZP_08179608.1| coproporphyrinogen oxidase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536395|gb|EGD08177.1| coproporphyrinogen oxidase [Xanthomonas vesicatoria ATCC 35937]
          Length = 299

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 111/294 (37%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  +  A           F+   W R++      GGGR   L
Sbjct: 5   DRVRDYLTDLQDRICAAVEAADGRA----------RFSEDLWQREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP NPHVP  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPNNPHVPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP         D DV  +H T + +C+      Y  +K
Sbjct: 110 RYFRAERDGEVVAAWFGGGFDLTPFYP-----MDEDVQHWHRTAQALCAPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  LV+R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDLGQ-----DFERDFAYQQAVGNGFLDAYMPLVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KDEPFGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|238651129|ref|YP_002916987.1| coproporphyrinogen III oxidase [Rickettsia peacockii str. Rustic]
 gi|259709758|sp|C4K2Y8|HEM6_RICPU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|238625227|gb|ACR47933.1| coproporphyrinogen III oxidase [Rickettsia peacockii str. Rustic]
          Length = 279

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 125/293 (42%), Positives = 177/293 (60%), Gaps = 17/293 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE  K I+   F NL+ ++C EFEK+E E  + +    P  F    W R+       GG
Sbjct: 2   NIEN-KEITSSWFTNLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRSSWQRN------GGG 53

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +P
Sbjct: 54  GGVMSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGVELDGKFFATGISLVAHLKSPLIP 113

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG DLTP    +      + + FH   KE C ++  + Y  +K
Sbjct: 114 AMHFNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIF+D+L+     G  + DF+F   VG   + +YP +VR  
Sbjct: 169 KQCDEYFYLKHRKEPRGVGGIFYDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSK 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
               ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 225 LFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|332977535|gb|EGK14306.1| coproporphyrinogen III oxidase [Psychrobacter sp. 1501(2011)]
          Length = 341

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 99/294 (33%), Positives = 147/294 (50%), Gaps = 22/294 (7%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +        LQ+ IC   E+ E +            FT   W R      + GGGR   +
Sbjct: 32  QRVHDFLVQLQADICQAIEQQEADGGGT------ATFTPDDWKR-----PEGGGGRSCVM 80

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+V EKA V+ S ++ +  P                A G+S+++HP NP+VP  H N+
Sbjct: 81  AGGEVIEKAGVMFSHIHINNLPPTATARHPDIAGRKAQALGVSLVIHPRNPNVPTSHANV 140

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+           +WFGGG DLTP           D + +H    ++C+      Y  +K
Sbjct: 141 RLFVAEKEGEAPIWWFGGGFDLTPFYP-----VLEDCVHWHKVCHDLCAPFGEEIYPEFK 195

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+F+D +++       +  F F+ AVG  ++     +  + 
Sbjct: 196 KWCDDYFYLRHRDEQRGIGGLFYDDVNTMSCGWDFETCFKFMQAVGQGYLDAILPIFEKR 255

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ R+ QL RRGRY E+NL+YD+GT FG ++ G +ESIL S+PPL  W
Sbjct: 256 KNTPYTEQQREFQLYRRGRYVEYNLVYDRGTLFGLQSNGRIESILVSLPPLTGW 309


>gi|126655680|ref|ZP_01727119.1| coproporphyrinogen III oxidase [Cyanothece sp. CCY0110]
 gi|126623159|gb|EAZ93864.1| coproporphyrinogen III oxidase [Cyanothece sp. CCY0110]
          Length = 315

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 152/305 (49%), Gaps = 43/305 (14%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ  IC   EK +              F    W R++      GGGR   L  G + 
Sbjct: 1   MKTLQDEICQGLEKADGS----------GKFHEDSWQREEG-----GGGRSRVLRDGNLL 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+  V  S V+G   P    +     +   F+ATG S+++HP NP++P VH N R     
Sbjct: 46  EQGGVNFSEVWGKQLPPSILKQRPEAEGHGFYATGTSMVLHPRNPYIPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGGIDLTP        +  D   FH TLKE C +H    Y  +K WCD YFYL H
Sbjct: 106 PVWWFGGGIDLTPYYP-----FAEDASQFHRTLKETCDKHHCEYYPVFKSWCDEYFYLKH 160

Query: 204 RQESRGIGGIFFDHLH----------------------SSPEMGGIDADFSFISAVGDCF 241
           RQE+RG+GGIFFD+                        S  +    +  F+F++  G  F
Sbjct: 161 RQETRGVGGIFFDYQDGTDPLYRGPHADKAAANYSNQLSDLKPRNWEELFAFVNDCGRTF 220

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V +  +  + +++RQ QL RRGRY EFNL+YD+GT FG +T G  ESIL S+P
Sbjct: 221 LPAYLPIVEKRRNTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLP 280

Query: 302 PLVAW 306
           PLV W
Sbjct: 281 PLVRW 285


>gi|90422774|ref|YP_531144.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB18]
 gi|90104788|gb|ABD86825.1| coproporphyrinogen oxidase [Rhodopseudomonas palustris BisB18]
          Length = 304

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 173/304 (56%), Gaps = 8/304 (2%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
              I      + E+ +  ++  FE+L+  IC+E E LE EA        P  FT K W R
Sbjct: 8   RAEIPHAPRSEAEQHRARAKAWFESLRDRICSEVEALEREAPAALFPGEPARFTYKPWQR 67

Query: 63  DKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSV 122
              Q   +GG         ++FEK  +  S+  G L+P+    + G   +  + ++ +S+
Sbjct: 68  QTGQGGGVGGFLSGG----RLFEKIGIHTSSANGRLTPEMAKTLPGDGVSLNYVSSSISL 123

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           I+HP +P VP VH N R + T   WFGGG DLTP L  +R +   D + FH  ++  C  
Sbjct: 124 IMHPRSPRVPTVHMNTRFLATSQGWFGGGADLTPMLAEQRRADAEDCVTFHAAMQRACDA 183

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y  +K W D YF+LPHR  +RG+GGIF+DHL+S    G  + DF+F   VG   +
Sbjct: 184 HDPGYYAKFKPWADSYFFLPHRGTARGVGGIFYDHLNS----GDFERDFAFTREVGLALL 239

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
           ++YP +VR+     +S+ +R +QL  RG Y EFNLLYDKGT FG +TGGN+E+IL+SMPP
Sbjct: 240 EVYPKIVRKRMQEPWSDAERAQQLACRGLYVEFNLLYDKGTMFGLQTGGNIETILSSMPP 299

Query: 303 LVAW 306
           LV+W
Sbjct: 300 LVSW 303


>gi|254413000|ref|ZP_05026772.1| coproporphyrinogen III oxidase, aerobic [Microcoleus chthonoplastes
           PCC 7420]
 gi|196180164|gb|EDX75156.1| coproporphyrinogen III oxidase, aerobic [Microcoleus chthonoplastes
           PCC 7420]
          Length = 342

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 109/332 (32%), Positives = 152/332 (45%), Gaps = 46/332 (13%)

Query: 1   MNLCTIEIGCPD---DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTV 57
           M         P+      + +   ++  + +Q  IC    +L+              F  
Sbjct: 1   MTASQTPTTNPNRSLPATDSRDRVKQFMQQIQDTICDSLAELDG----------AGQFQE 50

Query: 58  KHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWA 117
             W R++      GGGR   +  G VFE+  V  S V+G   P              F+A
Sbjct: 51  DSWQREEG-----GGGRSRVIRDGAVFEQGGVNFSEVWGTQLPPSILTQRPEAAGHGFYA 105

Query: 118 TGLSVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
           TG S+++HP +P++P VH N R       +WFGGG DLTP        +  D   FH TL
Sbjct: 106 TGTSMVLHPRSPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FAEDAAHFHKTL 160

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE------------- 223
           K  C  H    Y  +K WCD YFYL HRQE+RG+GG+FFD+   + E             
Sbjct: 161 KTACDNHHSEYYPVFKRWCDEYFYLKHRQETRGVGGLFFDYQDGTGELYKGPHPEKAAAI 220

Query: 224 ---------MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAE 274
                        +  F+++   G  F+  Y  +V R     + +++R  QL RRGRY E
Sbjct: 221 YSKELGAVEPRTWEQLFAWVQECGHSFLPAYVPIVERRRDMNYGDRERNFQLYRRGRYVE 280

Query: 275 FNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           FNL+YD+GT FG +T G  ESIL S+PPLV W
Sbjct: 281 FNLVYDRGTIFGLQTNGRTESILMSLPPLVRW 312


>gi|254496883|ref|ZP_05109731.1| coproporphyrinogen III oxidase [Legionella drancourtii LLAP12]
 gi|254353902|gb|EET12589.1| coproporphyrinogen III oxidase [Legionella drancourtii LLAP12]
          Length = 312

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 147/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ ICT  E L+  A           F    W R        GGG    L
Sbjct: 13  EQVKAYLLQLQNTICTSLEDLDGNAQ----------FVEDAWQR-----PAGGGGITRVL 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VF KA V  S V G+  P              F A G+S+++HP NP+VP  H N+
Sbjct: 58  THGQVFAKAGVNFSHVSGEQLPASASAHRPELAGRKFSALGVSLVIHPDNPYVPTSHANV 117

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + +  D   +H T    C     + Y  +K
Sbjct: 118 RFFIAEKEGAAPVWWFGGGFDLTPY-----YGFAEDCKHWHQTALNACQPFGQSIYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD  +        +  F+ + ++GD +IK Y  +V R 
Sbjct: 173 KWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFEHSFALMQSIGDHYIKAYAPIVSRR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H FS Q++  Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V+W
Sbjct: 229 KEHPFSIQEKAFQNYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPDVSW 282


>gi|149185629|ref|ZP_01863945.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
 gi|148830849|gb|EDL49284.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
          Length = 285

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 133/296 (44%), Positives = 173/296 (58%), Gaps = 14/296 (4%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            D  E+ + ++  FE L+  IC EFE +E EA   +A      F    W R++    D G
Sbjct: 2   TDWTEQTQTARTWFETLRDRICAEFESIEREAGSEAA------FQYDSWSREEEGNADPG 55

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGT-TKNPYFWATGLSVIVHPYNPH 130
           G     L  GKVFEK  V VSTV G+ +P+F   I G   +NP F ATG+S++ H  NPH
Sbjct: 56  G-GTRGLMKGKVFEKVGVNVSTVRGNFAPEFAASINGASPENPGFTATGISLVAHMANPH 114

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R + T A WFGGG DL P L      Y+ D   FH   +  C+ H    Y  
Sbjct: 115 VPAVHMNTRFLTTQAAWFGGGADLNPPLP-----YEEDTEEFHARFRAACAAHNPTYYDR 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K+W D YFY+PHR   RG+GGIF+DHL       G + + +F   VG+ F+ +YP LVR
Sbjct: 170 FKKWADDYFYIPHRGVHRGVGGIFYDHLECDD-EAGFERNLAFTKDVGEAFLDIYPKLVR 228

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     F+E D+ +QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 229 RRMESEFTEADKAQQLEWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEATW 284


>gi|157829204|ref|YP_001495446.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933930|ref|YP_001650719.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. Iowa]
 gi|166217814|sp|A8GU63|HEM6_RICRS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|189028103|sp|B0BVQ3|HEM6_RICRO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157801685|gb|ABV76938.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165909017|gb|ABY73313.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. Iowa]
          Length = 279

 Score =  321 bits (823), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 125/293 (42%), Positives = 178/293 (60%), Gaps = 17/293 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE  K I+   F NL+ ++C EFEK+E E  + +    P  F    W R+       GG
Sbjct: 2   NIEN-KEITSSWFTNLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRSSWQRN------GGG 53

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G VFEK  V +STV+G +SP+F+++I G   +  F+ATG+S++ H  +P +P
Sbjct: 54  GGVMSLMKGAVFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIP 113

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG DLTP    +      + + FH   KE+C ++  + Y  +K
Sbjct: 114 AMHFNTRYIETSKSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEVCDKYDSSYYPKFK 168

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIF+D+L+     G  + DF+F   VG   + +YP +VR  
Sbjct: 169 KQCDEYFYLKHRKEPRGVGGIFYDYLN----NGNFEQDFAFTQDVGKTLLSVYPEIVRSK 224

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
               ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 225 LFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 277


>gi|254462839|ref|ZP_05076255.1| coproporphyrinogen III oxidase, aerobic [Rhodobacterales bacterium
           HTCC2083]
 gi|206679428|gb|EDZ43915.1| coproporphyrinogen III oxidase, aerobic [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 297

 Score =  321 bits (823), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 162/305 (53%), Gaps = 17/305 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKE 68
              D++  K  + R F+ L+  I T F+ LE+        ++S   F V    R      
Sbjct: 1   MTSDMQAEKVQAARWFKTLRDDIVTAFQSLEDSHSVGPMNDKSAGAFEVTKTTRHSDDGT 60

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSV 122
           D GGG M+ +  G+VFEK  V +STV+G        +   +  I G  ++P FWA+G+S+
Sbjct: 61  DAGGGEMSVMRGGRVFEKVGVNISTVFGTLAPRAQAAMAARKGIEGMAEDPRFWASGISL 120

Query: 123 IVHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           + H  NPH PAVH N RM  T   +WFGGG DL P LE     Y+ D   FH T K    
Sbjct: 121 VAHMQNPHCPAVHMNTRMFWTPHAWWFGGGSDLNPCLE-----YEEDTEHFHKTQKVFLD 175

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H   +Y   K W D YF++PHR  +RG+GGIF D   +    G  DADF     +G  F
Sbjct: 176 PHGSEHYPALKAWADEYFFIPHRGRARGVGGIFMDDRCT----GNWDADFKLTQDIGRAF 231

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  L+ +     +SE D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+P
Sbjct: 232 LPAYQPLIEKRRVDDWSEADKDTQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLP 291

Query: 302 PLVAW 306
           PL  W
Sbjct: 292 PLAKW 296


>gi|15604710|ref|NP_221228.1| coproporphyrinogen III oxidase [Rickettsia prowazekii str. Madrid
           E]
 gi|13431558|sp|Q9ZC86|HEM6_RICPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|3861405|emb|CAA15304.1| COPROPORPHYRINOGEN III OXIDASE PRECURSOR (hemF) [Rickettsia
           prowazekii]
 gi|292572547|gb|ADE30462.1| Coproporphyrinogen III oxidase precursor [Rickettsia prowazekii
           Rp22]
          Length = 279

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 124/290 (42%), Positives = 174/290 (60%), Gaps = 16/290 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +       P  F    W R+       GG  +
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIE-EKYAQIKGLKPAKFVRTSWKRN------GGGCGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ S +F+ +ILG   +  F+ATG+SV+ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP         + +   FH   KE C ++  + Y  +K+ C
Sbjct: 117 FNTRYIETSKNWFGGGGDLTPFYPE-----ENETAKFHTAFKEACDKYDSSYYPKFKKQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   +G   + +YP +VR     
Sbjct: 172 DEYFYLRHRKEPRGVGGIFYDYLNS----GNFEQDFAFTKDIGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
            ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP+V 
Sbjct: 228 PWTAEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPVVK 277


>gi|78211955|ref|YP_380734.1| coproporphyrinogen III oxidase [Synechococcus sp. CC9605]
 gi|123578818|sp|Q3AMK3|HEM6_SYNSC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|78196414|gb|ABB34179.1| Coproporphyrinogen oxidase [Synechococcus sp. CC9605]
          Length = 362

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 106/328 (32%), Positives = 154/328 (46%), Gaps = 44/328 (13%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           + +    +  P    + +  ++     LQ  IC   E L+ E            F  + W
Sbjct: 15  VGVSNAPLELPP--SDSRERARAMVMGLQDQICAGLEALDGE----------GRFVEESW 62

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           +R +      GGGR   +  G+VFE+  V  S V G+  P    +     K   ++ATG 
Sbjct: 63  VRHEG-----GGGRSRVMREGRVFEQGGVNFSEVQGEELPPSILKQRPEAKGHPWFATGT 117

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP NP++P VH N R       +WFGGG DLTP        +  D   FH T +  
Sbjct: 118 SMVLHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLDDARHFHRTHQAA 172

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP----------------- 222
           C       +  +K WCD YFYL HR E+RG+GGIF+D+  ++                  
Sbjct: 173 CDSVHPDLHKVFKPWCDEYFYLKHRGETRGVGGIFYDYQDANGTLYKGQDPSGPAAQVSA 232

Query: 223 ----EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  FS   A G  F+  Y  +V + +   + +++R  QL RRGRY EFNL+
Sbjct: 233 SLGARPLSWEQLFSLGQANGRAFLPAYAPIVEKRHPMAYGDRERDFQLYRRGRYVEFNLV 292

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           +D+GT FG +T G  ESIL S+PPLV W
Sbjct: 293 WDRGTIFGLQTNGRTESILMSLPPLVRW 320


>gi|157965037|ref|YP_001499861.1| coproporphyrinogen III oxidase [Rickettsia massiliae MTU5]
 gi|157844813|gb|ABV85314.1| Coproporphyrinogen III oxidase precursor [Rickettsia massiliae
           MTU5]
          Length = 281

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 124/293 (42%), Positives = 177/293 (60%), Gaps = 17/293 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE  K I+   F NL+ ++C EFEK+E E  + +    P  F    W R+       GG
Sbjct: 4   NIEN-KEITSSWFTNLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRSSWQRN------GGG 55

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G + +L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +P
Sbjct: 56  GGVMSLMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIP 115

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           A+HFN R I T   WFGGG DLTP         + + + FH   KE C ++  + Y  +K
Sbjct: 116 AMHFNTRYIETSKSWFGGGGDLTPFYPE-----ENETVKFHAVFKEACDKYDSSYYPKFK 170

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYL HR+E RG+GGIF+D+L++       + DF+F   VG   + +YP +VR  
Sbjct: 171 KQCDEYFYLKHRKEPRGVGGIFYDYLNND----NFEQDFAFTQDVGKALLSVYPEIVRSK 226

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
               ++ + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 227 LFLPWTTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 279


>gi|71064799|ref|YP_263526.1| coproporphyrinogen III oxidase [Psychrobacter arcticus 273-4]
 gi|71037784|gb|AAZ18092.1| coproporphyrinogen oxidase [Psychrobacter arcticus 273-4]
          Length = 336

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 18/293 (6%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +    +LQ+ IC   E  E +   ++       F    W R      + GGGR   L 
Sbjct: 28  RVREFLVDLQARICQALEAQERDGCADA--HKAATFFPDDWER-----PEGGGGRSCVLA 80

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G+V EKA V+ S ++    P                A G+S++VHP NP+VP  H N+R
Sbjct: 81  DGEVIEKAGVMFSHIHVQNLPASATARHPDIAGRKAQAMGVSLVVHPKNPNVPTSHANVR 140

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           + +         +WFGGG DLTP           D I +H    ++C+      Y  +K+
Sbjct: 141 LFIAEAEGKDPIWWFGGGFDLTPFYP-----VLADCIHWHQVCHDLCAPFGDTVYPDFKQ 195

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YF+L HR E RGIGG+F+D +++       +  F F+ AVG+ +++    +  +  
Sbjct: 196 WCDEYFHLRHRDEQRGIGGLFYDDVNTESRGWDFETCFKFMQAVGNGYLEGILPIFEQRK 255

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  ++E  R+ QL RRGRY E+NL+YD+GT FG ++ G +ESIL SMPPL +W
Sbjct: 256 NAPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQSNGRIESILVSMPPLASW 308


>gi|196019265|ref|XP_002118953.1| hypothetical protein TRIADDRAFT_34987 [Trichoplax adhaerens]
 gi|190577575|gb|EDV18562.1| hypothetical protein TRIADDRAFT_34987 [Trichoplax adhaerens]
          Length = 276

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 125/296 (42%), Positives = 169/296 (57%), Gaps = 22/296 (7%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D    +KR++   F+ L+  IC EFEK+ENE   + +      F  K W RD     ++ 
Sbjct: 2   DKFSNKKRLASNWFKKLRDNICDEFEKIENEFGSSVS------FKRKKWDRDGGGGGEMS 55

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-GTTKNPYFWATGLSVIVHPYNPH 130
             R      G +FEK  V +STVYG  S  F  +I      N  FWA+G+S++ H  +PH
Sbjct: 56  IMR------GSIFEKVGVNISTVYGKFSDKFAKEIPGCENGNNNFWASGISLVAHMNSPH 109

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           +PAVHFN RMIVT   WFGGG DLTP   +       D   FH   K  C +     Y  
Sbjct: 110 IPAVHFNTRMIVTTKQWFGGGGDLTPVFPNNA-----DTELFHKHFKIACDKFDKNYYPR 164

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K+ CD YFYLPHR+E RG+GG+F+D+L+S    G  + DF F   +G  F K + S+++
Sbjct: 165 FKKNCDEYFYLPHRKEPRGVGGVFYDYLNS----GNWEKDFEFTKEIGVQFKKAFFSIIK 220

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RN    +++ ++  QL +RGRY EFNLLYD+GT FG  T GN E+IL SMPP+  W
Sbjct: 221 RNIMKKWTKVEKSIQLQKRGRYVEFNLLYDRGTKFGLMTNGNTEAILMSMPPMATW 276


>gi|332705259|ref|ZP_08425340.1| coproporphyrinogen oxidase [Lyngbya majuscula 3L]
 gi|332356002|gb|EGJ35461.1| coproporphyrinogen oxidase [Lyngbya majuscula 3L]
          Length = 344

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 110/312 (35%), Positives = 147/312 (47%), Gaps = 43/312 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +   ++  + LQ  IC    K++              F    W RD+      GGGR   
Sbjct: 23  RERVKQLMQQLQDTICDALVKVDG----------IGTFREDKWDRDEG-----GGGRSRV 67

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G V E+  V  S V+G   P    +         F+ATG S+++HP NP+VP VH N
Sbjct: 68  IRDGSVLEQGGVNFSEVWGKQLPPSILKQRPEAAGHGFFATGTSLVLHPRNPYVPTVHLN 127

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGGIDLTP        +  D    H  LKE C  H    Y  +K WCD
Sbjct: 128 YRYFEAGPVWWFGGGIDLTPYYP-----FAEDAAHLHRQLKEACDAHHPEYYPVFKSWCD 182

Query: 197 RYFYLPHRQESRGIGGIFFDHLHS----------------------SPEMGGIDADFSFI 234
            YFYL HRQE RG+GG+FFD+                           E    +  F+F+
Sbjct: 183 EYFYLKHRQEMRGVGGLFFDYQDGTGKLYRGPHQDGPAAAYSEKLGDLEPRSWEDLFAFV 242

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVE 294
           +   + F+  Y  +V R     + +++R  QL RRGRY EFNL+YD+GT FG +T G  E
Sbjct: 243 TTCSEAFLPAYLPIVERRRDMDYGDRERNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTE 302

Query: 295 SILASMPPLVAW 306
           SIL S+PPLV W
Sbjct: 303 SILMSLPPLVRW 314


>gi|318042593|ref|ZP_07974549.1| coproporphyrinogen III oxidase [Synechococcus sp. CB0101]
          Length = 361

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 109/311 (35%), Positives = 152/311 (48%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ++ ++     LQ  IC   E+L+              F  + W+R      + GGGR   
Sbjct: 29  RQRAKALLMGLQDSICAGLEQLDG----------TGRFAEESWVR-----PEGGGGRSRV 73

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V G   P          K   ++ATG S+++HP NP++P VH N
Sbjct: 74  MKGGRVFEQGGVNFSEVEGSELPPSILSQRPEAKGHRWFATGTSMVLHPRNPYIPTVHLN 133

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH+TLK  C     + Y  +K WCD
Sbjct: 134 YRYFEAGPVWWFGGGADLTPYYP-----FLEDAKHFHSTLKGACDSVNPSFYEVFKPWCD 188

Query: 197 RYFYLPHRQESRGIGGIFFDHLHS---------------------SPEMGGIDADFSFIS 235
            YFYL HR E+RG+GGIF+D+                          +    +  F+  S
Sbjct: 189 EYFYLKHRDETRGVGGIFYDYQDPRGVLYKGQNPAGPAAAAGQRVGAQPQSWEQLFALAS 248

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G+ F+  Y  +  +  H  + E++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 249 ACGNAFLPSYAPIAEKRQHTPYGERERQFQLYRRGRYVEFNLVFDRGTIFGLQTNGRTES 308

Query: 296 ILASMPPLVAW 306
           IL S+PPLV W
Sbjct: 309 ILMSLPPLVRW 319


>gi|89069763|ref|ZP_01157099.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
 gi|89044709|gb|EAR50820.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
          Length = 296

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 113/300 (37%), Positives = 159/300 (53%), Gaps = 16/300 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           ++  K  +   F  L+  I   FE LE        + R+   F ++  +R      + GG
Sbjct: 5   MQSEKARAAAWFRTLRDEIVAAFEALEQSHTDGPLSERAAGRFELRETVRRADDGSEAGG 64

Query: 73  GRMATLCAGKVFEKAAVLVSTVYG-----DLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
           G M+ L  G+VFEK  V VSTV+G              + G   +P FWA+G+S++ H  
Sbjct: 65  GLMSVLREGRVFEKVGVNVSTVHGTLGAAAQGAMAARGVPGIEDDPSFWASGISLVAHMQ 124

Query: 128 NPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPH PAVH N RM  T  A+WFGGG DL P+L       + D   FH  L+   + H   
Sbjct: 125 NPHAPAVHMNTRMFWTPGAWWFGGGADLNPALP-----VEADTEHFHAELERHVAPHGEG 179

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y   K W D YF++PHR  +RG+GGIF D  +S    G  +ADF+ +  +G  F+  + 
Sbjct: 180 LYPELKAWADEYFFIPHRGRARGVGGIFMDDRNS----GDWEADFALVQDIGRAFLPAFL 235

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L  R     F++ DR+ QLI RG YAE+NL+YD+GT FG  TG + +++L S+PPL  W
Sbjct: 236 PLAERRRATPFTDADREAQLIHRGLYAEYNLVYDRGTKFGLATGHDPDAVLMSLPPLAKW 295


>gi|294635470|ref|ZP_06713957.1| coproporphyrinogen III oxidase [Edwardsiella tarda ATCC 23685]
 gi|291091166|gb|EFE23727.1| coproporphyrinogen III oxidase [Edwardsiella tarda ATCC 23685]
          Length = 306

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 149/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  +C +    +  A           F    W R +      GGGR   L
Sbjct: 6   DAVRHFLLQLQDDLCQQLAAADGGA----------TFQQDEWQRAQG-----GGGRTRVL 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S + GD  P              F A G+S+++HP++P+VP  H N+
Sbjct: 51  RQGALFEQAGVNFSHIRGDSLPAAASAQRPELAGCAFQAMGVSLVLHPWSPYVPTAHANV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R            +WFGGG DLTP        +  DV+ +H   +++C       Y  YK
Sbjct: 111 RFFSAERPDGSSLWWFGGGFDLTPFYP-----FHEDVVHWHRQARDLCQPFDAQYYPRYK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCDRYF LPHRQE+RG+GG+FFD L++          F+F  AVG+ F   Y  +V R 
Sbjct: 166 AWCDRYFSLPHRQEARGVGGLFFDDLNTP----DFAHAFAFTRAVGNGFCPAYLPIVERR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 222 RALPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRSESILMSMPPLVRW 275


>gi|51474050|ref|YP_067807.1| coproporphyrinogen III oxidase [Rickettsia typhi str. Wilmington]
 gi|81610738|sp|Q68VN1|HEM6_RICTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|51460362|gb|AAU04325.1| Coprogen oxidase [Rickettsia typhi str. Wilmington]
          Length = 279

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 122/290 (42%), Positives = 174/290 (60%), Gaps = 16/290 (5%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           E K I+   F NL+ ++C EFEK+E E +       P  F    W R+       GG  +
Sbjct: 4   ENKEITSNWFTNLRDLLCKEFEKIE-EKYAQIKGLKPAKFVRTSWKRN------GGGCGI 56

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
            +L  G+VFEK  V +STV+G+ S +F+ +ILG   +  F+ATG+SV+ H  +P +PA+H
Sbjct: 57  MSLMKGEVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMH 116

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           FN R I T   WFGGG DLTP         + +   FH   KE C ++  + Y  +K  C
Sbjct: 117 FNTRYIETSKNWFGGGSDLTPFYPE-----ENETAKFHTAFKEACDKYDSSYYPKFKRQC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   +G   + +YP +VR     
Sbjct: 172 DEYFYLRHRKEPRGVGGIFYDYLNS----GNFEQDFAFTRDIGKALLSVYPEIVRSKLFL 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
            ++++ ++ QLI+RGRY EFNLLYD+GT FG  T GN+E+IL S+PP+V 
Sbjct: 228 PWTDEQKEYQLIKRGRYVEFNLLYDRGTKFGLMTDGNIEAILMSLPPVVK 277


>gi|88811390|ref|ZP_01126645.1| coproporphyrinogen III oxidase [Nitrococcus mobilis Nb-231]
 gi|88791279|gb|EAR22391.1| coproporphyrinogen III oxidase [Nitrococcus mobilis Nb-231]
          Length = 307

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 152/296 (51%), Gaps = 29/296 (9%)

Query: 17  RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
           R    +    +LQ  IC      ++         +   F    W R++      GGGR  
Sbjct: 5   RPAAVKSYLLDLQDRICEAISAEDD---------ATARFHEDPWSREEG-----GGGRSR 50

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHF 136
            LC G  FE+A +  S VYG   PD             + A G+S++VHP NP VP  H 
Sbjct: 51  VLCEGVTFEQAGINFSHVYGSALPDTASARRPELAGRCYQAMGVSLVVHPRNPFVPISHA 110

Query: 137 NIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           N+R            +WFGGG DLTP      + YD DV+ +H + K  C  +    Y  
Sbjct: 111 NVRFFLAEKPGEAPVWWFGGGFDLTPC-----YGYDEDVLHWHQSAKAACDPYDERFYPR 165

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +K WCD YFYLPHR E RG+GG+FFD         G +  F F+ +VG+ F++ Y  +VR
Sbjct: 166 FKAWCDEYFYLPHRNEPRGVGGLFFDDF----TGAGFEHAFGFMRSVGNGFLQAYLPIVR 221

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     + E++R+ QL RRGRY EFNLL+D+GT FG  +GG  ESIL S+PPLV W
Sbjct: 222 RRKSTDYGERERRFQLYRRGRYVEFNLLFDRGTRFGIHSGGRAESILMSLPPLVRW 277


>gi|217979901|ref|YP_002364048.1| coproporphyrinogen III oxidase [Methylocella silvestris BL2]
 gi|217505277|gb|ACK52686.1| Coproporphyrinogen oxidase [Methylocella silvestris BL2]
          Length = 298

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 141/297 (47%), Positives = 185/297 (62%), Gaps = 10/297 (3%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSA--NRSPKIFTVKHWLRDKSQKEDLGG 72
           E R+  ++  FE+LQ  I   FE LE++A    A  + +P  F    W ++       GG
Sbjct: 8   ERRRTEARAWFESLQQKIIKAFESLEDDAAGPFARPDMAPGRFVQTPWQKETG-----GG 62

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G MA L  G+VFEK AV  STV+G  +P+F  QI G   +  +WA+G+S+I HP+NP+VP
Sbjct: 63  GLMAVLK-GRVFEKMAVHTSTVFGSFAPEFAAQIPGADADSRYWASGVSLIAHPWNPNVP 121

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV-ANYTHY 191
            VH N R + T   WFGGG DLTP L+ RR   D D + FH  +   C+     A+Y  +
Sbjct: 122 CVHMNTRFVETSKAWFGGGADLTPVLDRRRTQTDLDTVDFHAAMAGACAGFEPVADYPRF 181

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE-MGGIDADFSFISAVGDCFIKLYPSLVR 250
           K WCD YF+L HR E RG+GGIF+D+L   P+     +  F+F  AVG  F  +YP L R
Sbjct: 182 KTWCDDYFFLKHRNEMRGVGGIFYDYLECPPDDAESFNKSFAFTKAVGLAFADIYPKLAR 241

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP 307
           RN+   F+E DR EQL+RRGRY EFNLLYD+GT FG KTGGNVE+IL+S+PP+  WP
Sbjct: 242 RNFDLSFTEADRHEQLVRRGRYVEFNLLYDRGTVFGLKTGGNVEAILSSLPPMAEWP 298


>gi|33863973|ref|NP_895533.1| coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9313]
 gi|41017128|sp|Q7V568|HEM6_PROMM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33635557|emb|CAE21881.1| Coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9313]
          Length = 349

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 108/311 (34%), Positives = 147/311 (47%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ++ ++     LQ  IC E E L+              F    W R      + GGGR   
Sbjct: 17  RKRARELVLGLQDEICNELESLDGGQS----------FRTDSWER-----PEGGGGRSKV 61

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V+G+  P          K   ++ATG S+++HP NP+VP +H N
Sbjct: 62  MREGRVFEQGGVNFSEVHGEELPPSILNQRPEAKGHPWFATGTSMVLHPRNPYVPTIHLN 121

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        Y  D   FH   K+ C       +  +K WCD
Sbjct: 122 YRYFEAGPVWWFGGGADLTPFYP-----YLEDARHFHRVHKQACDTVGPELHKVFKPWCD 176

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSS---------------------PEMGGIDADFSFIS 235
            YFYL HR E+RG+GGIF+D+   S                     P     +  F    
Sbjct: 177 EYFYLKHRGETRGVGGIFYDYQDGSGVLYKGQNSEGPAAQVSRELGPHPKSWEQLFELAK 236

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  +V +     + +++RQ QL RRGRYAEFNL++D+GT FG +T G  ES
Sbjct: 237 ACGKAFLPAYVPIVEKRQEQAYGDRERQFQLYRRGRYAEFNLVWDRGTIFGLQTNGRTES 296

Query: 296 ILASMPPLVAW 306
           IL S+PPL  W
Sbjct: 297 ILMSLPPLARW 307


>gi|289664683|ref|ZP_06486264.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 299

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  + +A           F    W R++      GGGR   L
Sbjct: 5   DRVRDFLTDLQDRICAAVEDADGKA----------RFAEDLWKREEG-----GGGRTRIL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP+NP++P  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPYIPTTHMNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV  +H   + +C       Y  +K
Sbjct: 110 RYFRAEHDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCEPFGEERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  +V+R 
Sbjct: 165 RWCDEYFFLRHRNETRGVGGLFFDDL-----GKEFERDFAYQQAVGNGFLDAYMPIVQRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 220 KATPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|198284017|ref|YP_002220338.1| coproporphyrinogen III oxidase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666394|ref|YP_002426661.1| coproporphyrinogen III oxidase, aerobic [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248538|gb|ACH84131.1| Coproporphyrinogen oxidase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518607|gb|ACK79193.1| coproporphyrinogen III oxidase, aerobic [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 296

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 142/289 (49%), Gaps = 26/289 (8%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  +  A           F    W R        GGGR   +
Sbjct: 7   DEMENFLRGLQDRICNALEAADGAA----------KFREDLWER-----PGGGGGRTRVI 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + EK  V  S V+GD  P              F A G+S+++H  NP+VP VH N 
Sbjct: 52  ADGALLEKGGVNFSKVHGDQLPPSATAHRPELAGQTFTALGISLVLHSRNPYVPIVHMNY 111

Query: 139 RMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
           R       +WFGGG DLTP      + ++ D   FH  LK  C +H    Y  +K WCD 
Sbjct: 112 RFFSAGPVWWFGGGADLTPI-----YGFEEDARHFHGILKTACDRHDPGFYPRFKTWCDD 166

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YF + HRQE RGIGGIFFD LH     G      +F   + + F+  Y  +V R     +
Sbjct: 167 YFTIRHRQEMRGIGGIFFDDLH-----GDAGLLQAFWEDMANSFLDSYLPIVARRRDLAY 221

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E++RQ QL+RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPL AW
Sbjct: 222 GERERQFQLLRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLAAW 270


>gi|153871109|ref|ZP_02000362.1| Coproporphyrinogen 3 oxidase, aerobic [Beggiatoa sp. PS]
 gi|152072425|gb|EDN69638.1| Coproporphyrinogen 3 oxidase, aerobic [Beggiatoa sp. PS]
          Length = 302

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
            + +     LQ  +CT F + + +                        +E  GGGR   L
Sbjct: 7   ELVKNYLLTLQEHLCTAFAEEDGKQQFQQDQWQ---------------REQGGGGRSRVL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V+G   P              F A G+S+++HP NP++P  H N+
Sbjct: 52  SNGAVFEQAGVNFSQVHGTKLPASATAQRPELAGRSFQAMGISLVIHPLNPYIPTSHANL 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ DVI +H T K  C       Y  YK
Sbjct: 112 RFFIAEKSDQEPIWWFGGGFDLTPY-----YGFEEDVIHWHRTAKAACDPFGKDIYARYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GG+FFD L+      G D  F+F+ ++GD ++  Y  +V++ 
Sbjct: 167 DWCDNYFFLKHRNEPRGVGGLFFDDLNQW----GFDTCFAFMRSIGDHYLAAYLPIVKKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 223 KSLSYGERERDFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVKW 276


>gi|326387117|ref|ZP_08208727.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208298|gb|EGD59105.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 293

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 132/290 (45%), Positives = 173/290 (59%), Gaps = 14/290 (4%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKE-DLGGGRMAT 77
             ++  FE+L+  IC  FE +E EA  ++       FT   W R+ + +  + GGG +  
Sbjct: 15  ARARVWFESLRDRICAAFEAIEREAGSDAC------FTYTPWNREHAGEPVENGGGGVQG 68

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTK-NPYFWATGLSVIVHPYNPHVPAVHF 136
           L  GKVFEK  V VSTV G  SP+F   I G    NP F ATG+S++ H  NPHVPAVH 
Sbjct: 69  LMKGKVFEKVGVNVSTVGGVFSPEFARTINGADPENPTFTATGISLVAHMANPHVPAVHM 128

Query: 137 NIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
           N R + T   WFGGG DL P +      YD D   FH   K  C  H    Y  +K W D
Sbjct: 129 NTRFLTTRKAWFGGGGDLNPPIP-----YDEDTAEFHAAFKAACDAHDEGYYPRFKAWAD 183

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFY+PHR+  RG+GGIF+DHL     M G +A+F+F   VG+ F+ ++P LVRR     
Sbjct: 184 DYFYIPHRRVHRGVGGIFYDHLECPD-MDGFEANFAFTRDVGEAFLDVFPRLVRRRMGMP 242

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           F+E ++ +QL+ RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 243 FTEAEKHQQLVWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEAIW 292


>gi|291618330|ref|YP_003521072.1| HemF [Pantoea ananatis LMG 20103]
 gi|291153360|gb|ADD77944.1| HemF [Pantoea ananatis LMG 20103]
 gi|327394721|dbj|BAK12143.1| coproporphyrinogen III oxidase HemF [Pantoea ananatis AJ13355]
          Length = 304

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 114/293 (38%), Positives = 152/293 (51%), Gaps = 30/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +    +LQ  IC +    +  AH          F    W R        GGGR   L 
Sbjct: 6   RVKTFLLDLQDEICRKLTAEDGGAH----------FIEDSWQR-----PGGGGGRSRVLR 50

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFE+A V  S V+GD  P              F A G+S+++HP+NP+VP  H N+R
Sbjct: 51  DGAVFEQAGVNFSHVHGDQMPASATAHRPELAGCSFEAMGVSLVIHPHNPYVPTSHANVR 110

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
             +         +WFGGG D+TP      + ++ D + +H T  ++C       Y  +K+
Sbjct: 111 FFIAEKPGAEPIWWFGGGFDMTPF-----YGFEEDALHWHQTAFDLCQPFGEDVYPRFKK 165

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR E RGIGG+FFD +H      G +  F+ I AVG  F+  Y  +V R  
Sbjct: 166 WCDDYFYLKHRDEQRGIGGLFFDDVHLP----GFEKSFALIQAVGRGFLDAYQPIVARRK 221

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              F E++RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 222 SLPFGERERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPLVRW 274


>gi|284006779|emb|CBA72044.1| Coproporphyrinogen III oxidase, aerobic [Arsenophonus nasoniae]
          Length = 302

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 152/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  +C + E ++N A           F  + W       +  GGGR   L
Sbjct: 7   NAVKAFLLTLQDKLCQQLEHVDNNA----------KFAEQSWQ-----HKHKGGGRSRIL 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G +FE+A V  S + G   P    +         + A G+S++ HP NP++P  H N+
Sbjct: 52  KHGTIFEQAGVNFSHISGKQLPASASENRPLLAGRRYQAMGVSLVTHPLNPYIPTAHANV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D+I +H T + +C  +    Y HYK
Sbjct: 112 RFFIAEKPGEPSIWWFGGGFDLTPY-----YGFEEDIIHWHKTAQSVCLPYGKEIYPHYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCDRYF++ HR E RG+GG+FFD L+           F F   VG+ F+  Y  +V + 
Sbjct: 167 KWCDRYFFIEHRNEPRGVGGLFFDDLNQP----DFTTCFHFAQDVGNGFLNAYLPIVEKR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++RQ QL RRGRYAEFNL+ D+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 KEIAWGERERQFQLYRRGRYAEFNLVCDRGTLFGLQTGGRTESILMSLPPLVRW 276


>gi|239946625|ref|ZP_04698378.1| coproporphyrinogen III oxidase, aerobic [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239920901|gb|EER20925.1| coproporphyrinogen III oxidase, aerobic [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 314

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 122/288 (42%), Positives = 174/288 (60%), Gaps = 16/288 (5%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           + I+   F +L+ ++C EFEK+E E  + +    P  F    W R+       GGG + +
Sbjct: 41  REITSSWFTDLRDLLCKEFEKIEEEYAQ-TKGLKPAKFVRTSWQRN------GGGGGVMS 93

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           L  G+VFEK  V +STV+G+ SP+F+ +I G   +  F+ATG+S++ H  +P +PA+HFN
Sbjct: 94  LMKGEVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMHFN 153

Query: 138 IRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
            R I T   WFGGG DLTP         + +   FH   KE C ++  + Y  +K+ CD 
Sbjct: 154 TRYIETSKSWFGGGGDLTPFYPE-----ENETAKFHAAFKEACDKYDSSYYPKFKKQCDE 208

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFYL HR+E RG+GGIF+D+L+S    G  + DF+F   VG   + +YP +VR      +
Sbjct: 209 YFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFAFTQDVGKALLSVYPEIVRSKLFLPW 264

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           + + ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V 
Sbjct: 265 TTEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVK 312


>gi|159904243|ref|YP_001551587.1| coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9211]
 gi|159889419|gb|ABX09633.1| Coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9211]
          Length = 375

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 106/311 (34%), Positives = 150/311 (48%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           ++ ++    +LQ  IC   E ++ E            F  + W R      + GGGR   
Sbjct: 43  RQRAKELVLSLQDQICNGLEAVDGE----------GTFKEETWER-----PEGGGGRSRV 87

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+V E+  V  S V G   P          K   ++ATG S+++HP NP++P VH N
Sbjct: 88  MSEGRVLEQGGVNFSEVQGQELPPSIINQRPEAKGHPWFATGTSMVLHPKNPYIPTVHLN 147

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        Y  D   FH TL++ C       +  +K WCD
Sbjct: 148 YRYFEAGPVWWFGGGADLTPYYP-----YLSDTKHFHKTLQQACDSINPLLHKVFKPWCD 202

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSP---------------------EMGGIDADFSFIS 235
            YF+L HR E+RG+GGIFFD+   S                           +  F+   
Sbjct: 203 EYFFLKHRNETRGVGGIFFDYQDGSGNLYKGQDPKGPAAKIANELGKHPMNWEELFALAK 262

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G+ F+  Y  ++ +  +  F+E++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 263 ACGNAFLPSYIPIIEKRQNQSFTERERQFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTES 322

Query: 296 ILASMPPLVAW 306
           IL S+PPL  W
Sbjct: 323 ILMSLPPLARW 333


>gi|289164657|ref|YP_003454795.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           longbeachae NSW150]
 gi|288857830|emb|CBJ11676.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           longbeachae NSW150]
          Length = 314

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC+  E L+ +A           F    W R        GGG    L
Sbjct: 18  EQVKTYLLKLQNTICSRLENLDGQAQ----------FIDDAWQR-----SAGGGGITRVL 62

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G   P              F A G+S+++HP NP+VP  H N+
Sbjct: 63  SQGLVFEKAGVNFSHVSGANLPSSASAHRPELTGRNFNALGVSLVIHPDNPYVPTSHANV 122

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG+DLTP      + ++ D   +H T  E C     + Y  +K
Sbjct: 123 RFFIAEKEDADPVWWFGGGVDLTPY-----YGFEEDCRHWHQTALEACQPFGQSIYPKFK 177

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD  +        D  FS + ++G+ +I+ Y  +V R 
Sbjct: 178 KWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFSLMQSIGNHYIEAYAPIVTRR 233

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H + E+++  Q  RRGRY EFNL+YD+GT FG ++ G  ESIL S+PP V W
Sbjct: 234 KSHPYGEREKTFQKYRRGRYVEFNLVYDRGTLFGLQSNGRTESILMSLPPEVTW 287


>gi|33866572|ref|NP_898131.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 8102]
 gi|33633350|emb|CAE08555.1| Coproporphyrinogen III oxidase [Synechococcus sp. WH 8102]
          Length = 388

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 110/327 (33%), Positives = 153/327 (46%), Gaps = 42/327 (12%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           N  T         E+ +  ++     LQ  IC   E L+ E            F  + W 
Sbjct: 40  NNGTAAPALELPPEDSRARARAMVMGLQDEICAGLESLDGE----------GTFVEESWE 89

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R      + GGGR   +  G VFE+  V  S V G   P    +     K   ++ATG S
Sbjct: 90  R-----PEGGGGRSRVMREGLVFEQGGVNFSEVQGQELPPSILKQRPEAKGHPWFATGTS 144

Query: 122 VIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP+NP++P VH N R       +WFGGG DLTP        +  D   FH T +  C
Sbjct: 145 MVLHPHNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLEDARHFHRTHQAAC 199

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP------------------ 222
                  +  +K WCD YF+L HR E+RG+GGIF+D+  SS                   
Sbjct: 200 DSVHPDLHKVFKPWCDEYFFLKHRGETRGVGGIFYDYQDSSGVLYKGQDPSGPAAGVSAQ 259

Query: 223 ---EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
                 G +  F+   A G  F+  Y  +V + +   + +++RQ QL RRGRY EFNL++
Sbjct: 260 LGARPLGWEQLFALGQANGRAFLPSYAPIVEKRHPMAYGDRERQFQLYRRGRYVEFNLVW 319

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 320 DRGTIFGLQTNGRTESILMSLPPLVRW 346


>gi|330881840|gb|EGH15989.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 269

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 109/293 (37%), Positives = 145/293 (49%), Gaps = 30/293 (10%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +  R    +    +LQ  ICT  E+ +  AH          F    W R        GGG
Sbjct: 1   MSTRTEAVKAYLLDLQDRICTALEQEDGNAH----------FVEDAWTR-----PAGGGG 45

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   +  G V EK  V  S V+G   P              F A G+S+++HP+NPHVP 
Sbjct: 46  RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPT 105

Query: 134 VHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVAN 187
            H N+R  +         +WFGGG DLTP      +  + D + +H   +  C+      
Sbjct: 106 SHANVRFFIAEKEGEEPVWWFGGGFDLTPY-----YGVEEDCVHWHRVAERACAPFGDDV 160

Query: 188 YTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS 247
           Y  YK WCD YF+L HR E RGIGG+FFD ++        D  F+FI A+GD FI  Y  
Sbjct: 161 YPRYKAWCDSYFHLKHRDEPRGIGGLFFDDVNQW----DFDTSFAFIRAIGDAFINAYLP 216

Query: 248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           +VRR     ++ Q R+ Q  RRGRY EFNL+YD+GT FG ++GG  ESIL S+
Sbjct: 217 IVRRRKAAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSL 269


>gi|325983026|ref|YP_004295428.1| Coproporphyrinogen oxidase [Nitrosomonas sp. AL212]
 gi|325532545|gb|ADZ27266.1| Coproporphyrinogen oxidase [Nitrosomonas sp. AL212]
          Length = 298

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 104/293 (35%), Positives = 144/293 (49%), Gaps = 31/293 (10%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +    NLQ  I    E+++ +            F    W R      + GGG  + + 
Sbjct: 5   RIKEFLINLQHSIVNGLEQVDGKM-----------FKQDQWDR-----PEGGGGMSSVIE 48

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G V E+  V  S VYG   P              F A G+S+++HP NP+ P VH N+R
Sbjct: 49  EGNVLERGGVNFSHVYGAGLPASATAARPELAGRSFEAMGVSLVLHPRNPYAPTVHMNVR 108

Query: 140 MIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
                       +WFGGG+DLTP      + Y+ D I FH T K+         Y  +K+
Sbjct: 109 YFEARKDGAEPVWWFGGGMDLTPY-----YGYEEDAIHFHQTCKQALQPFGDDYYPRFKK 163

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
           WCD YFYL HR+E RGIGG+FFD L+        D+ F  +  V + F+  Y  ++ +  
Sbjct: 164 WCDEYFYLKHRKEPRGIGGVFFDDLNQP----DFDSCFKLMRNVSENFLNAYRPILEKRK 219

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              + E +R  Q  RRGRY EFNL++D+GT FG +TGG  ESIL S+PP+V W
Sbjct: 220 DTPYGENERDFQAYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPPIVRW 272


>gi|91206195|ref|YP_538550.1| coproporphyrinogen III oxidase [Rickettsia bellii RML369-C]
 gi|122425139|sp|Q1RGQ3|HEM6_RICBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91069739|gb|ABE05461.1| Coproporphyrinogen III oxidase precursor [Rickettsia bellii
           RML369-C]
          Length = 279

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 122/293 (41%), Positives = 169/293 (57%), Gaps = 18/293 (6%)

Query: 16  ERKRI--SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
            +K    +   F NL+ ++C EFEK+E E  + +    P  F    W RD      +   
Sbjct: 2   NKKNREVTSSWFTNLRDLVCAEFEKIEEEYAK-AKGLKPGKFVRSSWERDGGGGGVMS-- 58

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               +  GKVFEK  V +STV+G+ S  F+ +I G   +  F+ATG+S++ H  +P +PA
Sbjct: 59  ----VMKGKVFEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPA 114

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +HFN R I T   WFGGG DLTP         + +   FH   KE C ++    Y  +K+
Sbjct: 115 MHFNTRYIETSKNWFGGGGDLTPFYPE-----EDETAKFHAAFKEACDKYDSGYYPKFKK 169

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
            CD YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR   
Sbjct: 170 QCDEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGKALLSVYPEIVRNKL 225

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++++ ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 226 FLPWTDEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKW 278


>gi|289670805|ref|ZP_06491880.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 299

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 106/292 (36%), Positives = 147/292 (50%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  IC   E  + +A           F    W R++      GGGR   L  
Sbjct: 7   VRDFLTDLQDRICAAVEDADGKA----------RFAEDLWKREEG-----GGGRTRILRD 51

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+A +  S V G   P              + A G+S++ HP+NP++P  H N+R 
Sbjct: 52  GAVFEQAGIGFSDVSGTRLPPSASAHRPELAGATWRACGVSLVFHPHNPYIPTTHMNVRY 111

Query: 141 IVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
                       WFGGG DLTP        +D DV  +H   + +C       Y  +K W
Sbjct: 112 FRAEHDGEVVAAWFGGGFDLTPFYP-----FDEDVQHWHRVAQALCEPFGEERYAAHKRW 166

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HR E+RG+GG+FFD L         + DF++  AVG+ F+  Y  +V+R   
Sbjct: 167 CDEYFFLRHRNETRGVGGLFFDDL-----GKEFERDFAYQQAVGNGFLDAYMPIVQRRKA 221

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R+ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PP V W
Sbjct: 222 TPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRAESILMSLPPRVRW 273


>gi|163745166|ref|ZP_02152526.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
 gi|161381984|gb|EDQ06393.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
          Length = 293

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 114/304 (37%), Positives = 160/304 (52%), Gaps = 19/304 (6%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
             D+++++K  +   F  L+  I   F  +E              F V +  R      D
Sbjct: 1   MTDNMQDQKTCAADWFRKLRDDIVQAFHDIEARHVG---EEEAGRFVVSNTTRTAPDGSD 57

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVI 123
            GGG M+ +  G+VFEK  V +STVYG       ++   +  + G   +P FWA+G+S++
Sbjct: 58  AGGGEMSVMRGGRVFEKVGVNISTVYGTLGERAQVAMAARKGLPGMADDPRFWASGISLV 117

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH  +K  C  
Sbjct: 118 AHMQNPHVPAVHMNTRMFWTPHAWWFGGGADLNPCIE-----YDEDTAHFHAEMKGACDP 172

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y   K W D YFY+PHR+ +RG+GGIF+D  +S    G   ADF+    VG  F+
Sbjct: 173 HGATLYDELKAWADEYFYIPHRKRARGVGGIFYDDRNS----GDWAADFALTQDVGRAFL 228

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             Y  LV +     +   D+  QL  RG YAE+NL+YD+GT FG +TG + +++L S+PP
Sbjct: 229 PAYVPLVDKRREMDWDMDDKDVQLRHRGLYAEYNLVYDRGTKFGLETGHDPDAVLMSLPP 288

Query: 303 LVAW 306
           +  W
Sbjct: 289 MAKW 292


>gi|41017117|sp|Q7U4M7|HEM6_SYNPX RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
          Length = 363

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 110/327 (33%), Positives = 153/327 (46%), Gaps = 42/327 (12%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
           N  T         E+ +  ++     LQ  IC   E L+ E            F  + W 
Sbjct: 15  NNGTAAPALELPPEDSRARARAMVMGLQDEICAGLESLDGE----------GTFVEESWE 64

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R      + GGGR   +  G VFE+  V  S V G   P    +     K   ++ATG S
Sbjct: 65  R-----PEGGGGRSRVMREGLVFEQGGVNFSEVQGQELPPSILKQRPEAKGHPWFATGTS 119

Query: 122 VIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           +++HP+NP++P VH N R       +WFGGG DLTP        +  D   FH T +  C
Sbjct: 120 MVLHPHNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLEDARHFHRTHQAAC 174

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP------------------ 222
                  +  +K WCD YF+L HR E+RG+GGIF+D+  SS                   
Sbjct: 175 DSVHPDLHKVFKPWCDEYFFLKHRGETRGVGGIFYDYQDSSGVLYKGQDPSGPAAGVSAQ 234

Query: 223 ---EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLY 279
                 G +  F+   A G  F+  Y  +V + +   + +++RQ QL RRGRY EFNL++
Sbjct: 235 LGARPLGWEQLFALGQANGRAFLPSYAPIVEKRHPMAYGDRERQFQLYRRGRYVEFNLVW 294

Query: 280 DKGTNFGFKTGGNVESILASMPPLVAW 306
           D+GT FG +T G  ESIL S+PPLV W
Sbjct: 295 DRGTIFGLQTNGRTESILMSLPPLVRW 321


>gi|257454403|ref|ZP_05619665.1| coproporphyrinogen III oxidase, aerobic [Enhydrobacter aerosaccus
           SK60]
 gi|257448169|gb|EEV23150.1| coproporphyrinogen III oxidase, aerobic [Enhydrobacter aerosaccus
           SK60]
          Length = 333

 Score =  318 bits (816), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 105/298 (35%), Positives = 150/298 (50%), Gaps = 15/298 (5%)

Query: 19  RISQRKFENLQSIICTEFEKLE--NEAHENSANRSPKIFTVKHWLRD--KSQKEDLGGGR 74
           +  +    +LQ  IC   E  E     +  +   S   F    W R   +   ++LGGGR
Sbjct: 11  QAVRAYLLDLQDRICQALEHQEATGGFNLYAEGASNAKFVADVWERPAEQGTHQNLGGGR 70

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAV 134
              L  GKV EK  V+ S +  +  P                A G+S+++HP NP+VP  
Sbjct: 71  SNVLQGGKVIEKGGVMFSHIVINHLPATATARHPELAGRQAQALGVSLVIHPTNPNVPTS 130

Query: 135 HFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           H N+RM +         +WFGGG DLTP           D + +H    ++C+      Y
Sbjct: 131 HANVRMFIAEKEGYEPIWWFGGGFDLTPFYP-----VMEDCVHWHQVCHDLCAPFGSDVY 185

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K WCD YFYL HR E RGIGG+F+D L++       D  F+F+ AVG+ +++    +
Sbjct: 186 PKFKAWCDEYFYLKHRNEQRGIGGLFYDDLNTLSMGWDFDKCFAFMQAVGNGYLEGIIPI 245

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             +  H  +SE  R  QL RRGRY E+NL+YD+GT FG ++ G +ESIL S+PPL  W
Sbjct: 246 FEKRKHTRYSESQRNFQLYRRGRYVEYNLVYDRGTLFGLQSNGRIESILVSLPPLTGW 303


>gi|126668172|ref|ZP_01739133.1| coproporphyrinogen III oxidase [Marinobacter sp. ELB17]
 gi|126627321|gb|EAZ97957.1| coproporphyrinogen III oxidase [Marinobacter sp. ELB17]
          Length = 306

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  +C      +              F    W R +      GGG    +
Sbjct: 8   QAVKHYLLQLQDTLCQRLAVTDG----------GGEFIHDAWDRVEG-----GGGISRVI 52

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
            +GKVFEK  V  S V G+  P              + A GLS+++HP+NPHVP  H N+
Sbjct: 53  GSGKVFEKGGVNFSHVMGNTMPPSATAHRPHLAGAPWQAMGLSLVMHPHNPHVPTSHANV 112

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         YWFGGG DLTP      +  + D   +H T    C+      Y  YK
Sbjct: 113 RFFIATPENAEPVYWFGGGYDLTPY-----YGVNEDCEHWHRTAANACAPFGDDVYPRYK 167

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E RG+GG+FFD  ++    G    DF F+ A+GD +I  Y  +V+  
Sbjct: 168 HWCDEYFFLKHRNEPRGVGGLFFDDYNT----GDFARDFEFMRAIGDSYIDAYEPIVQAR 223

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +S+  RQ QL RRGRY EFNL+YD+GT FG ++GG  ESIL S+PPLV W
Sbjct: 224 KNQPYSDAQRQFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPLVRW 277


>gi|90415414|ref|ZP_01223348.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2207]
 gi|90332737|gb|EAS47907.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2207]
          Length = 305

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 109/297 (36%), Positives = 149/297 (50%), Gaps = 31/297 (10%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
             K+  +     LQ  IC +   ++              +    W+R++      GGGR 
Sbjct: 8   IDKQAVKEYLLGLQDSICAQLGAVD-----------SGEWKEDRWVREEG-----GGGRS 51

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L    + EK  V  S V+G   P    Q         F A G+S+++HP NP+ P  H
Sbjct: 52  RVLVDDAIIEKGGVNFSHVFGTEMPASATQHRPELAGRRFEAMGVSLVIHPQNPYAPTSH 111

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG DLTP   +     + D   +H T K  C + +   Y+
Sbjct: 112 ANVRFFIAEKDGAEPVWWFGGGYDLTPYYGN-----EEDCSHWHQTAKSACDRFSKDYYS 166

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YFYL HR E RGIGG+FFD  +      G +  F+F+  VGD F   Y  ++
Sbjct: 167 RFKNWCDDYFYLKHRSEPRGIGGLFFDDFNE----LGFEQSFAFMRGVGDSFSSAYIPIL 222

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R ++  F E +RQ QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPLV W
Sbjct: 223 ERRHNIAFGEAERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRW 279


>gi|82701270|ref|YP_410836.1| coproporphyrinogen III oxidase [Nitrosospira multiformis ATCC
           25196]
 gi|82409335|gb|ABB73444.1| Coproporphyrinogen oxidase [Nitrosospira multiformis ATCC 25196]
          Length = 299

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 150/294 (51%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           + ++  F  LQ  I    EK++                  H+ RD+ ++ + GGG    L
Sbjct: 5   QQAREFFTGLQQRIVEGLEKVDG----------------THFRRDEWERPEGGGGLSCVL 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+G   P              F A G+S+++HP NP+ P VH N+
Sbjct: 49  EEGNVLERGGVNYSHVFGGGLPASATAARPELAGRGFEAMGVSLVLHPRNPYAPTVHLNV 108

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R +          +WFGGG+DLTP      + ++ D + FH T K+         +  +K
Sbjct: 109 RYLEARKEGAEPVWWFGGGMDLTPY-----YGFEEDAVHFHQTCKDALQPFGNDFHPRFK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR+E RGIGGIF+D L         D+ FS   +VG  F+  Y  ++ R 
Sbjct: 164 KWCDEYFYLKHRREPRGIGGIFYDDLSKP----DFDSCFSLTKSVGTHFLDAYLPILERR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 220 KSVPYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPVVKW 273


>gi|157827804|ref|YP_001496868.1| coproporphyrinogen III oxidase [Rickettsia bellii OSU 85-389]
 gi|166217813|sp|A8GY81|HEM6_RICB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|157803108|gb|ABV79831.1| coproporphyrinogen III oxidase [Rickettsia bellii OSU 85-389]
          Length = 279

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 121/293 (41%), Positives = 169/293 (57%), Gaps = 18/293 (6%)

Query: 16  ERKRI--SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
            +K    +   F NL+ ++C EFEK+E E  + +    P  F    W RD      +   
Sbjct: 2   NKKNREVTSSWFTNLRDLVCAEFEKIEEEYAK-AKGLKPGKFVRSSWERDGGGGGVMS-- 58

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               +  G+VFEK  V +STV+G+ S  F+ +I G   +  F+ATG+S++ H  +P +PA
Sbjct: 59  ----VMKGEVFEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPA 114

Query: 134 VHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKE 193
           +HFN R I T   WFGGG DLTP         + +   FH   KE C ++    Y  +K+
Sbjct: 115 MHFNTRYIETSKNWFGGGGDLTPFYPE-----EDETAKFHAAFKEACDKYDSGYYPKFKK 169

Query: 194 WCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNY 253
            CD YFYL HR+E RG+GGIF+D+L+S    G  + DFSF   VG   + +YP +VR   
Sbjct: 170 QCDEYFYLKHRKEPRGVGGIFYDYLNS----GNFEQDFSFTQDVGKALLSVYPEIVRNKL 225

Query: 254 HHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
              ++++ ++ QLIRRGRY EFNLLYD+GT FG  T GNVE+IL S+PP V W
Sbjct: 226 FLPWTDEQKEYQLIRRGRYVEFNLLYDRGTKFGLMTDGNVEAILMSLPPEVKW 278


>gi|270156916|ref|ZP_06185573.1| coproporphyrinogen 3 oxidase [Legionella longbeachae D-4968]
 gi|269988941|gb|EEZ95195.1| coproporphyrinogen 3 oxidase [Legionella longbeachae D-4968]
          Length = 309

 Score =  318 bits (816), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC+  E L+ +A           F    W R        GGG    L
Sbjct: 13  EQVKTYLLKLQNTICSRLENLDGQAQ----------FIDDAWQR-----SAGGGGITRVL 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G   P              F A G+S+++HP NP+VP  H N+
Sbjct: 58  SQGLVFEKAGVNFSHVSGANLPSSASAHRPELTGRNFNALGVSLVIHPDNPYVPTSHANV 117

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG+DLTP      + ++ D   +H T  E C     + Y  +K
Sbjct: 118 RFFIAEKEDADPVWWFGGGVDLTPY-----YGFEEDCRHWHQTALEACQPFGQSIYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF++ HR E+RGIGG+FFD  +        D  FS + ++G+ +I+ Y  +V R 
Sbjct: 173 KWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFSLMQSIGNHYIEAYAPIVTRR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H + E+++  Q  RRGRY EFNL+YD+GT FG ++ G  ESIL S+PP V W
Sbjct: 229 KSHPYGEREKTFQKYRRGRYVEFNLVYDRGTLFGLQSNGRTESILMSLPPEVTW 282


>gi|148244605|ref|YP_001219299.1| coproporphyrinogen III oxidase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326432|dbj|BAF61575.1| coproporphyrinogen III oxidase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 308

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 118/291 (40%), Positives = 160/291 (54%), Gaps = 29/291 (9%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           Q+    LQS IC +FE+L+ +            F    W +      + G G    L  G
Sbjct: 6   QKYLLMLQSDICEQFEQLDGKV----------KFIKDAWKKP----NNTGNGLTRILVNG 51

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
            VFE+A V  S +  +  P    ++        F A G+S+++HP+NP+VP  H N+R  
Sbjct: 52  AVFEQAGVNFSIIRSNDMPASATELRPELAGRSFTALGVSLVIHPHNPYVPTSHANVRFF 111

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           +         +WFGGG DLTP      + +D D IF+H + K+ C       Y  YK+WC
Sbjct: 112 IAKKKGKIPIWWFGGGFDLTPY-----YGFDEDAIFWHQSAKQACDLFGKDVYLKYKKWC 166

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E RGIGG+FFD L+     GG D  F+F+ +VGD +IK Y  +V R    
Sbjct: 167 DDYFYLKHRNEQRGIGGLFFDDLNE----GGFDKCFAFMRSVGDGYIKAYQPIVERRKDT 222

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +++ +RQ QL RRGRY EFNL+YD+GT FG +TGG  ESIL S+PPLV W
Sbjct: 223 SYTDHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSIPPLVRW 273


>gi|85059690|ref|YP_455392.1| coproporphyrinogen III oxidase [Sodalis glossinidius str.
           'morsitans']
 gi|123519114|sp|Q2NS88|HEM6_SODGM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|84780210|dbj|BAE74987.1| coproporphyrinogen III oxidase [Sodalis glossinidius str.
           'morsitans']
          Length = 304

 Score =  318 bits (814), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 149/301 (49%), Gaps = 34/301 (11%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            DIE            LQ  IC      +  A           F    W RD+      G
Sbjct: 4   PDIE----HINAYLLALQETICAALTAADGGAV----------FHEDLWQRDEG-----G 44

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHV 131
           GGR   L  G+VFE+A V  S VYG   P              + A G+S++VHP NP++
Sbjct: 45  GGRTRVLRQGRVFEQAGVNFSRVYGGALPASATAHRPELAGRSYQAMGVSLVVHPENPYI 104

Query: 132 PAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P  H N+R  +         +WFGGG DLTP      + +  D + +H T + +C     
Sbjct: 105 PTSHANVRFFIAEKPGAEPIWWFGGGFDLTPF-----YGFHEDAVHWHRTAQALCQPFGD 159

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
             Y  YK WCD YF+L HR E+RGIGG+FFD L +       +  F+F  AV   ++  Y
Sbjct: 160 TVYPRYKRWCDDYFFLKHRNEARGIGGLFFDDLSAP----NFNEAFAFCRAVSQGYLDAY 215

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             +V R   H + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ES+L SMPPL  
Sbjct: 216 LPIVERRKSHPWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESVLMSMPPLAR 275

Query: 306 W 306
           W
Sbjct: 276 W 276


>gi|134093814|ref|YP_001098889.1| coproporphyrinogen III oxidase [Herminiimonas arsenicoxydans]
 gi|133737717|emb|CAL60762.1| coproporphyrinogen III oxidase, aerobic (Coproporphyrinogenase)
           (Coprogen oxidase) [Herminiimonas arsenicoxydans]
          Length = 325

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 102/292 (34%), Positives = 148/292 (50%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +     LQ  I +  E+++ +A           F    W R      + GGG    +  
Sbjct: 33  VKEYLLGLQQRIVSALEEVDGQA-----------FGTDSWER-----PEGGGGISRIIEN 76

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+  V  S V G   P              + A G+S+++HP NP+ P VH N+R 
Sbjct: 77  GNVFERGGVGFSHVMGKNLPPSAAANRPELAGRNWEAMGVSLVLHPRNPYAPTVHMNVRF 136

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG+DLTP      + ++ D   FH   ++         +  YK+W
Sbjct: 137 FIASTEGAEPIWWFGGGMDLTPY-----YGFEDDARHFHQVCRDALLAFGDEVHPRYKKW 191

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YFYL HRQE RG+GGIFFD L+     GG +  F+   +VG+ F++ Y  +++    
Sbjct: 192 CDDYFYLKHRQEPRGVGGIFFDDLNE----GGFERCFALQQSVGNHFVEAYVPILKLRKD 247

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+V W
Sbjct: 248 MPYGERERDFQTYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVVTW 299


>gi|254453431|ref|ZP_05066868.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           238]
 gi|198267837|gb|EDY92107.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           238]
          Length = 293

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 158/301 (52%), Gaps = 17/301 (5%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +++ K  +   F  L+  I   FE LE+ +A    +      F V    R     ED GG
Sbjct: 1   MKQEKAAASVWFRTLRDEIVQSFENLEDTQAVGPFSGLPAGRFEVTQTTRTGDAGEDAGG 60

Query: 73  GRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVHP 126
           G M+ +  G+VFEK  V +STV+G        +   +    G   +P FWA+G+S++ H 
Sbjct: 61  GVMSVMRGGRVFEKVGVNISTVHGTLGPRAQAAMMARKGFDGMADDPRFWASGISLVAHM 120

Query: 127 YNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
            NPH P+VH N RM  T   +WFGGG DL P +E     Y  D   FH T +     H  
Sbjct: 121 QNPHTPSVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YSDDTAHFHATQQTWLDPHGE 175

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y   K W D YFY+PHR  +RG+GG+F D   +    G   ADF+    +G  F+  Y
Sbjct: 176 AHYPKLKAWADEYFYIPHRNRARGVGGVFMDDYST----GDWAADFALTQDLGRAFLPAY 231

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
             LV    +  +++ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+  
Sbjct: 232 QPLVEGRRNTKWTDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPMAK 291

Query: 306 W 306
           W
Sbjct: 292 W 292


>gi|256823824|ref|YP_003147787.1| Coproporphyrinogen oxidase [Kangiella koreensis DSM 16069]
 gi|256797363|gb|ACV28019.1| Coproporphyrinogen oxidase [Kangiella koreensis DSM 16069]
          Length = 308

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 111/300 (37%), Positives = 150/300 (50%), Gaps = 30/300 (10%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           +IE+     Q     LQ  IC +  + + E          K F V  W R +      GG
Sbjct: 5   NIED----VQHYLLELQRDICQQLAEEDGE----------KDFIVDEWQRAQG-----GG 45

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVP 132
           G    +  G + EK  V  S V G   P              F A G+S+++HP NP+ P
Sbjct: 46  GLTRVMENGGIIEKGGVNYSYVEGTNMPASATAHRPELAGRSFKAMGVSLVIHPKNPYAP 105

Query: 133 AVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
             H N+R  +         +WFGGG DLTP   ++      D IF+H   K+ C      
Sbjct: 106 TSHMNVRFFIAEKEGEEPIWWFGGGFDLTPYYANK-----EDCIFWHQVAKQACDPFGQE 160

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK+WCD YFYL HR E RGIGG+FFD L+S       +  F+F+ +VGD +IK Y 
Sbjct: 161 VYDQYKKWCDDYFYLKHRDEHRGIGGLFFDDLNSEQTGWDFEQCFAFMRSVGDYYIKAYR 220

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            ++ +     ++E +R  QL RRGRY EFNL++D+GT FG +TGG  ESIL S+P  V W
Sbjct: 221 PILAKGKDKPYTEAERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSLPSEVRW 280


>gi|114768873|ref|ZP_01446499.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
 gi|114549790|gb|EAU52671.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
          Length = 294

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 118/301 (39%), Positives = 173/301 (57%), Gaps = 20/301 (6%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAH-ENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           +++K   +  F NL++ IC  FE +EN        +  P  F +    RD+      GGG
Sbjct: 6   QKQKEEVENWFSNLRNEICMSFENIENNQSTGPHCDLPPGKFELTETKRDEGS---GGGG 62

Query: 74  RMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            M+ +  G+VFEK  V +STVYG        S   + ++ G   NP FWA+G+S++ H  
Sbjct: 63  LMSVMRGGRVFEKVGVNISTVYGKLNPLMQKSMASRKEMTGIEDNPIFWASGISLVAHMN 122

Query: 128 NPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           +P VPAVH N RM  T    WFGGG DL P +E        +  FFH  LK+ C ++   
Sbjct: 123 SPKVPAVHMNTRMFWTPVASWFGGGTDLNPMIE-----VAEETKFFHKVLKKTCDKYNPE 177

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK+W D YF + H  E+RG+GGIFFD L++    G  +ADF+F   VG  F+  Y 
Sbjct: 178 YYPKYKKWADEYFLIKHWNETRGVGGIFFDDLNT----GNWNADFNFTKDVGKAFLAAYV 233

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L  +N  + +++ +R+ QLI+RG+YAEFNL+YD+GT+FG ++G +  ++L S+PP+  W
Sbjct: 234 PLCEKNQANSWTDAEREVQLIKRGKYAEFNLVYDRGTHFGLQSGHDPSAVLMSLPPVAKW 293

Query: 307 P 307
           P
Sbjct: 294 P 294


>gi|71909281|ref|YP_286868.1| coproporphyrinogen III oxidase [Dechloromonas aromatica RCB]
 gi|123626465|sp|Q479T3|HEM6_DECAR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|71848902|gb|AAZ48398.1| Coproporphyrinogen III oxidase [Dechloromonas aromatica RCB]
          Length = 298

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 145/291 (49%), Gaps = 31/291 (10%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           +  F  LQS I  E E  + +            F    W+R      + GGG    +  G
Sbjct: 7   KDFFTGLQSRIVAELEAFDGQ-----------PFRTDSWVR-----PEGGGGISRLIEEG 50

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
             FE+  V  S V G   P     +        + A G+S+++HP NP+ P  H N+R  
Sbjct: 51  DFFERGGVNFSHVTGKSLPASATAVRPQLAGRSWEAMGVSLVLHPRNPYCPTAHMNVRCF 110

Query: 142 VTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           V         +WFGGG+D+TP    R      DV+ FH T K+  +      Y  YK WC
Sbjct: 111 VASKEGEEDVWWFGGGMDMTPYYGQR-----EDVVHFHQTCKDALAPFGDEVYPKYKHWC 165

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+L HR E RG+GG+FFD L+     GG +  F    AVG+ F K Y  ++ +    
Sbjct: 166 DEYFFLKHRNEPRGVGGVFFDDLNE----GGFERCFELTQAVGNAFTKAYLPVLAKRREM 221

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 222 PYDERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPIVKW 272


>gi|99082371|ref|YP_614525.1| coproporphyrinogen III oxidase [Ruegeria sp. TM1040]
 gi|99038651|gb|ABF65263.1| Coproporphyrinogen oxidase [Ruegeria sp. TM1040]
          Length = 300

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 115/304 (37%), Positives = 157/304 (51%), Gaps = 17/304 (5%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHE-NSANRSPKIFTVKHWLRDKSQKED 69
             ++ + K  +   F  L+  I   FE LE+  HE          F V    R      D
Sbjct: 5   TAEMRDEKARAAAWFRELRDQIVAAFEGLEDSHHEGPFTEMGAGRFDVSDTKRTAEDGSD 64

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVI 123
            GGG M+ +  G+VFEK  V +S VYG        +   +  + G  ++P FWA+G+S++
Sbjct: 65  AGGGLMSVMRGGRVFEKVGVNISEVYGTLGARAQQAMAARKGLPGMKEDPRFWASGISLV 124

Query: 124 VHPYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
            H  NPHVPAVH N RM  T   +WFGGG DL P +E     YD D   FH   +     
Sbjct: 125 AHMRNPHVPAVHMNTRMFWTPHGWWFGGGSDLNPCIE-----YDEDTAHFHEVQQTHLDP 179

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFI 242
           H    Y   K W D YF++PHR  +RG+GGIF D  ++    G    DF+ I  +G  F+
Sbjct: 180 HGADLYPRLKAWADEYFFIPHRGRARGVGGIFLDDHNT----GDWAQDFALIQDIGRAFL 235

Query: 243 KLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPP 302
             +  LV R   H  S  D++ QLI RG YAE+NL+YD+GT FG +TG +  ++L S+PP
Sbjct: 236 PAFLPLVERRRGHACSADDKEAQLIHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPP 295

Query: 303 LVAW 306
           L  W
Sbjct: 296 LAKW 299


>gi|17228146|ref|NP_484694.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
 gi|41017220|sp|Q8YZ37|HEM61_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic 1;
           Short=Coprogen oxidase 1; Short=Coproporphyrinogenase 1
 gi|17129996|dbj|BAB72608.1| coproporphyrinogen III oxidase [Nostoc sp. PCC 7120]
          Length = 317

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 145/305 (47%), Gaps = 43/305 (14%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
            + LQ  I     KL+  +           F    W R      + GGGR   L  G +F
Sbjct: 1   MKQLQDEITQALTKLDGGSE----------FHEDSWER-----PEGGGGRSRVLRDGAIF 45

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           E+A V  S V+G   P          +   F+ATG S+++HP NP+VP VH N R     
Sbjct: 46  EQAGVNFSEVWGSHLPPSILAQRPEAEGHGFYATGTSLVLHPRNPYVPTVHLNYRYFEAG 105

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
             +WFGGG DLTP        +  D   FH TLK  C +H    Y  +K WCD YFYL H
Sbjct: 106 PVWWFGGGADLTPYYP-----FAEDAAHFHQTLKLACDEHHPEYYPVFKRWCDEYFYLKH 160

Query: 204 RQESRGIGGIFFDHLHS----------------------SPEMGGIDADFSFISAVGDCF 241
           R E+RG+GG+FFD+                          P     +  FSFI   G  F
Sbjct: 161 RDETRGVGGLFFDYQDGQGVLYRGPNPKGEAANYSNQVGEPASRDWEDLFSFIQGSGKAF 220

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  Y  +V R +   + ++ R  QL RRGRY EFNL+YD+GT FG +T G  ESIL S+P
Sbjct: 221 LPAYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLP 280

Query: 302 PLVAW 306
           PLV W
Sbjct: 281 PLVRW 285


>gi|163857413|ref|YP_001631711.1| coproporphyrinogen III oxidase [Bordetella petrii DSM 12804]
 gi|226740641|sp|A9ITM7|HEM6_BORPD RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|163261141|emb|CAP43443.1| hemF [Bordetella petrii]
          Length = 303

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 108/295 (36%), Positives = 148/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
                  LQ  I    E+   E+           F    W R      + GGG    +  
Sbjct: 9   VHAYLTGLQDNIVQALEQAGGES-----------FRTDTWQR-----PEGGGGVSRLIEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G++ E+A VL S V+G   P              + A G+S+++HP NP+VP  H N+RM
Sbjct: 53  GQLLERAGVLFSHVHGTRLPPSASAHRPELAGRSWQAMGVSLVLHPRNPYVPTTHMNVRM 112

Query: 141 IVT---------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            V            +WFGGG+DLTP      ++++ D   FH   +     H  A Y  Y
Sbjct: 113 FVAAARPGHDENDVFWFGGGLDLTPY-----YAFEDDARHFHQVCRAALDPHGAAYYPQY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YFYL HRQE RG+GG+FFD L+      G DA F+ + +VGD F+  Y  +V+R
Sbjct: 168 KRWCDEYFYLKHRQEMRGVGGVFFDDLNEP----GFDASFALLRSVGDAFLPAYLPIVQR 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                +++  R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 224 RRDTPYTQAQRDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPMAQW 278


>gi|260434934|ref|ZP_05788904.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. WH 8109]
 gi|260412808|gb|EEX06104.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. WH 8109]
          Length = 362

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 106/328 (32%), Positives = 155/328 (47%), Gaps = 44/328 (13%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           + +    +  P    + +  ++     LQ  IC   E L+ E           +F  + W
Sbjct: 15  VGVSKAPLELPP--SDSRERARAMVMGLQDEICAGLEALDGE----------GLFAEESW 62

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           +R      + GGGR   +  G+VFE+  V  S V G+  P    +     K   ++ATG 
Sbjct: 63  VR-----SEGGGGRSRVMREGRVFEQGGVNFSEVQGEELPPSILKQRPEAKGHPWFATGT 117

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP NP++P VH N R       +WFGGG DLTP        +  D   FH T +  
Sbjct: 118 SMVLHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLDDARLFHRTHQAA 172

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSP----------------- 222
           C       +  +K WCD YFYL HR E+RG+GGIF+D+  ++                  
Sbjct: 173 CDSVHPDLHKVFKPWCDEYFYLKHRGETRGVGGIFYDYQDANGTLYKGQDPSGPAAQVSA 232

Query: 223 ----EMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  FS   A G  F+  Y  +V + +   + +++R  QL RRGRY EFNL+
Sbjct: 233 RLGARPLSWEQLFSLGQANGRAFLPAYAPIVEKRHPMAYGDRERDFQLYRRGRYVEFNLV 292

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           +D+GT FG +T G  ESIL S+PPLV W
Sbjct: 293 WDRGTIFGLQTNGRTESILMSLPPLVRW 320


>gi|78185492|ref|YP_377927.1| coproporphyrinogen III oxidase [Synechococcus sp. CC9902]
 gi|123581087|sp|Q3AWA8|HEM6_SYNS9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|78169786|gb|ABB26883.1| coproporphyrinogen oxidase [Synechococcus sp. CC9902]
          Length = 362

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 108/325 (33%), Positives = 154/325 (47%), Gaps = 46/325 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
             +E+   D     +  ++     LQ  IC   E L+ E            F  + W+R 
Sbjct: 20  PQLELPPTDS----RDRARSMVMGLQDEICAGLEALDGE----------GRFQEESWVR- 64

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   +  G+VFE+  V  S V G+  P    +     K   ++ATG S++
Sbjct: 65  ----PEGGGGRSRVMREGRVFEQGGVNFSEVQGNELPPSILKQRPEAKGHPWFATGTSMV 120

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP++P VH N R       +WFGGG DLTP        +  D   FH T ++ C+ 
Sbjct: 121 LHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLDDARHFHRTHQQACNS 175

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS---------------------S 221
                +  +K WCD YFYL HR E+RG+GGIF+D+  S                      
Sbjct: 176 VHPNLHKVFKPWCDEYFYLKHRNETRGVGGIFYDYQDSRGTLYKGQDPTGAAAKVSSELG 235

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
                 +  FS   A G  F+  Y  +V + +   + +++R  QL RRGRY EFNL++D+
Sbjct: 236 ATPLSWEQLFSLGQANGRAFLPSYAPIVEKRHATSYGDRERDFQLYRRGRYVEFNLVWDR 295

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 296 GTIFGLQTNGRTESILMSLPPLVRW 320


>gi|254436523|ref|ZP_05050017.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           307]
 gi|198251969|gb|EDY76283.1| coproporphyrinogen III oxidase, aerobic [Octadecabacter antarcticus
           307]
          Length = 298

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 114/302 (37%), Positives = 160/302 (52%), Gaps = 17/302 (5%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLEN-EAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
           D+++ K  +   F  L+  I   FEKLE+ ++    +      F V    R      D G
Sbjct: 5   DMKQEKSAAAAWFRTLRDEIVQAFEKLEDTQSSGPFSYLPAGRFEVTQTTRTGDAGIDAG 64

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYG------DLSPDFKDQILGTTKNPYFWATGLSVIVH 125
           GG M+ +  G+VFEK  V +STV+G        +   +  + G   +P FWA+G+S++ H
Sbjct: 65  GGLMSVMRGGRVFEKVGVNISTVHGTLGARAQAAMMARKGLDGMADDPRFWASGISLVAH 124

Query: 126 PYNPHVPAVHFNIRMIVTGA-YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHA 184
             NPHVPAVH N RM  T   +WFGGG DL P +E     Y  D   FH T K     H 
Sbjct: 125 MQNPHVPAVHMNTRMFWTPHAWWFGGGSDLNPCIE-----YSDDTAHFHATQKTWLDPHG 179

Query: 185 VANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKL 244
            A+Y   K W D YFY+PHR  +RG+GG+F D   +    G   ADF+    +G  F+  
Sbjct: 180 TAHYPKLKAWADEYFYIPHRNRARGVGGVFMDDYST----GDWPADFALTQDLGRAFLPA 235

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  LV       +S+ D+  QL+ RG YAE+NL+YD+GT FG +TG +  ++L S+PP+ 
Sbjct: 236 YQPLVDARRDTEWSDADKDAQLVHRGLYAEYNLVYDRGTKFGLETGHDANAVLMSLPPMA 295

Query: 305 AW 306
            W
Sbjct: 296 KW 297


>gi|168002852|ref|XP_001754127.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694681|gb|EDQ81028.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 428

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 112/310 (36%), Positives = 148/310 (47%), Gaps = 49/310 (15%)

Query: 21  SQRKFENL----QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMA 76
            + +FE +    Q  IC   E ++              F    W+R        GGG   
Sbjct: 117 MRARFETMIRKAQDDICAAVEAVDG-----------GKFREDAWIR-----PGGGGGISR 160

Query: 77  TLCAGKVFEKAAVLVSTVYGDLSPDFKDQ----------ILGTTKNPYFWATGLSVIVHP 126
            L  G V+EKA V VS VYG + P+                       F+A G+S ++HP
Sbjct: 161 VLQDGNVWEKAGVNVSVVYGSMPPEAYRAATGGTSSNGGSTNKAGRIPFFAAGVSSVMHP 220

Query: 127 YNPHVPAVHFNIRMIVT----------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTL 176
            NP  P VHFN R   T           A+WFGGG DLTPS     + +D DV  FH T 
Sbjct: 221 KNPMAPTVHFNYRYFETDAPQGVEGAPRAWWFGGGTDLTPS-----YIFDEDVKHFHQTQ 275

Query: 177 KEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISA 236
           K+ C +H    Y  YK+WCD YF + HR E RG+GGIFFD L+        D   +F + 
Sbjct: 276 KDACDKHDPEFYPKYKKWCDDYFLIKHRGERRGLGGIFFDDLND----RDADQILAFSTE 331

Query: 237 VGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESI 296
             +  I  Y  ++ +     F+ + +  Q +RRGRY EFNL+YD+GT FG KTGG +ESI
Sbjct: 332 CANAVIPAYIPIIEKRKDMPFTAEQKAWQQLRRGRYVEFNLVYDRGTTFGLKTGGRIESI 391

Query: 297 LASMPPLVAW 306
           L S+P    W
Sbjct: 392 LMSLPLTARW 401


>gi|116075796|ref|ZP_01473055.1| coproporphyrinogen III oxidase [Synechococcus sp. RS9916]
 gi|116067111|gb|EAU72866.1| coproporphyrinogen III oxidase [Synechococcus sp. RS9916]
          Length = 325

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 104/302 (34%), Positives = 143/302 (47%), Gaps = 42/302 (13%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E L+              F  + W R      + GGGR   +  G++FE+
Sbjct: 2   GLQDEICAGLEALDG----------VGRFQEESWDR-----PEGGGGRSRVMREGRIFEQ 46

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT-GA 145
             V  S V+G   P    +     K   ++ATG S+++HP NP+VP VH N R       
Sbjct: 47  GGVNFSEVHGQELPPSILKQRPEAKGHPWFATGTSMVLHPRNPYVPTVHLNYRYFEAGPV 106

Query: 146 YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQ 205
           +WFGGG DLTP        +  D   FH T K+ C   +   Y  +K WCD YF+L HR 
Sbjct: 107 WWFGGGADLTPFYP-----FLEDARHFHRTHKQACDSVSTDLYPVFKPWCDEYFFLKHRN 161

Query: 206 ESRGIGGIFFDHLH---------------------SSPEMGGIDADFSFISAVGDCFIKL 244
           E+RG+GGIF+D+                       +       +       A G  F+  
Sbjct: 162 ETRGVGGIFYDYQDGNGQLYKGQNPSGPAADVAKATGSRPLNWEQLHDLAKACGQGFLPA 221

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  +V + +   + E++RQ QL RRGRY EFNL++D+GT FG +T G  ESIL S+PPL 
Sbjct: 222 YTPIVEKRHPLAYGERERQFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTESILMSLPPLA 281

Query: 305 AW 306
            W
Sbjct: 282 RW 283


>gi|124026733|ref|YP_001015848.1| coproporphyrinogen III oxidase [Prochlorococcus marinus str.
           NATL1A]
 gi|166217805|sp|A2C524|HEM6_PROM1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|123961801|gb|ABM76584.1| Coproporphyrinogen III oxidase [Prochlorococcus marinus str.
           NATL1A]
          Length = 348

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 109/328 (33%), Positives = 154/328 (46%), Gaps = 44/328 (13%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M+    +   P +    +  +++    LQ  IC   E ++ E            F  + W
Sbjct: 1   MSSSQDKANLPAN--NSRARAKKLVLELQDEICAGLETIDGE----------GKFLEESW 48

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R      + GGGR   L  GK+FE+  V  S V+G+  P          K   ++ATG 
Sbjct: 49  ER-----PEGGGGRSRVLKDGKIFEQGGVNFSEVHGNELPPSIISQRPEAKGHSWFATGT 103

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP NP++P VH N R       +WFGGG DLTP        Y  D   FH+  K  
Sbjct: 104 SMVLHPKNPYIPTVHLNYRYFEAGPVWWFGGGADLTPFYP-----YLSDTRHFHSCHKNA 158

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS------------------ 221
           C       +  +K WCD YF+L HR E+RG+GGIF+D+   S                  
Sbjct: 159 CDTIDKDLHKVFKPWCDEYFFLKHRNETRGVGGIFYDYQDGSGLLYKGQNANGKASKIAK 218

Query: 222 ---PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  FS   A G  F+  Y  ++++  +  FS ++R  QL RRGRYAEFNL+
Sbjct: 219 ELGEYSLNWENLFSLAKACGQAFLPSYEPIIKKRKNQSFSTKERDFQLYRRGRYAEFNLV 278

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           +D+GT FG +T G  ESIL S+PPL  W
Sbjct: 279 WDRGTIFGLQTNGRTESILMSLPPLARW 306


>gi|119384489|ref|YP_915545.1| coproporphyrinogen III oxidase [Paracoccus denitrificans PD1222]
 gi|119374256|gb|ABL69849.1| Coproporphyrinogen oxidase [Paracoccus denitrificans PD1222]
          Length = 286

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 114/300 (38%), Positives = 164/300 (54%), Gaps = 22/300 (7%)

Query: 13  DIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGG 72
           ++++ ++ +   F  L+  I   FE LE+          P  F ++   R     ED GG
Sbjct: 2   EMQDERQEAAAWFRALRDRIVAAFEALEDRGPGAV---PPGRFEIRETRR----GEDGGG 54

Query: 73  GRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQ-----ILGTTKNPYFWATGLSVIVHPY 127
           G M+ +  G+VFEK  V  S V+G LS   +       + G   +P FWA+G+S++ H  
Sbjct: 55  GLMSVMRGGRVFEKVGVNWSAVHGQLSAAARQAMAARGVPGIEADPRFWASGISLVAHMQ 114

Query: 128 NPHVPAVHFNIRMIVTG-AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
           NPH PAVH N RM  T  A+WFGGG DL P LE        D   FH TL+  C+ H   
Sbjct: 115 NPHAPAVHMNTRMFWTPGAWWFGGGADLNPCLERA-----EDTAHFHATLRAACAPHGAD 169

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  ++ W D YF++PHR  +RG+GGIF+D L++    G   ADF+F  AVG+ F+  + 
Sbjct: 170 YYDRFRAWADEYFFVPHRGRARGVGGIFYDDLNT----GDWRADFAFTKAVGEAFLPAFL 225

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            L        + E ++  QL+ RG YAE+NL+YD+GT FG  TG + E++L S+PP+  W
Sbjct: 226 PLAETRMAEPWGEAEKDAQLVHRGLYAEYNLVYDRGTKFGLATGHDPEAVLMSLPPMAKW 285


>gi|149199270|ref|ZP_01876308.1| Coproporphyrinogen III oxidase [Lentisphaera araneosa HTCC2155]
 gi|149137695|gb|EDM26110.1| Coproporphyrinogen III oxidase [Lentisphaera araneosa HTCC2155]
          Length = 304

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 146/291 (50%), Gaps = 24/291 (8%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
                 + LQ  IC   E  + E            F    W +   Q    G G  A + 
Sbjct: 8   QITTYLQALQKSICKGIEDFDGEKS----------FEFDRWDK-SGQTGLNGFGISAVIK 56

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G VFEK  V  S V G   P       G   N  F A G+S+++HP NP++P  H N+R
Sbjct: 57  DGAVFEKGGVNFSCVEGAKLPGSASAHRGEIANKPFKAAGVSLVLHPRNPYMPTTHANVR 116

Query: 140 MIVT----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
                     +WFGGG DLTP      ++++ D   +H   K+ C       Y  YK+WC
Sbjct: 117 FFSAGEENPTWWFGGGYDLTPY-----YAFEEDCRHWHQVAKDACKPFGEDVYPRYKKWC 171

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YFYL HR E RG+GG+FFD L+      G D  F F+ A+G+ F+  Y  +  +   H
Sbjct: 172 DDYFYLKHRDEQRGVGGLFFDDLNEW----GFDKSFEFMQAIGNSFLDAYLPIAEKRKSH 227

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++R  Q+ RRGRY EFNL+YD+GT FG ++GG  E+IL SMPPL +W
Sbjct: 228 PYGERERNFQVQRRGRYVEFNLVYDRGTLFGLQSGGRTEAILMSMPPLASW 278


>gi|219848205|ref|YP_002462638.1| coproporphyrinogen III oxidase [Chloroflexus aggregans DSM 9485]
 gi|219542464|gb|ACL24202.1| Coproporphyrinogen oxidase [Chloroflexus aggregans DSM 9485]
          Length = 302

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 161/279 (57%), Gaps = 22/279 (7%)

Query: 29  QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAA 88
           Q  +C  FE+++            + F  + W R        GGG    +  G VFE+A 
Sbjct: 18  QQNLCAAFEEIDGH----------QRFVAETWER-----PGGGGGTARVMTDGAVFERAG 62

Query: 89  VLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT-GAYW 147
           V VS VYG+  P    Q   +T+   ++ATG+S+++HP NP+VPA H N R       +W
Sbjct: 63  VNVSAVYGEEVPPSIWQHRPSTRGQPYFATGISMVLHPRNPYVPAFHANFRYFEAGDDWW 122

Query: 148 FGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQES 207
           FGGG+DLTP      + +  D   FH TL++ C +H++A+Y   KE CDRYF+L HR E 
Sbjct: 123 FGGGMDLTP-----NYGFAEDARHFHVTLRDYCGRHSIADYRTMKETCDRYFFLKHRNEM 177

Query: 208 RGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLI 267
           RGIGGIFFD LH      G D  F+F+S      +  Y  +VRR  H  + E++R  QL 
Sbjct: 178 RGIGGIFFDDLH-PDGPDGFDRAFAFVSDGITTILDAYLPIVRRRMHTPYGERERSWQLY 236

Query: 268 RRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RRGRY EFNL+YD+GT FG +TGGN+E+IL S+PPL  W
Sbjct: 237 RRGRYVEFNLIYDRGTLFGLQTGGNIEAILMSLPPLARW 275


>gi|317968786|ref|ZP_07970176.1| coproporphyrinogen III oxidase [Synechococcus sp. CB0205]
          Length = 325

 Score =  316 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 110/302 (36%), Positives = 146/302 (48%), Gaps = 42/302 (13%)

Query: 27  NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEK 86
            LQ  IC   E+ +              F  + W+R      + GGGR   +  G+VFE+
Sbjct: 2   GLQDSICAGLEQFDG----------GGRFEEESWVR-----PEGGGGRSRVIKGGRVFEQ 46

Query: 87  AAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT-GA 145
             V  S V G   P          K   ++ATG S+++HP NP +P VH N R       
Sbjct: 47  GGVNFSEVEGTELPPSILNQRPEAKGHRWYATGTSMVLHPRNPFIPTVHLNYRYFEAGPV 106

Query: 146 YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQ 205
           +WFGGG DLTP        +  D   FH TLK  C     A Y  +K WCD YFYL HR 
Sbjct: 107 WWFGGGADLTPYYP-----FLEDAKHFHQTLKNACDSVNPAYYQVFKPWCDEYFYLKHRD 161

Query: 206 ESRGIGGIFFDHLHS---------------------SPEMGGIDADFSFISAVGDCFIKL 244
           E+RG+GGIF+D+                         P     +  F+  SA G+ F+  
Sbjct: 162 ETRGVGGIFYDYQDPRGVLYKGQAPEGPAAAAGQGVGPIQQSWEQLFNLASACGNAFLPS 221

Query: 245 YPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLV 304
           Y  + ++  H  + E++RQ QL RRGRY EFNL++D+GT FG +T G  ESIL S+PPLV
Sbjct: 222 YLPIAKKRQHTPYGERERQFQLYRRGRYVEFNLVFDRGTIFGLQTNGRTESILMSLPPLV 281

Query: 305 AW 306
            W
Sbjct: 282 RW 283


>gi|85374711|ref|YP_458773.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
 gi|84787794|gb|ABC63976.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
          Length = 285

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 128/296 (43%), Positives = 175/296 (59%), Gaps = 14/296 (4%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLG 71
            D   +   ++  FE+L+  IC EFE +E EA  ++A      F    W R+++  +D G
Sbjct: 2   TDWTSQTEQARAWFESLRDQICAEFEAIEREAGSDAA------FQYTPWDREEAGNDDPG 55

Query: 72  GGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTT-KNPYFWATGLSVIVHPYNPH 130
           GG    L  GKVFEK  V VSTV G  +P+F   I G + ++P F ATG+S++ H  NPH
Sbjct: 56  GGVQG-LMKGKVFEKVGVNVSTVRGSFAPEFAATINGASVEHPGFTATGISLVAHMANPH 114

Query: 131 VPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
           VPAVH N R + T A WFGGG DL P +      Y+ D   FH   +  C+ H    Y  
Sbjct: 115 VPAVHMNTRFLTTQAAWFGGGADLNPPIP-----YEQDTAEFHARFRAACAAHNPTYYER 169

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +++W D YF++PHR   RG+GGIF+DHL         + +F+F   VG  F+ ++P LVR
Sbjct: 170 FRKWADDYFFIPHRGVHRGVGGIFYDHLECDDAAA-FERNFAFTQDVGKAFLDIFPQLVR 228

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R     F+ +D+Q QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 229 RRMESDFTPEDKQTQLEWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSLPPEAVW 284


>gi|121611156|ref|YP_998963.1| coproporphyrinogen III oxidase [Verminephrobacter eiseniae EF01-2]
 gi|121555796|gb|ABM59945.1| Coproporphyrinogen oxidase [Verminephrobacter eiseniae EF01-2]
          Length = 323

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 145/294 (49%), Gaps = 24/294 (8%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   + LQ+ I    + LE E            F    W +         G     L
Sbjct: 17  ARVRGYLQGLQARITDALQALETEGG--------ARFRADAWSKPPGASLSGDGN-TLIL 67

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A   +S V G   P              F A GLS+++HP NP+VP VH N+
Sbjct: 68  EGGRVFERAGCGLSHVRGPHLPPSASAHRSALAGAPFEAMGLSLVLHPRNPYVPTVHMNV 127

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RMI         + WFGGG+DLTP      + ++ DV+ FH   +   +      Y  +K
Sbjct: 128 RMIAAAHPGQAPSCWFGGGMDLTPC-----YGFEEDVVHFHRHCRAALAPFGADKYPRFK 182

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RG GG+F+D L         +   +   +VG+ F+  Y  +V++ 
Sbjct: 183 QWCDEYFYLKHRNEQRGAGGVFYDDLAEP----DFEQSLALTQSVGEAFVPAYLPIVQKR 238

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL AW
Sbjct: 239 QATPYGERERDFQSYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLAAW 292


>gi|257092428|ref|YP_003166069.1| Coproporphyrinogen oxidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044952|gb|ACV34140.1| Coproporphyrinogen oxidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 305

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 144/291 (49%), Gaps = 24/291 (8%)

Query: 22  QRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAG 81
           +  F  LQ+ +    E +E              F V  W ++  Q     G     +  G
Sbjct: 8   RDYFTGLQTRLVAAAETVEG--------ADGGRFRVDPWSKEADQALAGRGC-TCVIEGG 58

Query: 82  KVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMI 141
           +VFE+  V  S V G   P              F A G+S+++HP NP+ P  H N+R +
Sbjct: 59  RVFERGGVAFSHVLGAALPASATAKRPELAGCAFEAMGVSLVLHPENPYCPTAHMNVRAL 118

Query: 142 VT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWC 195
           V        A+WFGGG+DLTP        +  DV  FH T ++         Y  YK+WC
Sbjct: 119 VATKTDHEPAWWFGGGMDLTPYYP-----FVEDVRHFHATCRQALLPFGGDTYARYKKWC 173

Query: 196 DRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHH 255
           D YF+L HR E RG+GG+FFD L+     GG +  F    AVGD F   Y  +V +    
Sbjct: 174 DEYFFLKHRNEPRGVGGVFFDDLNE----GGFERCFGLTRAVGDAFAAAYLPIVEKRKRL 229

Query: 256 LFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL S+PP+V W
Sbjct: 230 PYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPVVKW 280


>gi|332524160|ref|ZP_08400389.1| Coproporphyrinogen oxidase [Rubrivivax benzoatilyticus JA2]
 gi|332107498|gb|EGJ08722.1| Coproporphyrinogen oxidase [Rubrivivax benzoatilyticus JA2]
          Length = 308

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +R    LQS I    E  +              F    W R    + + G G    +
Sbjct: 8   AAMRRWLLELQSRIVAAVEAEDGT-----------PFLRDAWQRPAGGRLE-GDGLTQLV 55

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + E+     S V G   P    Q         F A G+S+++HP NPHVP  H N+
Sbjct: 56  EGGPLIERGGCNFSHVKGAALPPTATQHRPELAGSPFEALGVSLVMHPRNPHVPTTHMNV 115

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+            WFGGG+DLTP      +  + D   FH   ++  +      Y  +K
Sbjct: 116 RLFAAFPEGRAPVSWFGGGMDLTPY-----YGVEDDARHFHRVCRDALAPFGEDKYPRFK 170

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E RGIGG+FFD        GG DADF+ + +VG+ F+  +  +VRR 
Sbjct: 171 RWCDEYFYLKHRDEPRGIGGVFFDDFAE----GGFDADFAMVRSVGEAFLDAWLPIVRRR 226

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q +RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+V W
Sbjct: 227 RDTPYGERERDFQCLRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPVVHW 280


>gi|304415422|ref|ZP_07396073.1| coproporphyrinogen III oxidase [Candidatus Regiella insecticola
           LSR1]
 gi|304282721|gb|EFL91233.1| coproporphyrinogen III oxidase [Candidatus Regiella insecticola
           LSR1]
          Length = 363

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 106/297 (35%), Positives = 156/297 (52%), Gaps = 30/297 (10%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
           + K   +     LQ  IC E  +L+            + FT + W+      +     R 
Sbjct: 64  QEKEQVKAFLIYLQDKICQELTQLD----------EKEKFTEQCWV-----MKGKSDCRS 108

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             +  G++FE+A V  S V G+  P              F A G+SV++HP NP++P  H
Sbjct: 109 RLMTKGRLFEQAGVNFSDVCGNALPHSASSRRPELAGRAFQAMGVSVVIHPLNPYLPTSH 168

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  V         +WFGGG DLTP      + ++ D I +H T + +C       Y+
Sbjct: 169 ANVRFFVAEKPGEEPVWWFGGGFDLTPF-----YGFEEDAIHWHKTAQALCKPFGKEKYS 223

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            YK+WCD YFY+ HR E+RGIGG+FFD L++       +  F FI AVG+ F+  Y  ++
Sbjct: 224 QYKKWCDDYFYIKHRNEARGIGGLFFDDLNTP----DFNTCFDFIKAVGEGFLTAYLPII 279

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +  + +++R+ QL RRGRY EFNL++D+GT FG +TGG  ESIL S+PP V W
Sbjct: 280 EKRQNMTWGKKEREFQLYRRGRYVEFNLVWDRGTLFGLQTGGRSESILMSLPPRVRW 336


>gi|194288986|ref|YP_002004893.1| coproporphyrinogen iii oxidase [Cupriavidus taiwanensis LMG 19424]
 gi|193222821|emb|CAQ68824.1| coproporphyrinogen III oxidase [Cupriavidus taiwanensis LMG 19424]
          Length = 303

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 104/297 (35%), Positives = 147/297 (49%), Gaps = 27/297 (9%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
              +  +     LQ  I      ++ +            F    W +  +++    G R 
Sbjct: 2   IDSQAVRAYLLGLQDRITDAIGAIDGQ-----------PFLTDAWEKPPTERLRGSG-RT 49

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G V E+A V  S V GD  P              F A G+S++ HP NPHVP VH
Sbjct: 50  RILEGGAVMERAGVGFSHVSGDTLPPSATANRPELAGRSFEAMGVSLVFHPRNPHVPTVH 109

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG+DLTP   +       D   FH T ++  + +    Y 
Sbjct: 110 MNVRCFLALKPGTEPVWWFGGGMDLTPYYGNAG-----DCTHFHRTCRQALAPYGDELYP 164

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K+WCD YF+L HR E+RGIGGIFFD   +     G +  F+ + AVGD F+  Y  ++
Sbjct: 165 RFKQWCDEYFFLKHRNEARGIGGIFFDDFSA----LGFERSFAMMQAVGDAFLDAYLPIL 220

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +      + E++R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL AW
Sbjct: 221 QGRKDTPYGEREREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLAAW 277


>gi|317403474|gb|EFV83982.1| coproporphyrinogen 3 oxidase [Achromobacter xylosoxidans C54]
          Length = 303

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 114/295 (38%), Positives = 150/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +  F  LQ+ I    E  E              F    W+R      + GGG    L  
Sbjct: 9   VRGYFTGLQARIVGALEAAEG-----------GPFRTDEWIR-----PEGGGGVSRLLEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G++FE+A VL S V G   P              + A G+S+++HP NP+VP  H N+RM
Sbjct: 53  GQLFERAGVLFSHVQGSKLPPSASAHRPELAGRSWQAMGVSMVLHPRNPYVPTTHMNVRM 112

Query: 141 I---------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
                      T  +WFGGGIDLTP        ++ D   FH   ++  + H    Y  Y
Sbjct: 113 FVATARPGHDETDVFWFGGGIDLTPYYP-----FEEDARHFHAVCRDALAGHGADYYPRY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YF+L HR E+RGIGGIFFD L++     G DA F+   +VGD F+  Y  +V R
Sbjct: 168 KRWCDEYFFLKHRNETRGIGGIFFDDLNAP----GFDASFALTRSVGDAFLDSYLPIVDR 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             H  + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 RRHTPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|33241186|ref|NP_876128.1| coproporphyrinogen III oxidase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|41017131|sp|Q7V9T7|HEM6_PROMA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33238716|gb|AAQ00781.1| Coproporphyrinogen oxidase III [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 343

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 106/309 (34%), Positives = 147/309 (47%), Gaps = 42/309 (13%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
             +     LQ  IC   E ++ E            F  + W R      + GGGR   + 
Sbjct: 13  KVKSFLTGLQDDICKGLENIDGE----------GTFQEESWER-----PEGGGGRSRVMR 57

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIR 139
            G++FE+  V  S V+G+  P          K   ++ATG S+++HP NP++P VH N R
Sbjct: 58  EGRIFEQGGVNFSEVHGEELPPSILNQRPEAKGHKWFATGTSMVLHPRNPYIPTVHLNYR 117

Query: 140 MIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP        Y  D   FH   +E C       +  +K WCD Y
Sbjct: 118 YFEAGPVWWFGGGADLTPYYP-----YLKDTRHFHKIHQEACDSINPKLHKVFKPWCDEY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSS---------------------PEMGGIDADFSFISAV 237
           F+L HR ESRG+GGIFFD+   S                           +  FS   A 
Sbjct: 173 FFLKHRNESRGVGGIFFDYQDGSGKLYKGQNPNGLSSIASKELGEYKLSWEDLFSLAKAC 232

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G+ F+  Y  ++ + ++  FS+++R  QL RRGRY EFNL++D+GT FG +T G  ESIL
Sbjct: 233 GNAFLPSYIPIIEKRHNQTFSDRERNFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTESIL 292

Query: 298 ASMPPLVAW 306
            S+PPL  W
Sbjct: 293 MSLPPLARW 301


>gi|198443339|pdb|3DWR|A Chain A, Leishmania Major Coproporphyrinogen Iii Oxidase With Bound
           Ligand
 gi|198443340|pdb|3DWR|B Chain B, Leishmania Major Coproporphyrinogen Iii Oxidase With Bound
           Ligand
          Length = 309

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 14  EAVKDFLLKLQDDICEALEAEDGQA----------TFVEDKWTREGGG-----GGRTRVM 58

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 59  VDGAVIEKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANV 118

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D   FH   +++C       Y  +K
Sbjct: 119 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRDFHQVAQDLCKPFGADVYARFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  ++  Y  +V R 
Sbjct: 174 GWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYMDAYIPIVNRR 229

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 230 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 283


>gi|220926368|ref|YP_002501670.1| coproporphyrinogen III oxidase [Methylobacterium nodulans ORS 2060]
 gi|219950975|gb|ACL61367.1| coproporphyrinogen III oxidase [Methylobacterium nodulans ORS 2060]
          Length = 299

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 149/302 (49%), Positives = 189/302 (62%), Gaps = 7/302 (2%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHEN--SANRSPKIFTVKHWLRDKS 65
           I    DI+  K+ + R F  L+  IC  FE LE EA         +P  F    W R   
Sbjct: 3   IDASLDIDGLKQEATRWFSGLRDRICAAFEALEAEATGPFDPEATAPGRFVRTPWERTDH 62

Query: 66  QKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVH 125
                GGG MA L  G+VFEKA V VS V+G+ +P+F+ QI G  ++P F+ATG+S+I H
Sbjct: 63  SGAPGGGGIMAMLR-GRVFEKAGVHVSAVHGEFAPEFRIQIPGAAEDPRFFATGISLIAH 121

Query: 126 PYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAV 185
           P+NP+VP VH N R +VT   WFGGG DLTP L+ RR   DPD + FH  LK  C +H  
Sbjct: 122 PWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDRRRRQDDPDTVAFHAALKAACERHPG 181

Query: 186 ANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLY 245
           A+Y  YK WCD YF+L HR E RG+GGIF+D+  +    G   AD +    VG+ F+ +Y
Sbjct: 182 ADYARYKAWCDEYFHLKHRNEPRGVGGIFYDYHWT----GDPQADLALTREVGEAFLSVY 237

Query: 246 PSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVA 305
           P +VRRN    ++E DR EQ ++RGRY EFNLLYD+GT FG KTGGNV+SIL+SMPP V 
Sbjct: 238 PEIVRRNLATPWTEADRHEQQVQRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPTVR 297

Query: 306 WP 307
           WP
Sbjct: 298 WP 299


>gi|319944360|ref|ZP_08018634.1| coproporphyrinogen III oxidase [Lautropia mirabilis ATCC 51599]
 gi|319742321|gb|EFV94734.1| coproporphyrinogen III oxidase [Lautropia mirabilis ATCC 51599]
          Length = 319

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 111/314 (35%), Positives = 145/314 (46%), Gaps = 34/314 (10%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MN   +     +            F  LQS I    E +  +            F    W
Sbjct: 1   MNSTALPSSPAEH-----DAIAAWFAGLQSRIVAGLEDIGGD-----------RFLRDAW 44

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R+       G G    L  GK+FE+A V+ S V     P                ATG+
Sbjct: 45  QREP-DSPTQGSGISCVLDDGKLFERAGVMFSDVQVSQLPPTASANRPQLAGRKARATGV 103

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT--------GAYWFGGGIDLTPSLESRRHSYDPDVIFF 172
           S+++HP NPHVP VH N+R              +WFGGG+DLTP      +  + D   F
Sbjct: 104 SLVLHPRNPHVPTVHMNVRFFRALAPTPAEQDVWWFGGGMDLTPY-----YGEEEDARHF 158

Query: 173 HNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFS 232
           H    +  +     +Y   K WCDRYF+L HRQE+RGIGGIFFD L+           F+
Sbjct: 159 HQVCFDALAPFGPEHYPAMKAWCDRYFFLKHRQEARGIGGIFFDDLNQP----DFATAFA 214

Query: 233 FISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGN 292
              +VGD F+  Y  +VRR     + E++R  Q +RRGRY EFNL+ D+GT FG  +GG 
Sbjct: 215 LTRSVGDHFLDAYLPIVRRRMDRAYGERERTFQALRRGRYVEFNLVLDRGTLFGLASGGR 274

Query: 293 VESILASMPPLVAW 306
            ESILASMPP   W
Sbjct: 275 TESILASMPPTAGW 288


>gi|300312854|ref|YP_003776946.1| coproporphyrinogen III oxidase [Herbaspirillum seropedicae SmR1]
 gi|300075639|gb|ADJ65038.1| coproporphyrinogen III oxidase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 324

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 145/294 (49%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   ++LQ  I    E  + ++           F    W R      + GGG    L
Sbjct: 30  AAVKAYLQDLQQRIVAALEAADGKS-----------FLSDSWER-----PEGGGGTSRLL 73

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + E+  V  S V G   P              + A G+S+++HP NP+VP VH N+
Sbjct: 74  EEGNLLERGGVGFSHVMGKNLPPSAAANRPHLAGRAWEAMGVSLVLHPRNPYVPTVHMNV 133

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R   T A      +WFGGG+DLTP      +  + D   FH T ++    +    Y  +K
Sbjct: 134 RFFTTHAEGEEAVWWFGGGMDLTPY-----YGVEDDARHFHRTCRDALQPYGDELYPRFK 188

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR+E RG+GGIFFD  ++ P     +  F+   +VGD F+  Y  +V   
Sbjct: 189 TWCDDYFYLKHRKEPRGVGGIFFDDFNALP----FEQAFAMQRSVGDAFLAAYLPIVAAR 244

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 245 RDTPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPLVKW 298


>gi|124023960|ref|YP_001018267.1| coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9303]
 gi|123964246|gb|ABM79002.1| Coproporphyrinogen III oxidase [Prochlorococcus marinus str. MIT
           9303]
          Length = 357

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 107/311 (34%), Positives = 144/311 (46%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +   +     LQ  I  E E L+              F    W R      + GGGR   
Sbjct: 25  RERVRELVLGLQDEISNELESLDGGQS----------FRTDSWER-----PEGGGGRSKV 69

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V+G+  P          K   ++ATG S+++HP NP+VP +H N
Sbjct: 70  MREGRVFEQGGVNFSEVHGEELPPSILNQRPEAKGHPWFATGTSMVLHPRNPYVPTIHLN 129

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        Y  D   FH   K+ C       +  +K WCD
Sbjct: 130 YRYFEAGPVWWFGGGADLTPFYP-----YLEDARHFHRVHKQACDTVGPELHKVFKPWCD 184

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSS---------------------PEMGGIDADFSFIS 235
            YFYL HR E+RG+GGIF+D+   S                     P     +  F    
Sbjct: 185 EYFYLKHRGETRGVGGIFYDYQDGSGVLYKGQNPEGPAAQVSRELGPHPKSWEQLFELAK 244

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  +V +     + +++RQ QL RRGRYAEFNL++D+GT FG +T G  ES
Sbjct: 245 ACGKAFLPAYVPIVEKRQQQAYGDRERQFQLYRRGRYAEFNLVWDRGTIFGLQTNGRTES 304

Query: 296 ILASMPPLVAW 306
           IL S+PPL  W
Sbjct: 305 ILMSLPPLARW 315


>gi|157864380|ref|XP_001680900.1| coproporphyrinogen iii oxidase [Leishmania major strain Friedlin]
 gi|74961148|sp|P84155|HEM6_LEIMA RecName: Full=Coproporphyrinogen-III oxidase; Short=Coprogen
           oxidase; Short=Coproporphyrinogenase
 gi|68124192|emb|CAJ02175.1| coproporphyrinogen III oxidase [Leishmania major strain Friedlin]
          Length = 301

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 6   EAVKDFLLKLQDDICEALEAEDGQA----------TFVEDKWTREGGG-----GGRTRVM 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 51  VDGAVIEKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D   FH   +++C       Y  +K
Sbjct: 111 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRDFHQVAQDLCKPFGADVYARFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  ++  Y  +V R 
Sbjct: 166 GWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYMDAYIPIVNRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 222 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 275


>gi|329906919|ref|ZP_08274522.1| Coproporphyrinogen III oxidase, aerobic [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547135|gb|EGF32004.1| Coproporphyrinogen III oxidase, aerobic [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 304

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 145/292 (49%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  I T    ++ +            F+   W R      + GGG    +  
Sbjct: 11  IKTYLLDLQERIVTALSAIDGQ-----------PFSTDAWQR-----PEGGGGISRIIED 54

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G VFE+  V  S V G   P              + A G+S+++HP NP  P VH N+R 
Sbjct: 55  GNVFERGGVGFSHVTGKNLPPSAAANRPEIAGREWEAMGVSLVLHPRNPLAPTVHMNVRF 114

Query: 141 IVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG+DLTP      + ++ D   FH T  +  +      +  +K+W
Sbjct: 115 FMATAAGEAPVWWFGGGMDLTPY-----YGFEDDARHFHQTCFDALAPFGDDLHPRFKKW 169

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CD YF+L HRQE RGIGGIFFD  H+     G+D   + + +VGD F+  Y  +++R   
Sbjct: 170 CDEYFFLKHRQEPRGIGGIFFDDFHA----LGLDRSSAMMQSVGDAFLAAYLPILQRRKD 225

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             F E  R  Q  RRGRY EFNL+YD+GT FG ++GG  ESIL SMPP+V W
Sbjct: 226 LPFDETQRDFQAYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPVVKW 277


>gi|72382992|ref|YP_292347.1| coproporphyrinogen III oxidase [Prochlorococcus marinus str.
           NATL2A]
 gi|123620730|sp|Q46IN4|HEM6_PROMT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|72002842|gb|AAZ58644.1| coproporphyrinogen oxidase [Prochlorococcus marinus str. NATL2A]
          Length = 348

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 107/328 (32%), Positives = 154/328 (46%), Gaps = 44/328 (13%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           M+    +   P +    +  +++    LQ  IC   E ++ E            F  + W
Sbjct: 1   MSSSQDKANLPAN--NSRARAKKLVLELQDEICAGLETIDGE----------GKFLEESW 48

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R      + GGGR   L  G++FE+  V  S V+G+  P          K   ++ATG 
Sbjct: 49  ER-----PEGGGGRSRVLKDGQIFEQGGVNFSEVHGNELPPSIISQRPEAKGHSWFATGT 103

Query: 121 SVIVHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEM 179
           S+++HP +P++P VH N R       +WFGGG DLTP        Y  D   FH+  K  
Sbjct: 104 SMVLHPKSPYIPTVHLNYRYFEAGPVWWFGGGADLTPFYP-----YLSDTRHFHSCHKNA 158

Query: 180 CSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSS------------------ 221
           C       +  +K WCD YF+L HR E+RG+GGIF+D+   S                  
Sbjct: 159 CDTIDKDLHKVFKPWCDEYFFLKHRNETRGVGGIFYDYQDGSGLLYKGQNANGKASKIAK 218

Query: 222 ---PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLL 278
                    +  FS   A G  F+  Y  ++++  +  FS ++R  QL RRGRYAEFNL+
Sbjct: 219 ELGEYSLNWENLFSLAKACGQAFLPSYEPIIKKRKNQSFSTKERDFQLYRRGRYAEFNLV 278

Query: 279 YDKGTNFGFKTGGNVESILASMPPLVAW 306
           +D+GT FG +T G  ESIL S+PPL  W
Sbjct: 279 WDRGTIFGLQTNGRTESILMSLPPLARW 306


>gi|94499922|ref|ZP_01306458.1| Coproporphyrinogen oxidase [Oceanobacter sp. RED65]
 gi|94428123|gb|EAT13097.1| Coproporphyrinogen oxidase [Oceanobacter sp. RED65]
          Length = 299

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 154/294 (52%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++    LQ  IC +  + +              F  + W R++      GGGR   +
Sbjct: 4   EAVKQYLLALQDDICRQLSEEDG----------GTEFREESWTREEG-----GGGRSRVI 48

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S V+G   P              F A G+S+++HP+NP+VP  H N+
Sbjct: 49  ENGNVIEKGGVNFSHVHGKTLPASATANRPELAGRSFQAMGVSLVIHPHNPYVPTSHANV 108

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ DV ++H T K+ C       Y  YK
Sbjct: 109 RFFIAEKEGEEPVWWFGGGFDLTPY-----YGFEEDVRYWHQTAKQACDPFGNDLYEKYK 163

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFY+ HRQE RG+GG+FFD L+     G  +  F+F+ +VGD +IK Y  ++ + 
Sbjct: 164 NWCDDYFYIKHRQEPRGVGGLFFDDLND----GDFENSFAFMRSVGDHYIKAYRPIIAKR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  F EQ+R+ Q  RRGRY EFNL+ D+GT FG +TGG  ESIL S+PP+V W
Sbjct: 220 KNTDFDEQERKFQCYRRGRYVEFNLVQDRGTIFGLQTGGRTESILMSLPPVVHW 273


>gi|326572658|gb|EGE22647.1| coproporphyrinogen III oxidase [Moraxella catarrhalis CO72]
          Length = 320

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 151/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVREFLLNLQQAIVQALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFTTCFQFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  RN H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFERNKHRSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|307293832|ref|ZP_07573676.1| Coproporphyrinogen oxidase [Sphingobium chlorophenolicum L-1]
 gi|306879983|gb|EFN11200.1| Coproporphyrinogen oxidase [Sphingobium chlorophenolicum L-1]
          Length = 283

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 130/298 (43%), Positives = 178/298 (59%), Gaps = 17/298 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD-KSQKE 68
               ++ +++ ++  FE+L+  IC EFE +E EA  +        F    W R+      
Sbjct: 1   MTLMLDPQQQAARTWFESLRDRICAEFEAIEREAGSD------ARFDYIAWDREAPGLTP 54

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
             GGG +  +  GKVFEK  V VSTV G  SP+F   I G +++P F+ATG+S++ H  N
Sbjct: 55  GEGGGGVRGVMKGKVFEKVGVNVSTVGGVFSPEFATTIHGASEDPSFFATGISLVAHMAN 114

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N R +VT   WFGGG DL P L       D D   FHN LK  C  H   +Y
Sbjct: 115 PHVPAVHMNTRYLVTSKRWFGGGADLNPPLP-----RDEDTAHFHNVLKAACDAHDADHY 169

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K W D YF++PHR   RG+GGIF+DHL      G  DA+F+F   VG+ F+K +P +
Sbjct: 170 PRFKAWADEYFFIPHRGVHRGVGGIFYDHL-----EGDFDANFAFTRDVGEAFLKAFPPI 224

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           VRR     +S+++ +  L  RGRYAEFNL++D+GT FG KTGGNV++IL S+PP+ +W
Sbjct: 225 VRRRMGESWSQEEYRRMLEWRGRYAEFNLVHDRGTLFGLKTGGNVDAILMSLPPMASW 282


>gi|163848150|ref|YP_001636194.1| coproporphyrinogen III oxidase [Chloroflexus aurantiacus J-10-fl]
 gi|222526051|ref|YP_002570522.1| coproporphyrinogen III oxidase [Chloroflexus sp. Y-400-fl]
 gi|163669439|gb|ABY35805.1| Coproporphyrinogen oxidase [Chloroflexus aurantiacus J-10-fl]
 gi|222449930|gb|ACM54196.1| Coproporphyrinogen oxidase [Chloroflexus sp. Y-400-fl]
          Length = 302

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 118/279 (42%), Positives = 159/279 (56%), Gaps = 22/279 (7%)

Query: 29  QSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAA 88
           Q  +C  FE+++  A           F  + W R        GGG    +  G VFE+A 
Sbjct: 18  QQRLCAAFEEIDQHAQ----------FVAESWER-----PGGGGGTARVMTEGAVFERAG 62

Query: 89  VLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT-GAYW 147
           V VS VYG   P    Q   +T+   ++ATG+S+++HP NP+VPA H N R       +W
Sbjct: 63  VNVSAVYGVEVPPSIWQHRPSTRGQPYFATGISMVLHPRNPYVPAFHANFRYFEAGDDWW 122

Query: 148 FGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQES 207
           FGGG+DLTPS     + +  D   FH TL++ C++H +A+Y   K  CD YF+L HR E 
Sbjct: 123 FGGGMDLTPS-----YGFAEDARHFHVTLRDYCARHPIADYREMKATCDNYFFLKHRNEM 177

Query: 208 RGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLI 267
           RGIGGIFFD LH      G +  F+F+S      +  Y  +VRR  H  + E++R  QL 
Sbjct: 178 RGIGGIFFDDLH-PAGDDGFERAFAFVSDGITTILDAYLPIVRRRMHTPYGERERMWQLY 236

Query: 268 RRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RRGRY EFNL+YD+GT FG +TGGN+E+IL S+PPL  W
Sbjct: 237 RRGRYVEFNLIYDRGTLFGLQTGGNIEAILMSLPPLARW 275


>gi|197725360|pdb|3E8J|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Naiffi
 gi|197725361|pdb|3E8J|B Chain B, Coproporphyrinogen Iii Oxidase From Leishmania Naiffi
          Length = 306

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 149/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 11  EAVKEFLLKLQDDICHAIEAEDEQA----------TFMEDKWTREGGG-----GGRTRVI 55

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         + A G+S+++HP NPHVP  H N+
Sbjct: 56  ANGAVIEKGGVNFSHVYGKGLPGSSTERHPDMAGCNYQAMGVSLVIHPKNPHVPTSHANV 115

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH+  +E+C       Y  +K
Sbjct: 116 RLFVAEKEGKEPVWWFGGGFDLTPY-----YAVEEDCYYFHHVAQELCRPFGADVYERFK 170

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++PHR E+RGIGG+FFD L+  P     +  F+F+ AVG  FI  Y  +V R 
Sbjct: 171 AWCDEYFFIPHRNEARGIGGLFFDDLNEWP----FEKCFAFMQAVGKGFIDAYIPIVNRR 226

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 227 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILMSLPPRARW 280


>gi|33597012|ref|NP_884655.1| coproporphyrinogen III oxidase [Bordetella parapertussis 12822]
 gi|33600854|ref|NP_888414.1| coproporphyrinogen III oxidase [Bordetella bronchiseptica RB50]
 gi|41017144|sp|Q7W7U0|HEM6_BORPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|41017147|sp|Q7WL80|HEM6_BORBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33566463|emb|CAE37716.1| coproporphyrinogen III oxidase [Bordetella parapertussis]
 gi|33568454|emb|CAE32366.1| coproporphyrinogen III oxidase [Bordetella bronchiseptica RB50]
          Length = 303

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 111/295 (37%), Positives = 148/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  I    E+   EA           F    W R +      GGG    L  
Sbjct: 9   VRDYLTDLQGRIVAALEQAGGEA-----------FRTDAWQRAEG-----GGGVSRLLEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G++FE+A VL S V G   P              + A G+S+++HP NP+VP  H N+RM
Sbjct: 53  GQLFERAGVLFSHVKGTRLPPSASAHRPELAGRGWEAMGVSMVLHPRNPYVPTTHMNVRM 112

Query: 141 IVT---------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            V            +WFGGG+DLTP        ++ D   FH   ++    H    Y  Y
Sbjct: 113 FVAAARPGHAESDVFWFGGGLDLTPYYP-----FEDDARHFHRACRDALDPHGADYYPRY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YF+L HR E+RGIGGIFFD L+      G DA F+   +VGD F+  Y  +V+ 
Sbjct: 168 KQWCDEYFFLKHRNETRGIGGIFFDDLNDP----GFDASFALTRSVGDSFLPAYLPIVQA 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 RRDMPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|146298712|ref|YP_001193303.1| coproporphyrinogen III oxidase [Flavobacterium johnsoniae UW101]
 gi|146153130|gb|ABQ03984.1| Coproporphyrinogen oxidase [Flavobacterium johnsoniae UW101]
          Length = 300

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 110/296 (37%), Positives = 154/296 (52%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K       +NLQ  IC   E ++  A           F    W R      + GGGR   
Sbjct: 2   KDKFYAYIQNLQDQICAGLEAVDGTA----------KFREDLWKR-----PEGGGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G VFEK  V +S V+G L    +        +  F+A GLS+++HP NP VP VH N
Sbjct: 47  IENGAVFEKGGVNISAVHGKLPETMQKMFGVGEAD--FFACGLSLVIHPKNPMVPTVHAN 104

Query: 138 IRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + ++ D   FH T K  C +H    Y  
Sbjct: 105 WRYFEMYNESGKVIEQWFGGGQDLTPY-----YLFEEDGKHFHQTCKTACDKHNPEFYPK 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK+ CD YF+  HR E+RG+GG+FFD+  ++ +M   +  + F++ VG+ F++ Y  +V 
Sbjct: 160 YKKQCDSYFWNAHRNEARGLGGLFFDYCKANEQMPM-ENWYDFVTEVGNSFLEAYVPIVE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  ++ ++R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 219 KRKNLEYTSENRNWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|113954279|ref|YP_729695.1| coproporphyrinogen III oxidase [Synechococcus sp. CC9311]
 gi|113881630|gb|ABI46588.1| coproporphyrinogen III oxidase, aerobic [Synechococcus sp. CC9311]
          Length = 348

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 109/311 (35%), Positives = 149/311 (47%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +  ++   + LQ+ IC   E+L+  AH          F  + W R      + GGGR   
Sbjct: 16  RTRARALVQGLQNEICAGLEQLDGSAH----------FQEESWDR-----PEGGGGRSRV 60

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFE+  V  S V+G   P    +     K   ++ATG S+++HP NP +P VH N
Sbjct: 61  MTEGRVFEQGGVNFSEVHGKELPPSILKQRPDAKGHPWFATGTSMVLHPRNPFIPTVHLN 120

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH   K  C       YT +K WCD
Sbjct: 121 YRYFEAGPVWWFGGGADLTPFYP-----FLEDARHFHREHKRACDSIDPKLYTVFKPWCD 175

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSS---------------------PEMGGIDADFSFIS 235
            YF+L HR+E+RGIGGIF+D+   S                         G D       
Sbjct: 176 EYFFLKHRKETRGIGGIFYDYQDGSGRLYRGQDPEGPAARQAADIGSFRLGWDQLHDLAR 235

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  +V +     + E++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 236 ACGQAFLPAYTPIVEKRNPLPYGERERQFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTES 295

Query: 296 ILASMPPLVAW 306
           IL S+PP+  W
Sbjct: 296 ILMSLPPMARW 306


>gi|92114980|ref|YP_574908.1| coproporphyrinogen III oxidase [Chromohalobacter salexigens DSM
           3043]
 gi|122419276|sp|Q1QTJ9|HEM6_CHRSD RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|91798070|gb|ABE60209.1| coproporphyrinogen oxidase [Chromohalobacter salexigens DSM 3043]
          Length = 307

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 145/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  +C      E +            F    W R+       GGGR   +
Sbjct: 7   DKVKEYLLDLQDRLCDGLAAEEGDTA----------FREDSWTRE-----AGGGGRSRVI 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFEK  V  S V+G+  P              F A G+S ++HP NPHVP  H N+
Sbjct: 52  ENGEVFEKGGVNFSHVFGERLPASASAARPELAGRSFHAVGVSWVLHPRNPHVPTAHGNV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP           DV+ +H   +E C+      Y  +K
Sbjct: 112 RFFIAEKEGAEPVWWFGGGFDLTPFYP-----VFEDVVHWHRVAQETCAPFGDDVYPRFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF L HR E+RG+GG+FFD L+        +  F+F  AVGD F++ Y  +VRR 
Sbjct: 167 RWCDEYFTLHHRDETRGVGGLFFDDLNEWE----FERCFAFQRAVGDAFLEAYVPIVRRR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 223 QATEYGERERDFQAFRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLAQW 276


>gi|293604472|ref|ZP_06686877.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
 gi|292817053|gb|EFF76129.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
          Length = 303

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 110/295 (37%), Positives = 148/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +     LQ+ I    E  E              F    W+R      + GGG    L  
Sbjct: 9   VRDYLTGLQARIVQALEAAEG-----------GPFRADEWVR-----PEGGGGLSRLLEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           GK+FE+A VL S V G   P              + A G+S+++HP NP+VP  H N+RM
Sbjct: 53  GKLFERAGVLFSHVKGTKLPPSASAHRPELAGRAWEAMGVSMVLHPRNPYVPTTHMNVRM 112

Query: 141 I---------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
                         +WFGGGIDLTP        ++ D   FH   ++  + H    Y  Y
Sbjct: 113 FVAAARPGHDEADIFWFGGGIDLTPYYP-----FEEDARHFHTVCRDALASHGPEYYPRY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YF+L HR E+RGIGG+FFD L++     G DA F+   +VGD F+  Y  +V R
Sbjct: 168 KRWCDEYFFLKHRNETRGIGGVFFDDLNAP----GFDASFALTRSVGDAFLDSYLPIVER 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                ++E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 224 RRGLAYTERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPMAQW 278


>gi|87200549|ref|YP_497806.1| coproporphyrinogen III oxidase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136230|gb|ABD26972.1| Coproporphyrinogen oxidase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 287

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 124/297 (41%), Positives = 175/297 (58%), Gaps = 14/297 (4%)

Query: 12  DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD-KSQKEDL 70
            +  +    ++  FE+L+  IC EFE +E EA  +        F    W R+ + +  + 
Sbjct: 2   SNWTDHTARARTWFESLRDRICAEFEAIEREAGSD------ARFAYTPWNREHEGETVEN 55

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-PYFWATGLSVIVHPYNP 129
           GGG +  L  G+VFEK  V VSTV G+ S +F   I G + + P F ATG+S++ H  NP
Sbjct: 56  GGGGVQGLMKGRVFEKVGVNVSTVQGEFSKEFAGTINGASADAPGFTATGISLVAHMANP 115

Query: 130 HVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
           HVPAVH N R + T   WFGGG DL P +      Y+ D + FH   K  C +H    Y 
Sbjct: 116 HVPAVHMNTRFLTTSKAWFGGGGDLNPPIP-----YEEDTVEFHAEYKAACDRHDPEYYP 170

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K+W D YF++PHR+  RG+GGIF+DHL  + +    +A+F+F   VG+ FI ++P LV
Sbjct: 171 RFKKWADDYFWIPHRKVHRGVGGIFYDHLECADDAA-FEANFAFTRDVGEAFINVFPRLV 229

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           RR     F+  ++  QL  RGRYAEFNL++D+GT FG KTGGN+++IL S+PP   W
Sbjct: 230 RRRMGMDFTPAEKLTQLEYRGRYAEFNLVWDRGTLFGLKTGGNIDAILMSLPPEAVW 286


>gi|87120980|ref|ZP_01076872.1| coproporphyrinogen III oxidase [Marinomonas sp. MED121]
 gi|86163818|gb|EAQ65091.1| coproporphyrinogen III oxidase [Marinomonas sp. MED121]
          Length = 337

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 106/295 (35%), Positives = 144/295 (48%), Gaps = 31/295 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +    +LQ  IC   E  E              F    W R+     + GGGR   +
Sbjct: 24  AEVKAFLMDLQDRICASLEMFE----------PQTRFQEDAWERE-----NGGGGRTRVI 68

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+V EK  V  S V G   P              F A G+S+++HP NP+ P  H N+
Sbjct: 69  ADGEVIEKGGVNFSHVMGSQLPPSATAARPELAGGSFEAMGVSLVIHPKNPYAPTSHANV 128

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      + +D D   +H +  E C       Y  +K
Sbjct: 129 RLFVVHKEGMDPVWWFGGGFDLTPY-----YGFDEDCTQWHQSALEACEPFGEHYYDKFK 183

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR E RGIGG+FFD         G +  F  + +VGD F+K Y  ++ + 
Sbjct: 184 DWCDEYFYLKHRGEPRGIGGLFFDDFSE----LGFEQSFGLMRSVGDSFMKAYHPILAKR 239

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTG-GNVESILASMPPLVAW 306
               + E++R  QL RRGRY EFNL++D+GT+FG ++G G  ESIL S+PP V W
Sbjct: 240 LDTPYGERERDFQLHRRGRYVEFNLVFDRGTHFGLQSGAGRTESILMSLPPEVKW 294


>gi|253998090|ref|YP_003050153.1| coproporphyrinogen III oxidase [Methylovorus sp. SIP3-4]
 gi|253984769|gb|ACT49626.1| Coproporphyrinogen oxidase [Methylovorus sp. SIP3-4]
          Length = 299

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
                  + LQS I    E ++ +            F    W R      + GGG    L
Sbjct: 4   DAVYDYLQGLQSRIVEAIELIDGK-----------NFLNDSWQR-----PEGGGGTSCLL 47

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G+  P              + A G+S++ HP NP++P VH N+
Sbjct: 48  EEGNVFERAGVGFSHVIGNKLPPSASVAHPEAAGRSWKAMGVSLVFHPRNPYIPTVHMNV 107

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG+DLTP      + ++ D I FH   +E  +      Y  +K
Sbjct: 108 RFFVAEKPGEEPIWWFGGGMDLTPY-----YGFEEDAIHFHRLCREALAPFGSQYYPAFK 162

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YF+L HR+E RGIGGIFFD  +      G +  F+ I  VGD FI+ Y  +V+R 
Sbjct: 163 QHCDEYFHLKHRKEPRGIGGIFFDDFNE----LGFEQSFALIRNVGDAFIQAYMPIVQRR 218

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL+YD+GT FG ++ G  ESIL SMPP+V W
Sbjct: 219 KDMAYGERERDFQAYRRGRYVEFNLVYDRGTLFGLQSNGRTESILLSMPPIVKW 272


>gi|154331237|ref|XP_001562058.1| coproporphyrinogen iii oxidase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134059380|emb|CAM37084.1| coproporphyrinogen III oxidase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 301

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 6   EAVKEFLLKLQDDICHAIEAEDEQA----------TFMEDKWTREGGG-----GGRTRVI 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         + A G+S+++HP NPHVP  H N+
Sbjct: 51  ANGTVIEKGGVNFSHVYGKGLPGSSTERHPDMAGCNYQAMGVSLVIHPKNPHVPTSHANV 110

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH+  +E+C       Y  +K
Sbjct: 111 RLFVAEKEGKEPVWWFGGGFDLTPY-----YAVEEDCYYFHHVAQELCRPFGADVYARFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++PHR E+RGIGG+FFD L   P     +  F+F+ AVG  FI  Y  +V R 
Sbjct: 166 AWCDEYFFIPHRNEARGIGGLFFDDLSEWP----FEKCFAFMQAVGKGFIDAYIPIVNRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 222 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILMSLPPRARW 275


>gi|326562518|gb|EGE12835.1| coproporphyrinogen III oxidase [Moraxella catarrhalis 103P14B1]
          Length = 320

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 151/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVREFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFTTCFQFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  RN H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFERNKHRSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|291221339|ref|XP_002730678.1| PREDICTED: GK18283-like [Saccoglossus kowalevskii]
          Length = 374

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 120/304 (39%), Positives = 161/304 (52%), Gaps = 36/304 (11%)

Query: 15  EERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGR 74
           ++ K+  +     LQ+ IC  FE LE            K F V+ W R +      GGG 
Sbjct: 69  DDMKKRMELYILQLQADICRRFENLE----------QSKKFQVERWERKEG-----GGGI 113

Query: 75  MATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKN-----PYFWATGLSVIVHPYNP 129
              L  G VFEKA V +S V G+L P+   Q+    KN       F+A G+S ++HP NP
Sbjct: 114 SCILQDGSVFEKAGVNISVVTGELPPEAVKQMKSRGKNIGEGKLPFFAAGISSVIHPRNP 173

Query: 130 HVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
            VP VHFN R            +WFGGG DLTP    +      DV+ FH TLKE C +H
Sbjct: 174 MVPTVHFNYRYFEIDEGNGKTTWWFGGGTDLTPYYLDK-----EDVVHFHKTLKEACDKH 228

Query: 184 AVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK 243
              +Y  +K+WCD YF++ HR E RG+GGIFFD L         +  F FI + G+  + 
Sbjct: 229 DKKHYIDFKKWCDDYFFVTHRGERRGVGGIFFDDLDKP----SQEDCFKFIQSCGNAIMP 284

Query: 244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPP 302
            Y  +V ++ +  F  ++R+ QL+RRGRY EFNL+YD+GT FG  T G  +ESIL S+P 
Sbjct: 285 SYEPIVEKHKNENFGYKERRWQLLRRGRYVEFNLVYDRGTKFGLYTPGARIESILMSLPL 344

Query: 303 LVAW 306
              W
Sbjct: 345 TARW 348


>gi|116072595|ref|ZP_01469861.1| coproporphyrinogen III oxidase [Synechococcus sp. BL107]
 gi|116064482|gb|EAU70242.1| coproporphyrinogen III oxidase [Synechococcus sp. BL107]
          Length = 379

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 108/325 (33%), Positives = 154/325 (47%), Gaps = 46/325 (14%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
             +E+   D     +  ++     LQ  IC   E L+ E            F  + W+R 
Sbjct: 37  PQLELPPTDS----RDRARSMVMGLQDEICAGLEALDGE----------GRFQEESWVR- 81

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   +  G+VFE+  V  S V G+  P    +     K   ++ATG S++
Sbjct: 82  ----PEGGGGRSRVMREGRVFEQGGVNFSEVQGNELPPSILKQRPEAKGHPWFATGTSMV 137

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP++P VH N R       +WFGGG DLTP        +  D   FH T ++ C+ 
Sbjct: 138 LHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYP-----FLDDARHFHRTHQQACNS 192

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHS---------------------S 221
                +  +K WCD YFYL HR E+RG+GGIF+D+  S                      
Sbjct: 193 VHPNLHKVFKPWCDEYFYLKHRNETRGVGGIFYDYQDSRGTLYKGQDPTGAAAKVSSELG 252

Query: 222 PEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
                 +  FS   A G  F+  Y  +V + +   + +++R  QL RRGRY EFNL++D+
Sbjct: 253 ATPLSWEQLFSLGQANGRAFLPSYAPIVEKRHATSYGDRERDFQLYRRGRYVEFNLVWDR 312

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPLV W
Sbjct: 313 GTIFGLQTNGRTESILMSLPPLVRW 337


>gi|71899722|ref|ZP_00681874.1| Coproporphyrinogen oxidase [Xylella fastidiosa Ann-1]
 gi|71730517|gb|EAO32596.1| Coproporphyrinogen oxidase [Xylella fastidiosa Ann-1]
          Length = 331

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 148/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++ ++H          F   HW R +      GGGR   L
Sbjct: 31  DRVRDYLTALQDRICNVVETIDGQSH----------FHEDHWQRTEG-----GGGRTRLL 75

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP NP VP  H N+
Sbjct: 76  RDGAVFEQAGIGFSDVCGTHLPPSASVRRPELAGANWCACGVSLVFHPKNPFVPTTHLNV 135

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV+ +H   +++C+      Y  +K
Sbjct: 136 RYFRAERDGKQVAAWFGGGFDLTPFYP-----FDEDVVHWHTVARDLCAPFGDERYAAHK 190

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 191 RWCDEYFVLRHRNETRGVGGLFFDDLD-----KDFERDFAYQRAVGDGFLDAYFPIVTRR 245

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   + +++R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 246 HDTPYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 299


>gi|322488363|emb|CBZ23610.1| putative coproporphyrinogen III oxidase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 301

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 147/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 6   EAVKDFLLKLQDDICEAIEAEDGQAM----------FMEDKWTREGGG-----GGRTRVI 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP +PHVP  H N+
Sbjct: 51  ANGAVIEKGGVNFSHVYGKGMPGSSTERHPDMAGCNFQAMGVSLVIHPKSPHVPTSHANV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH   +++C       Y  +K
Sbjct: 111 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRYFHQVAQDLCKPFGADVYARFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++PHR E+RGIGG+FFD L+  P     +  F F+ AVG  FI  Y  +V R 
Sbjct: 166 TWCDEYFFIPHRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGFIDAYIPIVNRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 222 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 275


>gi|56459135|ref|YP_154416.1| coproporphyrinogen III oxidase [Idiomarina loihiensis L2TR]
 gi|62510577|sp|Q5QXJ4|HEM6_IDILO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|56178145|gb|AAV80867.1| Coproporphyrinogen III oxidase [Idiomarina loihiensis L2TR]
          Length = 304

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 115/294 (39%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +    +LQ  IC +  + + E            F    W R        GGGR   +
Sbjct: 7   KQVKSYLMSLQDAICQQLAQADGEQS----------FQEDSWDR-----PGGGGGRSRIM 51

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+  V  S VYG+  P          +   F A G+S+++HP NP VP VH N+
Sbjct: 52  KNGAVFEQGGVGFSHVYGEKMPASATAHRPELEGRDFNACGVSLVMHPENPMVPTVHMNV 111

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        +D D+I +H   K          Y  YK
Sbjct: 112 RFFIAQKEGEEPVWWFGGGFDLTPFYP-----FDQDIIEWHQQAKNALDSVDEKLYPEYK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E+RG+GGIFFD L+        D  FS I AVGD F K Y  +V R 
Sbjct: 167 AWCDDYFFLKHRDEARGVGGIFFDDLND----RSFDECFSVIKAVGDAFTKAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  +++Q R  QL RRGRY EFNL++D+GT FG +TGG  ESIL SMPPL  W
Sbjct: 223 KNLAYTQQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|89900862|ref|YP_523333.1| coproporphyrinogen III oxidase [Rhodoferax ferrireducens T118]
 gi|89345599|gb|ABD69802.1| Coproporphyrinogen oxidase [Rhodoferax ferrireducens T118]
          Length = 310

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 149/294 (50%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
                  + LQ+ I      +++ A           F +  W +   +    G G    L
Sbjct: 12  EAVSSYLQGLQARITAAIADIDDTA-----------FLLDAWQKPAGE-LLQGKGITQIL 59

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A    S V G   P    Q         F A G+S++ HP NP VP VH N+
Sbjct: 60  EGGPVFERAGCGFSKVSGPRLPPSATQHRPELAGAPFDAMGVSLVFHPRNPFVPTVHMNV 119

Query: 139 RMIV------TGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM+       T   WFGGG+DLTP      + ++ DV  FH+T K   +      Y  +K
Sbjct: 120 RMLAAKAADGTQVCWFGGGMDLTPY-----YGFEEDVRHFHSTCKATLAPFGDDKYPRFK 174

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YFYL HR E RG+GGIFFD         G +   + + AVGD F+  Y  +V R 
Sbjct: 175 TWCDDYFYLKHRAEPRGVGGIFFDDFSE----LGFEGSLAMMQAVGDSFLNAYLPIVERR 230

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            + ++ +++R+ QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPPL +W
Sbjct: 231 KNTVYGKREREFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPLASW 284


>gi|33593304|ref|NP_880948.1| coproporphyrinogen III oxidase [Bordetella pertussis Tohama I]
 gi|41017141|sp|Q7VWE7|HEM6_BORPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|33572660|emb|CAE42583.1| coproporphyrinogen III oxidase [Bordetella pertussis Tohama I]
 gi|332382713|gb|AEE67560.1| coproporphyrinogen III oxidase [Bordetella pertussis CS]
          Length = 303

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 111/295 (37%), Positives = 148/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +    +LQ  I    E+   EA           F    W R +      GGG    L  
Sbjct: 9   VRDYLTDLQGRIVAALEQAGGEA-----------FRTDAWQRAEG-----GGGVSRLLEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G++FE+A VL S V G   P              + A G+S+++HP NP+VP  H N+RM
Sbjct: 53  GQLFERAGVLFSHVKGTRLPPSASAHRPELAGRGWEAMGVSMVLHPRNPYVPTTHMNVRM 112

Query: 141 IVT---------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
            V            +WFGGG+DLTP        ++ D   FH   ++    H    Y  Y
Sbjct: 113 FVAAARPGHAESDVFWFGGGLDLTPYYP-----FEDDARHFHRACRDALDPHGADYYPRY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K+WCD YF+L HR E+RGIGGIFFD L+      G DA F+   +VGD F+  Y  +V+ 
Sbjct: 168 KQWCDEYFFLKHRNETRGIGGIFFDDLNEP----GFDASFALTCSVGDSFLPAYLPIVQA 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 RRDMPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|182680587|ref|YP_001828747.1| coproporphyrinogen III oxidase [Xylella fastidiosa M23]
 gi|182630697|gb|ACB91473.1| Coproporphyrinogen oxidase [Xylella fastidiosa M23]
          Length = 331

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 148/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++ ++H          F   HW R +      GGGR   L
Sbjct: 31  DRVRDYLTALQDRICNVVETIDGQSH----------FHQDHWQRTEG-----GGGRTRLL 75

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+AA+  S V G   P              + A G+S++ HP NP VP  H N+
Sbjct: 76  RDGAVFEQAAIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNV 135

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV+ +H   +++C+      Y  +K
Sbjct: 136 RYFRAEREGKQVAAWFGGGFDLTPFYP-----FDEDVVHWHTVARDLCAPFGDERYAAHK 190

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF L HR E+RG+GG+FFD L         + DF +  AVGD F+  Y  +V R 
Sbjct: 191 RWCDEYFVLRHRNETRGVGGLFFDDLD-----KDFERDFDYQRAVGDGFLDAYFPIVTRR 245

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   + +++R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 246 HDTPYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 299


>gi|322496645|emb|CBZ31715.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 301

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 6   EAVKDFLVKLQDDICEALEAEDGQA----------TFMEDKWTREGGG-----GGRTRVM 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 51  VNGAVIEKGGVNFSHVYGKGLPGSSTERHPDMTGCNFQAMGVSLVIHPKNPHVPTSHANV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH   +++C       YT +K
Sbjct: 111 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRYFHQVAQDLCKPFGADVYTRFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  +I  Y  +V R 
Sbjct: 166 VWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYIDAYIPIVNRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 222 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 275


>gi|87300941|ref|ZP_01083783.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 5701]
 gi|87284812|gb|EAQ76764.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 5701]
          Length = 361

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 107/311 (34%), Positives = 150/311 (48%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +  ++     LQ  IC   + L+ E           +F  + W R      + GGGR   
Sbjct: 29  RARARTLLMGLQDSICAGLQALDGE----------GVFQEESWER-----PEGGGGRSRV 73

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           + AG++FE+  V  S V GD  P              ++ATG S+++HP NP+VP VH N
Sbjct: 74  MKAGRIFEQGGVNFSEVEGDQLPPSILSQRPEAAGQRWFATGTSMVLHPRNPYVPTVHLN 133

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH +L+  C       Y  +K WCD
Sbjct: 134 YRYFEAGPVWWFGGGADLTPYYP-----FLADARHFHRSLQGACDSVDPTLYPVFKPWCD 188

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSP---------------------EMGGIDADFSFIS 235
            YF+L HR E+RG+GGIF+D+   +                           +  F   S
Sbjct: 189 EYFFLKHRNETRGVGGIFYDYQDPAGALYKGQNPSGPAAAVAAATGAVPRSWEQLFQLAS 248

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G+ F+  Y  +V + +   + E++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 249 ACGNAFLPSYVPIVGKRHGSAYGERERQFQLYRRGRYVEFNLVFDRGTIFGLQTNGRTES 308

Query: 296 ILASMPPLVAW 306
           IL S+PPLV W
Sbjct: 309 ILMSLPPLVRW 319


>gi|296136792|ref|YP_003644034.1| Coproporphyrinogen oxidase [Thiomonas intermedia K12]
 gi|295796914|gb|ADG31704.1| Coproporphyrinogen oxidase [Thiomonas intermedia K12]
          Length = 320

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 146/297 (49%), Gaps = 27/297 (9%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
            +    +    +LQ+ I    +  + +            F    W R        G G  
Sbjct: 17  MQTEQVRSYLLDLQARILEALQAADGQ-----------PFRRDTWTRPA-DSPLQGEGIS 64

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
           + +  G + E+     S V G   P    Q         F A G+S++ HP NP+VP VH
Sbjct: 65  SLIEFGGLLERGGCNFSHVRGPKLPPSATQHRPELAGAPFEALGISLVFHPTNPYVPTVH 124

Query: 136 FNIRMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+RM++          WFGGG+DLTP      + ++ D   FH T +   +     +Y 
Sbjct: 125 MNVRMLMAEPEGQAPVAWFGGGMDLTPY-----YGFEDDARHFHRTCQAALAPFGDDHYP 179

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YF+L HR E RGIGG+FFD  +     GG +  F+ + AVGD F+  Y  +V
Sbjct: 180 RFKAWCDEYFFLKHRNEPRGIGGVFFDDYNE----GGFEQSFALMRAVGDAFLPAYVPIV 235

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  Q  RRGRY EFNL++D+GT+FG ++GG  ESIL SMPP+V W
Sbjct: 236 ERRRALPYGERERDFQAYRRGRYVEFNLVWDRGTHFGLQSGGRTESILMSMPPIVKW 292


>gi|86141064|ref|ZP_01059623.1| coproporphyrinogen III oxidase [Leeuwenhoekiella blandensis MED217]
 gi|85833006|gb|EAQ51455.1| coproporphyrinogen III oxidase [Leeuwenhoekiella blandensis MED217]
          Length = 300

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 111/296 (37%), Positives = 155/296 (52%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K       +NLQ  I ++ E ++ +A           F    W R +      GGGR   
Sbjct: 2   KEQFVSYIKNLQDQITSKLEAIDGKA----------TFKEDLWKRAEG-----GGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G V EK  V +S V+G L+P  +        +  F+A GLS+++HP NP+ P VH N
Sbjct: 47  IEDGNVIEKGGVNISEVHGPLAPAMQQYF--NVGDVDFFACGLSLVIHPKNPYAPTVHAN 104

Query: 138 IRMIVT-------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + ++ D   FH T K  C +H    Y  
Sbjct: 105 WRYFEMLDKAGNLVDSWFGGGQDLTPY-----YLFEEDAQHFHQTCKTACDKHDPEFYPQ 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK  CD YFY  HR E+RG+GG+FFD+L ++ E    D  ++F++ VGD F+  Y  ++ 
Sbjct: 160 YKMRCDEYFYNAHRGEARGLGGLFFDYLKATDERSMQDW-YNFVTEVGDSFLTAYAPILE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +     + E++R  Q +RRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 219 KRKDLAYGEKERDWQEVRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPAVQW 274


>gi|313200155|ref|YP_004038813.1| coproporphyrinogen oxidase [Methylovorus sp. MP688]
 gi|312439471|gb|ADQ83577.1| Coproporphyrinogen oxidase [Methylovorus sp. MP688]
          Length = 299

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 147/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
                  + LQS I    E ++ +            F    W R      + GGG    L
Sbjct: 4   DAVYDYLQGLQSRIVEAIELIDGK-----------NFLNDSWQR-----PEGGGGTSCLL 47

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V G+  P              + A G+S++ HP NP++P VH N+
Sbjct: 48  EEGNVFERAGVGFSHVIGNKLPPSASVAHPEAAGRSWKAMGVSLVFHPRNPYIPTVHMNV 107

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG+DLTP      + ++ D I FH   +E  +      Y  +K
Sbjct: 108 RFFVAEKPGEEPIWWFGGGMDLTPY-----YGFEEDAIHFHRLCREALTPFGSQYYPAFK 162

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YF+L HR+E RGIGGIFFD  +      G +  F+ I  VGD FI+ Y  +V+R 
Sbjct: 163 QHCDEYFHLKHRKEPRGIGGIFFDDFNE----LGFEQSFALIRNVGDAFIQAYMPIVQRR 218

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL+YD+GT FG ++ G  ESIL SMPP+V W
Sbjct: 219 KDMAYGERERDFQAYRRGRYVEFNLVYDRGTLFGLQSNGRTESILLSMPPIVKW 272


>gi|9104779|gb|AAF82830.1|AE003856_9 coproporphyrinogen III oxidase, aerobic [Xylella fastidiosa 9a5c]
          Length = 319

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 148/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++ ++H          F   HW R +      GGGR   L
Sbjct: 19  DRVRDYLTALQDRICNVVETIDGQSH----------FHEDHWQRTEG-----GGGRTRLL 63

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP NP VP  H N+
Sbjct: 64  RDGAVFEQAGIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNV 123

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV+ +H   +++C+      Y  +K
Sbjct: 124 RYFRAERDGKQVAAWFGGGFDLTPFYP-----FDEDVVHWHTVARDLCAPFGDERYAAHK 178

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 179 RWCDEYFVLRHRNETRGVGGLFFDDLD-----KDFERDFAYQRAVGDGFLDAYFPIVTRR 233

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   + +++R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 234 HDTPYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 287


>gi|209447546|pdb|3EJO|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Donovani
 gi|209447547|pdb|3EJO|B Chain B, Coproporphyrinogen Iii Oxidase From Leishmania Donovani
          Length = 310

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 15  EAVKDFLVKLQDDICEALEAEDGQA----------TFMEDKWTREGGG-----GGRTRVM 59

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 60  VNGAVIEKGGVNFSHVYGKGLPGSSTERHPDMTGCNFQAMGVSLVIHPKNPHVPTSHANV 119

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH   +++C       YT +K
Sbjct: 120 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRYFHQVAQDLCKPFGADVYTRFK 174

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  +I  Y  +V R 
Sbjct: 175 VWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYIDAYIPIVNRR 230

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 231 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 284


>gi|146071844|ref|XP_001463209.1| coproporphyrinogen iii oxidase [Leishmania infantum]
 gi|134067292|emb|CAM65562.1| coproporphyrinogen III oxidase [Leishmania infantum JPCM5]
          Length = 301

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 148/294 (50%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 6   EAVKDFLVKLQDDICEALEAEDGQA----------TFMEDKWTREGGG-----GGRTRVM 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 51  VNGAVIEKGGVNFSHVYGKGLPGSSTERHPDMTGCNFQAMGVSLVIHPKNPHVPTSHANV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D  +FH   +++C       YT +K
Sbjct: 111 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRYFHQVAQDLCKPFGADVYTRFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  +I  Y  +V R 
Sbjct: 166 VWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYIDAYIPIVNRR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 222 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 275


>gi|117618495|ref|YP_854793.1| coproporphyrinogen III oxidase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166217791|sp|A0KEX7|HEM6_AERHH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|117559902|gb|ABK36850.1| coproporphyrinogen III oxidase, aerobic [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 302

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  +              F    W R+          R    
Sbjct: 7   AQVKAFLLQLQDEICRGLELADG----------AGHFVEDAWRREGGGGGRTRVLR---- 52

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V E+  V  S V+GD  P              F A G+S+++HP+NP+VP  H N+
Sbjct: 53  -HGAVIEQGGVNFSHVHGDAMPASATAHRPELAGRRFEAMGVSLVIHPHNPYVPTSHANV 111

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP        ++ DV  +H   +++C       Y  +K
Sbjct: 112 RFFIAEKEGEEPIWWFGGGFDLTPFYP-----FEEDVRHWHQLSRDLCQPFGTDIYPEFK 166

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCDRYF+L HR E+RG+GG+FFD L+  P        F+F+ AVG  ++  Y  +V R 
Sbjct: 167 SWCDRYFFLKHRDETRGVGGLFFDDLNRWP----FADCFAFMQAVGKGYLDAYLPIVERR 222

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R+ QL RRGRY EFNL+YD+GT FG +TGG  ESIL SMPPL  W
Sbjct: 223 KALAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARW 276


>gi|238898379|ref|YP_002924060.1| coproporphyrinogen III oxidase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466138|gb|ACQ67912.1| coproporphyrinogen III oxidase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 312

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 151/294 (51%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC + +K+EN+                 W     +K + GGG    L
Sbjct: 8   NEIKTFLLFLQKKICDDIKKVENDGEC----------KETKW-----EKNEGGGGISCIL 52

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A V  S V+G   P              + A G+S+I+HP NP+VP  H N+
Sbjct: 53  SGGSVFEQACVNFSEVFGPSLPVSATLSRPELAGHAYRALGVSIIIHPINPYVPTSHANV 112

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  +         +WFGGG DLTP      + ++ D   +H T  ++C       Y  YK
Sbjct: 113 RFFMAEKPGVAPVWWFGGGFDLTPF-----YGFEEDARHWHQTACDLCQPFGNNRYQEYK 167

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YF+L HR E+RGIGG+FFD L+           F FI AVG+ F K Y  +V+R 
Sbjct: 168 KCCDDYFFLKHRNEARGIGGLFFDDLNKP----DFLNCFEFIQAVGNGFSKAYFPIVKRR 223

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + +++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 224 KIFSWGKRERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPLVRW 277


>gi|326559622|gb|EGE10036.1| coproporphyrinogen III oxidase [Moraxella catarrhalis 7169]
 gi|326560037|gb|EGE10432.1| coproporphyrinogen III oxidase [Moraxella catarrhalis 46P47B1]
 gi|326567698|gb|EGE17804.1| coproporphyrinogen III oxidase [Moraxella catarrhalis BC1]
          Length = 320

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 108/300 (36%), Positives = 150/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVREFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFMTCFKFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   N H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFEHNKHQSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|94495459|ref|ZP_01302039.1| Coproporphyrinogen oxidase [Sphingomonas sp. SKA58]
 gi|94424847|gb|EAT09868.1| Coproporphyrinogen oxidase [Sphingomonas sp. SKA58]
          Length = 294

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 183/305 (60%), Gaps = 13/305 (4%)

Query: 3   LCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR 62
           +       P  +++R++ ++  FE+L+  IC EFE +E EA  ++A      F    W R
Sbjct: 1   MTNPVPIVPFALDDRQQAARGWFESLRDRICAEFESIEREADSDAA------FAFMPWDR 54

Query: 63  D-KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           + + Q    GGG +  +  GKVFEK  V VSTV G+ +P F   I G  +NP F+ATG+S
Sbjct: 55  EAEGQAAGDGGGGVRGVMKGKVFEKVGVNVSTVGGEFAPGFAQTIHGADENPAFFATGIS 114

Query: 122 VIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           ++ H  NPHVPAVH N R +VT   WFGGG DL P L       + D   FH  LK+ C 
Sbjct: 115 LVAHMANPHVPAVHMNTRYLVTTKSWFGGGADLNPPLP-----REEDTAHFHAVLKDACD 169

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
            H   +Y  +K W D YF++PHR   RG+GGIF+DHL    +    DA+F+F  AVGD F
Sbjct: 170 AHDPDHYPRFKAWADDYFFIPHRGVHRGVGGIFYDHLECVDDAA-FDANFAFTRAVGDAF 228

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           +  +P +VRR     +S+ D +  L  RGRYAEFNL++D+GT FG KTGGN+++IL S+P
Sbjct: 229 LAAFPPIVRRRMGEPWSDADYRTMLEWRGRYAEFNLVHDRGTLFGLKTGGNIDAILMSLP 288

Query: 302 PLVAW 306
           P+ +W
Sbjct: 289 PMASW 293


>gi|296113628|ref|YP_003627566.1| coproporphyrinogen 3 oxidase [Moraxella catarrhalis RH4]
 gi|295921322|gb|ADG61673.1| coproporphyrinogen 3 oxidase [Moraxella catarrhalis RH4]
          Length = 320

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 151/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVREFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDGMNTASTNWDFMTCFKFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  RN H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFERNKHRSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|134296480|ref|YP_001120215.1| coproporphyrinogen III oxidase [Burkholderia vietnamiensis G4]
 gi|134139637|gb|ABO55380.1| Coproporphyrinogen oxidase [Burkholderia vietnamiensis G4]
          Length = 326

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 106/311 (34%), Positives = 144/311 (46%), Gaps = 29/311 (9%)

Query: 4   CTIEIGCPDDIEE--RKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
                  PD  +        +   + LQ+ I      L+                   W 
Sbjct: 12  PAAGAPSPDMTDSTYDVARVRTYLQGLQTRIADALGALDGT-----------PLATDAWQ 60

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLS 121
           R   ++   GG     L  G+VFE+A +  S V GD  P              F A G+S
Sbjct: 61  RGPEERLRGGGC-TRILEGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVS 119

Query: 122 VIVHPYNPHVPAVHFNIRMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNT 175
           +++HP NP+ P VH N+RM+          +WFGGG+DLTP        ++ D   FH T
Sbjct: 120 LVLHPRNPYCPTVHMNVRMLIATKPGEAPVFWFGGGMDLTPVYP-----FEDDARHFHQT 174

Query: 176 LKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFIS 235
            K          Y  +K WCD YF+L HR E+RGIGGIFFD         G +  F  + 
Sbjct: 175 CKAALDPFGAELYPRFKTWCDEYFFLKHRNETRGIGGIFFDDFSEP----GFERSFEMMQ 230

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           +VGD F+  Y  +V R     + E +R+ Q  RRGRY EFNL++D+GT FG ++GG  ES
Sbjct: 231 SVGDAFLNAYLPIVERRAALPYGEHEREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTES 290

Query: 296 ILASMPPLVAW 306
           IL SMPP+  W
Sbjct: 291 ILMSMPPVATW 301


>gi|126662826|ref|ZP_01733825.1| coproporphyrinogen III oxidase [Flavobacteria bacterium BAL38]
 gi|126626205|gb|EAZ96894.1| coproporphyrinogen III oxidase [Flavobacteria bacterium BAL38]
          Length = 300

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 115/296 (38%), Positives = 157/296 (53%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K       + LQ+ IC   E ++  A           F    W R      + GGGR   
Sbjct: 2   KNKFYTYIQTLQNQICEGLETIDGSA----------KFREDVWER-----PEGGGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G+VFEK  V +S V+G L    +        +  F+A GLS+++HP NP VP VH N
Sbjct: 47  IENGQVFEKGGVNISAVHGKLPNTMQKMFGVGEAD--FFACGLSLVIHPKNPMVPTVHSN 104

Query: 138 IRMIVTG-------AYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + ++ D   FH T K  C +H    Y +
Sbjct: 105 WRYFEMYDENGNIINQWFGGGQDLTPY-----YLFEEDAKHFHQTCKNACDKHNPEFYPN 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK+ CD YF+  HR E+RGIGG+FFD+L ++ +M  ++  F+F+S VG+ F++ Y  +V 
Sbjct: 160 YKKKCDEYFWNAHRFEARGIGGLFFDYLKATEQM-SMEDWFNFVSEVGNSFLQAYVPIVE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +     F+E  R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 219 KRKDLSFTEVQRTWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|311105294|ref|YP_003978147.1| coproporphyrinogen 3 oxidase aerobic [Achromobacter xylosoxidans
           A8]
 gi|310759983|gb|ADP15432.1| coproporphyrinogen 3 oxidase, aerobic [Achromobacter xylosoxidans
           A8]
          Length = 303

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 114/295 (38%), Positives = 148/295 (50%), Gaps = 34/295 (11%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +     LQ+ I    E  E  A           F    W+R      + GGG    L  
Sbjct: 9   VRDYLTGLQARIVGALEAAEGTA-----------FRSDEWVR-----PEGGGGLSRLLEG 52

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A VL S V G   P              + A G+S+++HP NPHVP  H N+RM
Sbjct: 53  GSLFERAGVLFSHVQGTKLPPSASAHRPELAGRSWEAMGVSMVLHPRNPHVPTTHMNVRM 112

Query: 141 I---------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHY 191
                         +WFGGGIDLTP        Y+ D   FH T ++  + H    Y  Y
Sbjct: 113 FLAAARPGHDEADVFWFGGGIDLTPYYP-----YEEDARHFHATCRDALAGHGADYYPRY 167

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRR 251
           K WCD YF+L HR E+RGIGGIF+D L++     G DA F+   +VGD F+  Y  +V R
Sbjct: 168 KRWCDEYFFLKHRNETRGIGGIFYDDLNAP----GFDASFALTRSVGDAFLPAYMPIVER 223

Query: 252 NYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
                + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPL  W
Sbjct: 224 RRGQTYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPLAQW 278


>gi|294340961|emb|CAZ89356.1| Coproporphyrinogen 3 oxidase, aerobic (Coproporphyrinogen III
           oxidase, aerobic) (Coproporphyrinogenase) (Coprogen
           oxidase) [Thiomonas sp. 3As]
          Length = 309

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 146/297 (49%), Gaps = 27/297 (9%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
            +    +    +LQ+ I    +  + +            F    W R        G G  
Sbjct: 6   MQTEQVRSYLLDLQARILEALQAADGQ-----------PFRRDTWTRPA-DSPLQGEGIS 53

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
           + +  G + E+     S V G   P    Q         F A G+S++ HP NP+VP VH
Sbjct: 54  SLIEFGGLLERGGCNFSHVRGPKLPPSATQHRPELAGAPFEALGISLVFHPTNPYVPTVH 113

Query: 136 FNIRMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+RM++          WFGGG+DLTP      + ++ D   FH T +   +     +Y 
Sbjct: 114 MNVRMLMAEPEGQAPVAWFGGGMDLTPY-----YGFEDDARHFHRTCQAALAPFGDDHYP 168

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K WCD YF+L HR E RGIGG+FFD  +     GG +  F+ + AVGD F+  Y  +V
Sbjct: 169 RFKAWCDEYFFLKHRNEPRGIGGVFFDDYNE----GGFEQSFALMRAVGDAFLPAYVPIV 224

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            R     + E++R  Q  RRGRY EFNL++D+GT+FG ++GG  ESIL SMPP+V W
Sbjct: 225 ERRRALPYGERERDFQAYRRGRYVEFNLVWDRGTHFGLQSGGRTESILMSMPPIVKW 281


>gi|52841447|ref|YP_095246.1| coproporphyrinogen III oxidase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628558|gb|AAU27299.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 316

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC   E ++ +            F    W R        GGG+   +
Sbjct: 18  EQIKSYLLQLQNTICVSLESIDGKT----------RFHEDSWQRA-----AGGGGKTRIM 62

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P             +F A G+S+++HP NP+VP  H N+
Sbjct: 63  ANGNVFEKAGVNFSHVSGEQLPASASAHREELAGRHFSALGVSLVIHPQNPYVPTTHANV 122

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP      + +  D   +H T    C       Y  +K
Sbjct: 123 RFFVAEKEDSEPVWWFGGGFDLTPY-----YGFVEDCEHWHQTALNACLPFGETIYPKFK 177

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++ HR E+RGIGG+FFD  +        D  F  + ++GD FI  Y  +V R 
Sbjct: 178 RWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFELMRSIGDHFILAYEPIVARR 233

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F  +++  Q  RRGRYAEFNL+YD+GT FG ++GG  ESIL S+PP+V W
Sbjct: 234 KDIPFGNREKAFQNYRRGRYAEFNLVYDRGTLFGLQSGGRTESILMSLPPIVHW 287


>gi|326568665|gb|EGE18736.1| coproporphyrinogen III oxidase [Moraxella catarrhalis BC7]
          Length = 320

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 108/300 (36%), Positives = 150/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVRDFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFMTCFKFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   N H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFEHNKHQSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|326565540|gb|EGE15711.1| coproporphyrinogen III oxidase [Moraxella catarrhalis 12P80B1]
 gi|326568843|gb|EGE18913.1| coproporphyrinogen III oxidase [Moraxella catarrhalis BC8]
 gi|326574256|gb|EGE24204.1| coproporphyrinogen III oxidase [Moraxella catarrhalis 101P30B1]
          Length = 320

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 108/300 (36%), Positives = 150/300 (50%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVRDFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
           R   L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  RSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFMTCFKFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   N H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFEHNKHQSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|114321781|ref|YP_743464.1| coproporphyrinogen III oxidase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228175|gb|ABI57974.1| coproporphyrinogen oxidase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 304

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 115/290 (39%), Positives = 148/290 (51%), Gaps = 30/290 (10%)

Query: 23  RKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGK 82
              + LQ  IC E  +L+            +                 GGGR   L  G 
Sbjct: 10  DYLKELQDRICHELAELDGGPGFEEETWEREE---------------GGGGRSRVLKHGN 54

Query: 83  VFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIV 142
           +FE+A V  S V+G   PD             F A G+S+++HP NPHVP  H N+R  V
Sbjct: 55  LFEQAGVNFSHVFGKRLPDSATARRPELAGRGFQAMGVSLVLHPENPHVPTTHANVRYFV 114

Query: 143 T------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
                    +WFGGG DLTP      + Y  D + +H T +  C       Y  YK+WCD
Sbjct: 115 ADKAGSEPVWWFGGGFDLTPY-----YGYQEDAVHWHRTARAACEPFGAEVYPRYKQWCD 169

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHL 256
            YFYLPHR E+RGIGG+FFD L       G +  F+F+ +VGD F+  Y  +  R  H  
Sbjct: 170 EYFYLPHRGETRGIGGLFFDDLDDW----GFERSFAFMRSVGDHFLPAYRPIAERRRHQP 225

Query: 257 FSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + E++R  QL RRGRYAEFNLLYD+GT FG ++GG  ESIL SMPP+  W
Sbjct: 226 WGERERAFQLYRRGRYAEFNLLYDRGTRFGLQSGGRTESILMSMPPMARW 275


>gi|163754798|ref|ZP_02161920.1| coproporphyrinogen III oxidase, aerobic [Kordia algicida OT-1]
 gi|161325739|gb|EDP97066.1| coproporphyrinogen III oxidase, aerobic [Kordia algicida OT-1]
          Length = 300

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 106/296 (35%), Positives = 153/296 (51%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K +       LQ  I T  E ++ +A           F    W R      + GGGR   
Sbjct: 2   KDLFLNYIHQLQDKITTTLEAIDGKA----------TFQEDLWKR-----PEGGGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G +FEK  V +S V+G+L    +        +  F+A GLS+++HP NP +P VH N
Sbjct: 47  IENGAIFEKGGVNISAVHGELPEALRKNFKVEQGD--FFACGLSLVLHPKNPFIPTVHAN 104

Query: 138 IRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + ++ D   FH   K  C +H    Y  
Sbjct: 105 WRYFEMYDEEGNIVTQWFGGGQDLTPY-----YLFEEDATHFHTICKTACDKHHPEFYPK 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           +KE CD YF+  HR E+RG+GG+FFD+L  + E    D  ++F++ +G+ F+K Y  +V 
Sbjct: 160 FKETCDNYFWNAHRNEARGVGGLFFDYLKETEEFSMQDR-YNFVTEIGNSFLKSYVPIVE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           R  +  +++  +  Q +RRGRY EFNL++D+GT FG KT G +ESIL S+PP V W
Sbjct: 219 RRKNLEYTQAHKNWQEVRRGRYVEFNLVHDRGTLFGLKTNGRIESILMSLPPTVQW 274


>gi|269138481|ref|YP_003295181.1| coproporphyrinogen III oxidase [Edwardsiella tarda EIB202]
 gi|267984141|gb|ACY83970.1| coproporphyrinogen III oxidase [Edwardsiella tarda EIB202]
 gi|304558506|gb|ADM41170.1| Coproporphyrinogen III oxidase [Edwardsiella tarda FL6-60]
          Length = 329

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 112/292 (38%), Positives = 151/292 (51%), Gaps = 31/292 (10%)

Query: 21  SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCA 80
            +R    LQ  +C      +              F+   W R        G GR   L  
Sbjct: 32  VRRFLLRLQDNLCQALADADG----------GGAFSEDRWQR-----PQGGAGRTRVLRQ 76

Query: 81  GKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRM 140
           G +FE+A V  S ++G  S               F A G+S+++HP++P+VP  H N+R 
Sbjct: 77  GALFEQAGVNFSHIHG-DSLPAATAKRPELVGCPFQAMGVSLVLHPHSPYVPTAHANVRF 135

Query: 141 IVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEW 194
            +         +WFGGG DLTP        +  DVI +H + +++C       Y  YK W
Sbjct: 136 FIAERPGAAPLWWFGGGFDLTPFYP-----FYDDVIQWHRSARDLCRPFGEQLYPRYKAW 190

Query: 195 CDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYH 254
           CDRYFYLPHRQE+RG+GG+FFD L++       D  F+F  AVG+ F   Y  L  R  H
Sbjct: 191 CDRYFYLPHRQEARGVGGLFFDDLNAP----DFDQAFAFTRAVGEGFAPAYLPLAERRRH 246

Query: 255 HLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
             + E++RQ QL RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 247 LSWGERERQFQLYRRGRYVEFNLVWDRGTLFGLQSGGRSESILMSMPPLVRW 298


>gi|124266532|ref|YP_001020536.1| coproporphyrinogen III oxidase [Methylibium petroleiphilum PM1]
 gi|124259307|gb|ABM94301.1| coproporphyrinogen oxidase [Methylibium petroleiphilum PM1]
          Length = 306

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 141/294 (47%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +     LQ  I    E  +              F    W R+   K + G G    +
Sbjct: 5   QAVRDYLLGLQERIVAALEAEDG-----------GRFLSDRWTREPGGKLE-GEGLSRLI 52

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G++ E+     S V G   P    Q         F A G+S++ HP NP+VP VH N+
Sbjct: 53  EGGRLLERGGCSFSHVRGRALPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNV 112

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM+           WFGGG+DLTP      + ++ D   FH T ++  +      Y  +K
Sbjct: 113 RMLAAHRADGEIVTWFGGGMDLTPY-----YGFEEDAAHFHATCRDALAPFGDDKYPRFK 167

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GG+F+D         G D  F+   AVGD  +  Y  +V+R 
Sbjct: 168 QWCDEYFFLKHRNEPRGVGGVFYDDFSE----LGFDGSFAMTRAVGDALLAGYLPIVQRR 223

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP  AW
Sbjct: 224 QALPFGERERGFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPAAAW 277


>gi|148358802|ref|YP_001250009.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           pneumophila str. Corby]
 gi|296106847|ref|YP_003618547.1| coproporphyrinogen III oxidase [Legionella pneumophila 2300/99
           Alcoy]
 gi|62510599|sp|Q5ZW72|HEM6_LEGPH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|166217802|sp|A5IBB3|HEM6_LEGPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|148280575|gb|ABQ54663.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           pneumophila str. Corby]
 gi|295648748|gb|ADG24595.1| coproporphyrinogen III oxidase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 311

 Score =  311 bits (797), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC   E ++ +            F    W R        GGG+   +
Sbjct: 13  EQIKSYLLQLQNTICVSLESIDGKT----------RFHEDSWQRA-----AGGGGKTRIM 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P             +F A G+S+++HP NP+VP  H N+
Sbjct: 58  ANGNVFEKAGVNFSHVSGEQLPASASAHREELAGRHFSALGVSLVIHPQNPYVPTTHANV 117

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP      + +  D   +H T    C       Y  +K
Sbjct: 118 RFFVAEKEDSEPVWWFGGGFDLTPY-----YGFVEDCEHWHQTALNACLPFGETIYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++ HR E+RGIGG+FFD  +        D  F  + ++GD FI  Y  +V R 
Sbjct: 173 RWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFELMRSIGDHFILAYEPIVARR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F  +++  Q  RRGRYAEFNL+YD+GT FG ++GG  ESIL S+PP+V W
Sbjct: 229 KDIPFGNREKAFQNYRRGRYAEFNLVYDRGTLFGLQSGGRTESILMSLPPIVHW 282


>gi|56416886|ref|YP_153960.1| coproporphyrinogen III oxidase [Anaplasma marginale str. St.
           Maries]
 gi|222475251|ref|YP_002563667.1| coproporphyrinogen III oxidase (hemF) [Anaplasma marginale str.
           Florida]
 gi|56388118|gb|AAV86705.1| coproporphyrinogen III oxidase [Anaplasma marginale str. St.
           Maries]
 gi|222419388|gb|ACM49411.1| coproporphyrinogen III oxidase (hemF) [Anaplasma marginale str.
           Florida]
          Length = 292

 Score =  311 bits (796), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 118/294 (40%), Positives = 167/294 (56%), Gaps = 21/294 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K      F  L+  I  +F  +E E  ++           + W R+        GG
Sbjct: 18  MNEKKERVAGWFHELRDRIVDQFLAIEEEFSDSRPEI-----KRRTWDREGG------GG 66

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-GTTKNPYFWATGLSVIVHPYNPHVP 132
             + +  GKVFEKA V  STVYG +  +F  +I         FWA+G+SV+ H  +P VP
Sbjct: 67  GESVVIVGKVFEKAGVNFSTVYGVMDSNFACEIPGAQESGGDFWASGISVVAHMQSPFVP 126

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R + T   WFGGG+DLTP+        + D   FH  ++  C +     Y  +K
Sbjct: 127 AVHMNTRFMCTSKSWFGGGMDLTPTYYD-----EDDKTTFHEGIRAACDKFNPEYYPKFK 181

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYLPHR+E RG+GGIF+D+L +    G  + DF+F   VG CF+++Y ++VRRN
Sbjct: 182 QRCDEYFYLPHRKEMRGVGGIFYDNLCT----GNWEQDFAFTQEVGKCFLRVYSAIVRRN 237

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  +  ++R  QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 238 MHKTWGAEERNFQLLKRGRYVEFNLIYDRGTRFGLMTNGNPDAIMMSMPPLVRW 291


>gi|148238797|ref|YP_001224184.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 7803]
 gi|147847336|emb|CAK22887.1| Coproporphyrinogen III oxidase, aerobic [Synechococcus sp. WH 7803]
          Length = 355

 Score =  311 bits (796), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 105/311 (33%), Positives = 147/311 (47%), Gaps = 42/311 (13%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           +  ++     LQ  IC   E+++              F  + W+R      + GGGR   
Sbjct: 23  RERARSLVMALQDEICAGLEQIDGS----------GRFQEESWVR-----PEGGGGRSRV 67

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G++FE+  V  S V G   P    +     K   ++ATG S+++HP NP VP VH N
Sbjct: 68  MREGRIFEQGGVNFSEVQGQELPPSILKQRPEAKGHPWFATGTSMVLHPRNPFVPTVHLN 127

Query: 138 IRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCD 196
            R       +WFGGG DLTP        +  D   FH T ++ C       Y  +K WCD
Sbjct: 128 YRYFEAGPVWWFGGGADLTPFYP-----FLEDARHFHRTHQQACDSVDERLYQVFKPWCD 182

Query: 197 RYFYLPHRQESRGIGGIFFDHLHSSPE---------------------MGGIDADFSFIS 235
            YF+L HRQE+RG+GGIF+D+   S                           +  FS   
Sbjct: 183 EYFFLKHRQETRGVGGIFYDYQDGSGRLYRGQDPEGPAAQKASQIGAVPLSWEQLFSLAG 242

Query: 236 AVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVES 295
           A G  F+  Y  ++ R     + +++RQ QL RRGRY EFNL++D+GT FG +T G  ES
Sbjct: 243 ANGRAFLPAYAPIIERRNGMAYGDRERQFQLYRRGRYVEFNLVWDRGTIFGLQTNGRTES 302

Query: 296 ILASMPPLVAW 306
           IL S+PPL  W
Sbjct: 303 ILMSLPPLARW 313


>gi|325286459|ref|YP_004262249.1| Coproporphyrinogen oxidase [Cellulophaga lytica DSM 7489]
 gi|324321913|gb|ADY29378.1| Coproporphyrinogen oxidase [Cellulophaga lytica DSM 7489]
          Length = 300

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 109/296 (36%), Positives = 153/296 (51%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K       + LQ  I T+ E ++ +A           F    W R      + GGGR   
Sbjct: 2   KDKFYNYIQELQDTITTKLEAIDGDA----------KFKQDIWER-----PEGGGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G V EK  V +S V+G L    +        +  F+A GLS+++HP NP VP VH N
Sbjct: 47  IENGAVIEKGGVNISGVHGKLPESMQKYFGVE--DANFFACGLSLVLHPKNPMVPTVHAN 104

Query: 138 IRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + ++ D   FHN  K  C +H +  Y  
Sbjct: 105 WRYFEMYDTDGNIVDQWFGGGQDLTPY-----YLFNEDATHFHNVCKTACDKHNLEFYAK 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK  CD YF+  HR E+RG+GG+FFD+  ++  M   D  ++F++ VG+ F+  Y  +V 
Sbjct: 160 YKARCDEYFWNAHRNEARGVGGLFFDYCKATDAMSMQDW-YNFVTEVGNSFLDCYVPIVE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +     +++++R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 219 KRKELPYTKEERDWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|294013041|ref|YP_003546501.1| coproporphyrinogen III oxidase [Sphingobium japonicum UT26S]
 gi|292676371|dbj|BAI97889.1| coproporphyrinogen III oxidase [Sphingobium japonicum UT26S]
          Length = 283

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 130/298 (43%), Positives = 175/298 (58%), Gaps = 17/298 (5%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD-KSQKE 68
               ++ +++ ++  FE+L++ IC EFE +E EA  +        F    W R+      
Sbjct: 1   MTLTLDPQQQAARTWFESLRNRICAEFEAIEREAGSD------ARFDYIAWDREAPGLAP 54

Query: 69  DLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
             GGG +  +  GKVFEK  V VSTV G  SP+F   I G +++P F+ATG+S++ H  N
Sbjct: 55  GEGGGGVRGVMKGKVFEKVGVNVSTVGGAFSPEFAKTIHGASEDPSFFATGISLVAHMAN 114

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANY 188
           PHVPAVH N R +VT   WFGGG DL P L       D D   FH  LK  C  H    Y
Sbjct: 115 PHVPAVHMNTRYLVTSKRWFGGGADLNPPLP-----RDEDTAHFHAALKAACDAHDADYY 169

Query: 189 THYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSL 248
             +K W D YF++PHR   RG+GGIF+DHL      G  DA F+F   VG+ F++ +P +
Sbjct: 170 PRFKAWADDYFFIPHRGVHRGVGGIFYDHL-----EGDFDAGFAFTRDVGEAFLRAFPPI 224

Query: 249 VRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           VRR     +SE D +  L  RGRYAEFNL++D+GT FG KTGGNV++IL S+PP+ +W
Sbjct: 225 VRRRMGESWSEDDYRRMLEWRGRYAEFNLVHDRGTLFGLKTGGNVDAILMSLPPMASW 282


>gi|260219515|emb|CBA26360.1| Coproporphyrinogen-III oxidase, aerobic [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 313

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  I T    ++              F    W +   +    G G    L
Sbjct: 15  ERVRAYLMGLQDRITTAIAAMDG-----------GTFLSDAWEKAPGE-PLQGNGITRIL 62

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+
Sbjct: 63  EGGAVFERAGCGFSHVRGPKLPPSATQHRPELSGAPFEAMGVSLVFHPRNPYVPTVHMNV 122

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM+           WFGGG+DLTP      +  D D + FH T K+  S +    Y  +K
Sbjct: 123 RMLAAKNPQGDTVCWFGGGMDLTPY-----YGLDEDAVHFHQTCKDALSDYGDDKYPRFK 177

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GGIFFD         G D  F+ + +VGD F+  Y  +  R 
Sbjct: 178 KWCDEYFFLKHRNEPRGVGGIFFDDFSE----LGQDRSFAMLQSVGDAFLAAYLPIAERR 233

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               +++++R  QL RRGRY EFNL++D+GT+FG ++GG  ESIL SMPP  +W
Sbjct: 234 KDMAYTQRERDFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPHASW 287


>gi|307609973|emb|CBW99502.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           pneumophila 130b]
          Length = 311

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC   E ++ +            F    W R        GGG+   +
Sbjct: 13  EQIKSYLLQLQNTICVSLESIDGQT----------RFHEDSWQRA-----AGGGGKTRIM 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P             +F A G+S+++HP NP+VP  H N+
Sbjct: 58  ANGNVFEKAGVNFSHVSGEQLPASASAHREELAGRHFSALGVSLVIHPQNPYVPTTHANV 117

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP      + +  D   +H T    C       Y  +K
Sbjct: 118 RFFVAEKEDSEPVWWFGGGFDLTPY-----YGFVEDCEHWHQTALNACLPFGETIYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++ HR E+RGIGG+FFD  +        D  F  + ++GD FI  Y  +V R 
Sbjct: 173 RWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFELMRSIGDHFILAYEPIVARR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F  +++  Q  RRGRYAEFNL+YD+GT FG ++GG  ESIL S+PP+V W
Sbjct: 229 KDIPFGNREKAFQNYRRGRYAEFNLVYDRGTLFGLQSGGRTESILMSLPPIVHW 282


>gi|113866939|ref|YP_725428.1| coproporphyrinogen III oxidase [Ralstonia eutropha H16]
 gi|113525715|emb|CAJ92060.1| Coproporphyrinogen III oxidase [Ralstonia eutropha H16]
          Length = 303

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 101/297 (34%), Positives = 145/297 (48%), Gaps = 27/297 (9%)

Query: 16  ERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRM 75
              +  +     LQ  I      ++ +            F    W +  +++    G R 
Sbjct: 2   IDSQAVRAYLLGLQDRITDAIGAIDGQ-----------PFLTDAWEKPPTERLRGSG-RT 49

Query: 76  ATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVH 135
             L  G V E+A V  S V GD  P              F A G+S++ HP NP+VP VH
Sbjct: 50  RILEGGAVMERAGVGFSHVSGDTLPPSATANRPELAGRSFEAMGVSLVFHPRNPYVPTVH 109

Query: 136 FNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYT 189
            N+R  +         +WFGGG+DLTP           D   FH T ++  + +    Y 
Sbjct: 110 MNVRCFLALKPGAEPVWWFGGGMDLTPYYGDAG-----DCAHFHRTCQQALAPYGDDLYP 164

Query: 190 HYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLV 249
            +K+WCD YF+L HR E+RG+GGIFFD   +     G +  F+ + +VGD F+  Y  ++
Sbjct: 165 RFKQWCDEYFFLRHRNEARGVGGIFFDDFSA----LGFERSFAMMQSVGDAFLDAYLPIL 220

Query: 250 RRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +      + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPPLV W
Sbjct: 221 QARKDTPYGERERGFQAYRRGRYVEFNLVFDRGTLFGLQSGGRAESILMSMPPLVTW 277


>gi|48425926|pdb|1VJU|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Major
 gi|48425927|pdb|1VJU|B Chain B, Coproporphyrinogen Iii Oxidase From Leishmania Major
 gi|158430415|pdb|2QT8|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Major
 gi|158430416|pdb|2QT8|B Chain B, Coproporphyrinogen Iii Oxidase From Leishmania Major
 gi|198443341|pdb|3DWS|A Chain A, Leishmania Major Coproporphyrinogen Iii Oxidase With Bound
           Ligand
 gi|198443342|pdb|3DWS|B Chain B, Leishmania Major Coproporphyrinogen Iii Oxidase With Bound
           Ligand
          Length = 309

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 144/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR    
Sbjct: 14  EAVKDFLLKLQDDICEALEAEDGQA----------TFVEDKWTREGGG-----GGRTRVX 58

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 59  VDGAVIEKGGVNFSHVYGKGLPXSSTERHPDIAGCNFEAXGVSLVIHPKNPHVPTSHANV 118

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D   FH   +++C       Y  +K
Sbjct: 119 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRDFHQVAQDLCKPFGADVYARFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  +   Y  +V R 
Sbjct: 174 GWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYXDAYIPIVNRR 229

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 230 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 283


>gi|54294159|ref|YP_126574.1| coproporphyrinogen III oxidase [Legionella pneumophila str. Lens]
 gi|62510595|sp|Q5WX75|HEM6_LEGPL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|53753991|emb|CAH15462.1| oxygen-dependent coproporphyrinogen III oxidase [Legionella
           pneumophila str. Lens]
          Length = 309

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 143/294 (48%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ+ IC   E ++ +            F    W R        GGG+   +
Sbjct: 13  EQIKSYLLQLQNTICVSLESIDGQT----------KFHEDSWQRA-----AGGGGKTRIM 57

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFEKA V  S V G+  P             +F A G+S+++HP NP+VP  H N+
Sbjct: 58  ANGNVFEKAGVNFSHVSGEQLPASASAHREELAGRHFSALGVSLVIHPQNPYVPTTHANV 117

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R  V         +WFGGG DLTP      + +  D   +H T    C       Y  +K
Sbjct: 118 RFFVAEKEDSEPVWWFGGGFDLTPY-----YGFIEDCEHWHQTALNACLPFGETIYPKFK 172

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++ HR E+RGIGG+FFD  +        D  F  + ++GD FI  Y  +V R 
Sbjct: 173 RWCDDYFFIKHRNEARGIGGLFFDDYNEI----SFDHSFELMRSIGDHFILAYEPIVARR 228

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               F  +++  Q  RRGRYAEFNL+YD+GT FG ++GG  ESIL S+PP+V W
Sbjct: 229 KDIPFGNREKAFQNYRRGRYAEFNLVYDRGTLFGLQSGGRTESILMSLPPIVHW 282


>gi|332188858|ref|ZP_08390566.1| coproporphyrinogen III oxidase family protein [Sphingomonas sp.
           S17]
 gi|332011124|gb|EGI53221.1| coproporphyrinogen III oxidase family protein [Sphingomonas sp.
           S17]
          Length = 286

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 131/306 (42%), Positives = 167/306 (54%), Gaps = 21/306 (6%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MN  T +I     ++  +  ++  FE L+  IC EFE +E EA  +        FT   W
Sbjct: 1   MNSRTPDIA----LDAEQDAARLWFETLRDRICAEFEAIEREAGSD------ATFTYTAW 50

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
            R     E  GGG    +   +VFEK  V VSTV G     F   I G   +P F ATG+
Sbjct: 51  DRADPSGEPGGGGVRGVMKG-RVFEKVGVNVSTVGGTFEGPFAKTIHGAGDDPRFVATGI 109

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           S++ H  NPHVPAVH N R + T   WFGGG DL P L       + D   FH  LK  C
Sbjct: 110 SLVAHMANPHVPAVHMNTRFLTTTKRWFGGGADLNPPLP-----IEEDTADFHARLKAAC 164

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
             H    +  +K W D YFY+PHRQ  RG+GGIF+DHL      G    +F+F   VG+ 
Sbjct: 165 DAHNPEYHPRFKAWADDYFYIPHRQVHRGVGGIFYDHL-----EGDFTGNFAFTRDVGEA 219

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+ ++P +VRR     F+E DR   L  RGRYAEFNL+YD+GT FG KTGGN+++IL S+
Sbjct: 220 FLDVFPRIVRRRMGLPFTEADRAAMLAWRGRYAEFNLVYDRGTLFGLKTGGNIDAILMSL 279

Query: 301 PPLVAW 306
           PPL  W
Sbjct: 280 PPLATW 285


>gi|323525390|ref|YP_004227543.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1001]
 gi|323382392|gb|ADX54483.1| Coproporphyrinogen oxidase [Burkholderia sp. CCGE1001]
          Length = 307

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 151/294 (51%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
           +  +   + LQ+ I       + +            F    W R   +K   GG     L
Sbjct: 9   QAVRTWLQGLQTDIAHALGAFDGK-----------PFATDTWQRAPGEKLRGGGC-TRIL 56

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G  FE+A +  S V GD  P              F A G+S+++HP+NPH P VH N+
Sbjct: 57  EGGHFFERAGIGFSDVSGDALPGSASAARPQLAGRGFEAMGVSLVLHPHNPHCPTVHMNV 116

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R++V         +WFGGG+DLTP      + Y+ D   FH T ++  + +    Y  +K
Sbjct: 117 RLLVATKAGEEPVFWFGGGMDLTPY-----YGYEEDAQHFHRTCRDALAPYGADLYPKFK 171

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF+L HR E RGIGGIFFD   +     G D  F+ + +VG+ F+K Y  ++ + 
Sbjct: 172 RWCDEYFFLKHRNEPRGIGGIFFDDYSAP----GFDQSFAMLKSVGEGFLKAYLPIIEKR 227

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  + E +R+ Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+V W
Sbjct: 228 RNVPYGEAEREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVVNW 281


>gi|121594260|ref|YP_986156.1| coproporphyrinogen III oxidase [Acidovorax sp. JS42]
 gi|120606340|gb|ABM42080.1| Coproporphyrinogen oxidase [Acidovorax sp. JS42]
          Length = 334

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 112/309 (36%), Positives = 150/309 (48%), Gaps = 36/309 (11%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   E LQ+ I +  E +E        ++    F    W R +S     G G    L
Sbjct: 15  ARVRGYLEGLQARITSALEDIEG-----PQSQGGARFRSDAWRR-ESGSALQGDGITRIL 68

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A    S V G   P    Q         F A G+S++ HP NP+VP VH N+
Sbjct: 69  EGGRVFERAGCGFSHVSGPRLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNV 128

Query: 139 RMIVT---------------------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLK 177
           RMI                          WFGGG+DLTP      + +D D + FH   +
Sbjct: 129 RMIAAGTGAAGTGAAGTGAAGQAGQGPICWFGGGMDLTPY-----YGFDEDAVHFHRACR 183

Query: 178 EMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
           +  +      Y  +K WCD YFYL HR E RG+GGIFFD         G +   +   +V
Sbjct: 184 DALAPFGEGLYPRFKTWCDEYFYLKHRNEQRGVGGIFFDDFAEP----GFEQSLAMTQSV 239

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           GD F+  Y  +V+R  H    E++R+ QL RRGRY EFNL++D+GT+FG ++GG  ESIL
Sbjct: 240 GDAFLGAYLPIVQRRMHMDHGEREREFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESIL 299

Query: 298 ASMPPLVAW 306
            SMPPL AW
Sbjct: 300 LSMPPLAAW 308


>gi|149369450|ref|ZP_01889302.1| coproporphyrinogen III oxidase [unidentified eubacterium SCB49]
 gi|149356877|gb|EDM45432.1| coproporphyrinogen III oxidase [unidentified eubacterium SCB49]
          Length = 300

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 114/296 (38%), Positives = 153/296 (51%), Gaps = 30/296 (10%)

Query: 18  KRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMAT 77
           K         LQ+ I +  E+++ +A           F    W R +      GGGR   
Sbjct: 2   KEQFVTYIRTLQNTITSRLEQIDGKA----------TFEEDIWKRKEG-----GGGRTRV 46

Query: 78  LCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFN 137
           +  G VFEK  V +S V+G L    +        +  F+A GLS+++HP NP VP VH N
Sbjct: 47  IENGAVFEKGGVNISEVHGKLPESMQQYFGVK--DANFFACGLSLVLHPVNPMVPTVHAN 104

Query: 138 IRMIVTGAY-------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTH 190
            R              WFGGG DLTP      + +D D   FH T K  C +H    Y  
Sbjct: 105 WRYFEMYNQEGEIVDQWFGGGQDLTPY-----YLFDEDATHFHQTCKTACDKHNPTFYPK 159

Query: 191 YKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVR 250
           YK  CD YFY  HR+E RG+GG+FFD+   S +M   D  ++F++ VGD F++ Y  +V 
Sbjct: 160 YKARCDEYFYNAHREEGRGLGGLFFDYCKVSEDMQMQDW-YNFVTEVGDSFLEAYCPIVE 218

Query: 251 RNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +  +  F++  R  Q IRRGRY EFNL++DKGT FG KT G +ESIL S+PP V W
Sbjct: 219 KRMNLPFTKAQRDWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQW 274


>gi|85710708|ref|ZP_01041772.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
 gi|85687886|gb|EAQ27891.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
          Length = 285

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 128/288 (44%), Positives = 173/288 (60%), Gaps = 14/288 (4%)

Query: 20  ISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLC 79
            ++  FE+L+  IC  FE +E EA  +++      F    W R++   +D GGG    L 
Sbjct: 10  RAKEWFESLRDQICAAFESIEREAGSDAS------FQYTPWNREEEGNDDPGGGVQG-LM 62

Query: 80  AGKVFEKAAVLVSTVYGDLSPDFKDQILGTT-KNPYFWATGLSVIVHPYNPHVPAVHFNI 138
            GKVFEK  V VSTV G  S  F +Q+ G + ++P F ATG+S++ H +NPHVPAVH N 
Sbjct: 63  KGKVFEKVGVNVSTVRGRFSEQFANQVNGASVEHPEFTATGISLVAHMHNPHVPAVHMNT 122

Query: 139 RMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
           R + T A WFGGG DL P +      Y+ D   FH +++  C  H    Y  YK+W D Y
Sbjct: 123 RFLTTQAAWFGGGADLNPPIP-----YEEDTEEFHASMRAACMAHNPTYYERYKKWADDY 177

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           FY+PHR+  RG+GGIF+DHL    +    D +F+F   VG  F+ +YP LVR+     F 
Sbjct: 178 FYIPHREVHRGVGGIFYDHLECEDDQ-SFDRNFAFTQDVGKAFLDIYPKLVRKRMESDFD 236

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           + D  +QL  RGRYAEFNL+YD+GT FG KTGGN+++IL S+PP   W
Sbjct: 237 DADVAQQLEYRGRYAEFNLVYDRGTIFGLKTGGNIDAILMSLPPRATW 284


>gi|262377339|ref|ZP_06070563.1| coproporphyrinogen III oxidase, aerobic [Acinetobacter lwoffii
           SH145]
 gi|262307792|gb|EEY88931.1| coproporphyrinogen III oxidase, aerobic [Acinetobacter lwoffii
           SH145]
          Length = 330

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 106/309 (34%), Positives = 156/309 (50%), Gaps = 28/309 (9%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
               +  P   + +    +    +LQ+ IC   E+ E       A      F +  W R 
Sbjct: 9   TRALMQHPTSTDIQ--HVREFLLDLQARICAALEQQER------AGGGTAEFIIDDWER- 59

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   L  G V EK  V+ S +     P    +           A G+S++
Sbjct: 60  ----PEGGGGRSRVLQNGTVIEKGGVMFSHINISKLPASATERHPNIAGAKAQAMGVSLV 115

Query: 124 VHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLK 177
           +HP NP++P  H N+R+ V         +WFGGG DLTP   +     D DV+ +H T  
Sbjct: 116 IHPKNPNIPTSHANVRLFVAEKEGQDPIWWFGGGFDLTPFYPN-----DEDVLSWHQTAH 170

Query: 178 EMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
           ++C+      Y  +K+WCD YFYL HR E RG+GG+FFD L+        +  F ++ AV
Sbjct: 171 DLCAPFGEEVYPEHKQWCDDYFYLKHRDEQRGVGGLFFDDLNQW----DFETCFQYMQAV 226

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESIL 297
           G+ +++    + +RN    ++E  R+ QL RRGRY E+NL+YD+GT FG +TGG +ESIL
Sbjct: 227 GNGYLEAILPIFQRNQDKPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESIL 286

Query: 298 ASMPPLVAW 306
            S+PPL  W
Sbjct: 287 VSLPPLTGW 295


>gi|149926738|ref|ZP_01914998.1| coproporphyrinogen III oxidase [Limnobacter sp. MED105]
 gi|149824667|gb|EDM83883.1| coproporphyrinogen III oxidase [Limnobacter sp. MED105]
          Length = 303

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 144/294 (48%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              ++  + LQS I     + EN+            F    W R +      GGG    L
Sbjct: 7   NQVKQYLQGLQSSIIEGIGQFENK-----------PFLNDSWERAEG-----GGGCSRVL 50

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G + E+  V  S V GD  P              F A G+S++ HP NP+VP VH N+
Sbjct: 51  EEGSLLERGGVNFSHVMGDKLPGSATASRQGLAGASFEAMGVSLVFHPRNPYVPTVHMNV 110

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+           +WFGGG+DLTP      + ++ D   FH + K          +  +K
Sbjct: 111 RLFAATTVEGESVWWFGGGMDLTPY-----YGFEEDAKHFHQSCKNALDPFGAHYHAKFK 165

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YFYL HR+E RG+GG+FFD         G +  F+    VGD F+K Y  +V R 
Sbjct: 166 KWCDEYFYLKHRKEPRGVGGVFFDDFSE----LGFEQSFAMTRNVGDAFLKGYLPIVERR 221

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP V W
Sbjct: 222 MNMAYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPQVKW 275


>gi|254251817|ref|ZP_04945135.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
 gi|124894426|gb|EAY68306.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
          Length = 365

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   + LQ+ I      L+                   W R  +++   GG     L
Sbjct: 9   ARVRTYLQALQTRIADALGALDGT-----------PLATDAWQRGPAERLRGGGC-TRIL 56

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A +  S V GD  P              F A G+S+++HP NP+ P VH N+
Sbjct: 57  EDGRVFERAGIGFSDVAGDALPPSASAARPELAGRGFEALGVSLVLHPRNPYCPTVHMNV 116

Query: 139 RMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM++         +WFGGG+DLTP      + ++ D   FH T K+       A Y  +K
Sbjct: 117 RMLIATKPGEKPVFWFGGGMDLTPV-----YGFEDDARHFHRTCKDALDPFGAALYPRFK 171

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E RG+GGIFFD         G +  F  + +VGD F+  Y  +V R 
Sbjct: 172 KWCDEYFFLKHRNEMRGVGGIFFDDFSEP----GFERAFEMMQSVGDAFLPAYLPIVERR 227

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 228 AGLPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVANW 281


>gi|254247617|ref|ZP_04940938.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia PC184]
 gi|124872393|gb|EAY64109.1| Coproporphyrinogen oxidase [Burkholderia cenocepacia PC184]
          Length = 323

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   + LQ+ I      L+                   W R  +++   GG     L
Sbjct: 25  ARVRTYLQGLQTRIADALGALDGT-----------PLATDTWQRGPAERLRGGGC-TRIL 72

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A +  S V GD  P              F A G+S+++HP NP+ P VH N+
Sbjct: 73  EGGRVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNV 132

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM+          +WFGGG+DLTP      + ++ D   FH T K+         Y  +K
Sbjct: 133 RMLIATKPGEAPVFWFGGGMDLTPV-----YGFEDDARHFHQTCKDALDPFGAELYPRFK 187

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGGIFFD         G +  F  + +VGD F+  Y  +V R 
Sbjct: 188 QWCDEYFFLKHRNETRGIGGIFFDDFSEP----GFERSFDLMQSVGDAFLNAYLPIVERR 243

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 244 AELPYGERERDFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVANW 297


>gi|153208198|ref|ZP_01946608.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165923958|ref|ZP_02219790.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii RSA 334]
 gi|189028100|sp|A9KC01|HEM6_COXBN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|120576103|gb|EAX32727.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165916614|gb|EDR35218.1| coproporphyrinogen III oxidase, aerobic [Coxiella burnetii RSA 334]
          Length = 310

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 151/289 (52%), Gaps = 30/289 (10%)

Query: 24  KFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
             ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V
Sbjct: 15  YLKDLQNRLCRAFEKEEGES----------RFQETLW-----EKPNGGGGRTRLLTEGHV 59

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
            E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + 
Sbjct: 60  IEQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIA 119

Query: 144 ------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                   +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD 
Sbjct: 120 GKDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDD 174

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H +
Sbjct: 175 YFYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPY 230

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 231 GERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 279


>gi|77747481|ref|NP_297310.2| coproporphyrinogen III oxidase [Xylella fastidiosa 9a5c]
 gi|13431555|sp|Q9PHC7|HEM6_XYLFA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
          Length = 305

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 109/294 (37%), Positives = 148/294 (50%), Gaps = 31/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E ++ ++H          F   HW R +      GGGR   L
Sbjct: 5   DRVRDYLTALQDRICNVVETIDGQSH----------FHEDHWQRTEG-----GGGRTRLL 49

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G VFE+A +  S V G   P              + A G+S++ HP NP VP  H N+
Sbjct: 50  RDGAVFEQAGIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPTTHLNV 109

Query: 139 RMIVTGAY------WFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R             WFGGG DLTP        +D DV+ +H   +++C+      Y  +K
Sbjct: 110 RYFRAERDGKQVAAWFGGGFDLTPFYP-----FDEDVVHWHTVARDLCAPFGDERYAAHK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF L HR E+RG+GG+FFD L         + DF++  AVGD F+  Y  +V R 
Sbjct: 165 RWCDEYFVLRHRNETRGVGGLFFDDLD-----KDFERDFAYQRAVGDGFLDAYFPIVTRR 219

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           +   + +++R  QL RRGRY EFNLL+D+GT FG ++GG  ESIL S+PPLV W
Sbjct: 220 HDTPYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRW 273


>gi|255003234|ref|ZP_05278198.1| coproporphyrinogen III oxidase [Anaplasma marginale str. Puerto
           Rico]
          Length = 275

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 118/294 (40%), Positives = 167/294 (56%), Gaps = 21/294 (7%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           + E+K      F  L+  I  +F  +E E  ++           + W R+        GG
Sbjct: 1   MNEKKERVAGWFHELRDRIVDQFLAIEEEFSDSRPEI-----KRRTWDREGG------GG 49

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQIL-GTTKNPYFWATGLSVIVHPYNPHVP 132
             + +  GKVFEKA V  STVYG +  +F  +I         FWA+G+SV+ H  +P VP
Sbjct: 50  GESVVIVGKVFEKAGVNFSTVYGVMDSNFACEIPGAQESGGDFWASGISVVAHMQSPFVP 109

Query: 133 AVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           AVH N R + T   WFGGG+DLTP+        + D   FH  ++  C +     Y  +K
Sbjct: 110 AVHMNTRFMCTSKSWFGGGMDLTPTYYD-----EDDKTTFHEGIRAACDKFNPEYYPKFK 164

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           + CD YFYLPHR+E RG+GGIF+D+L +    G  + DF+F   VG CF+++Y ++VRRN
Sbjct: 165 QRCDEYFYLPHRKEMRGVGGIFYDNLCT----GNWEQDFAFTQEVGKCFLRVYSAIVRRN 220

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            H  +  ++R  QL++RGRY EFNL+YD+GT FG  T GN ++I+ SMPPLV W
Sbjct: 221 MHKTWGAEERNFQLLKRGRYVEFNLIYDRGTRFGLMTNGNPDAIMMSMPPLVRW 274


>gi|50086244|ref|YP_047754.1| coproporphyrinogen III oxidase [Acinetobacter sp. ADP1]
 gi|49532220|emb|CAG69932.1| coproporphyrinogen III oxidase [Acinetobacter sp. ADP1]
          Length = 326

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 101/305 (33%), Positives = 151/305 (49%), Gaps = 28/305 (9%)

Query: 8   IGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
           +  P   + +    +     LQ+ IC+  E+ E              F +  W R     
Sbjct: 15  MQNPTSADIQ--RVREFLLGLQARICSSLEQQE------QLGGGTAEFVIDDWER----- 61

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPY 127
            + GGGR   L  G+V EK  V+ S +     P    +           A G+S+++HP 
Sbjct: 62  PEGGGGRSRVLQNGEVIEKGGVMFSHINISKLPASATERHPQIAGAKAQALGVSLVIHPK 121

Query: 128 NPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
           NPH+P  H N+R+ V         +WFGGG DLTP         + D+  +H T  ++C 
Sbjct: 122 NPHIPTSHANVRLFVAEPEGQDPIWWFGGGFDLTPFYPD-----EQDIKNWHQTAHDLCQ 176

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
                 Y  +K+WCD YFYL HR E RG+GG+FFD L+        +  F ++ AVG+ +
Sbjct: 177 PFGEDVYAEHKQWCDDYFYLKHRDEQRGVGGLFFDDLNCW----DFETCFQYMQAVGNGY 232

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMP 301
           ++    +  ++    ++E  R+ QL RRGRY E+NL+YD+GT FG +TGG +ESIL S+P
Sbjct: 233 LEAIVPIFEKHRDQPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESILVSLP 292

Query: 302 PLVAW 306
            L  W
Sbjct: 293 NLAGW 297


>gi|212217945|ref|YP_002304732.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuK_Q154]
 gi|212012207|gb|ACJ19587.1| coproporphyrinogen III oxidase [Coxiella burnetii CbuK_Q154]
          Length = 319

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 151/289 (52%), Gaps = 30/289 (10%)

Query: 24  KFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKV 83
             ++LQ+ +C  FEK E E+           F    W     +K + GGGR   L  G V
Sbjct: 24  YLKDLQNRLCRAFEKEEGES----------RFQETLW-----EKPNGGGGRTRLLTEGHV 68

Query: 84  FEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT 143
            E+  V  S VYG+  P    Q         F A GLS+++HP NP+VP VH N R  + 
Sbjct: 69  IEQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIA 128

Query: 144 ------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDR 197
                   +WFGGG DLTP      + ++ D   +H   K+ C +   A Y  +K  CD 
Sbjct: 129 GKDEADPRWWFGGGYDLTPY-----YGFEEDCRHWHRVAKKACDRFGEAIYPRFKAACDD 183

Query: 198 YFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLF 257
           YFYL HR E RGIGG+FFD L+           F FI  +GD F++ Y  +++   +H +
Sbjct: 184 YFYLKHRNEPRGIGGLFFDDLNEWE----FKRCFEFIKILGDSFLEAYLPIMQNRKNHPY 239

Query: 258 SEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            E+ R+ QL RRGRY EFNLLYD+GT FG + GG  ESIL S+PP V W
Sbjct: 240 GERQREFQLYRRGRYVEFNLLYDRGTRFGLEFGGRTESILMSLPPRVVW 288


>gi|167585915|ref|ZP_02378303.1| coproporphyrinogen III oxidase [Burkholderia ubonensis Bu]
          Length = 307

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +   + LQ+ I      L+                   W R   ++   GG     L
Sbjct: 9   ERVRAYLQGLQTRIADALGALDGT-----------PLATDAWQRGPGERLRGGGC-TRIL 56

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G+VFE+A +  S V GD  P              F A G+S+++HP NP+ P VH N+
Sbjct: 57  EDGQVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNV 116

Query: 139 RMI------VTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           RM+          +WFGGG+DLTP      + ++ D   FH T K+         Y  +K
Sbjct: 117 RMLIATKPGEAPVFWFGGGMDLTPI-----YGFEDDARHFHQTCKDALDPFGADLYPRFK 171

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
           +WCD YF+L HR E+RGIGGIFFD         G +  F  + +VGD F+  Y  +V R 
Sbjct: 172 QWCDEYFFLKHRNEARGIGGIFFDDYAEP----GFERAFEMMQSVGDAFLAAYLPIVERR 227

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
               + E++R  Q  RRGRY EFNL++D+GT FG ++GG  ESIL SMPP+  W
Sbjct: 228 RDTPYGERERTFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSMPPVANW 281


>gi|88807856|ref|ZP_01123367.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 7805]
 gi|88787895|gb|EAR19051.1| coproporphyrinogen III oxidase [Synechococcus sp. WH 7805]
          Length = 367

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 108/325 (33%), Positives = 151/325 (46%), Gaps = 42/325 (12%)

Query: 4   CTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRD 63
            T E+       + +  ++     LQ  IC   E+++              F  + W R 
Sbjct: 21  STSEMPGERPPADSRERARALVMALQDEICAGLEQIDGS----------GRFKEESWER- 69

Query: 64  KSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVI 123
                + GGGR   +  G++FE+  V  S V G+  P    +     K   ++ATG S++
Sbjct: 70  ----PEGGGGRSRVMREGRIFEQGGVNFSEVQGEELPPSILKQRPEAKGHPWFATGTSMV 125

Query: 124 VHPYNPHVPAVHFNIRMIVT-GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQ 182
           +HP NP VP VH N R       +WFGGG DLTP        +  D   FH T +E C  
Sbjct: 126 LHPRNPFVPTVHLNYRYFEAGPVWWFGGGADLTPFYP-----FLEDARHFHRTHQEACDS 180

Query: 183 HAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPE------------------- 223
                Y  +K WCD YF+L HRQE+RGIGGIF+D+   S                     
Sbjct: 181 VDDRLYQVFKPWCDEYFFLKHRQETRGIGGIFYDYQDGSGRLYRGQDPEGPAARKASEIG 240

Query: 224 --MGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDK 281
                 +  F+   A G  F+  Y  ++ R     + +++RQ QL RRGRY EFNL++D+
Sbjct: 241 AVPLSWEQLFALAGANGRAFLPAYAPIIERRNGLSYGDRERQFQLYRRGRYVEFNLVWDR 300

Query: 282 GTNFGFKTGGNVESILASMPPLVAW 306
           GT FG +T G  ESIL S+PPL  W
Sbjct: 301 GTIFGLQTNGRTESILMSLPPLARW 325


>gi|326575042|gb|EGE24971.1| coproporphyrinogen III oxidase [Moraxella catarrhalis O35E]
          Length = 320

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 107/300 (35%), Positives = 149/300 (49%), Gaps = 19/300 (6%)

Query: 14  IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGG 73
           ++ + +  +    NLQ  I    E  EN    +   R+   F    W R      + GGG
Sbjct: 1   MQAQIQAVREFLLNLQQAIVHALENQENSGGFD--GRTDTKFIADTWER-----PEGGGG 53

Query: 74  RMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPA 133
               L  G+V EKA V+ S ++    P                A G+S++VHP NP+VP 
Sbjct: 54  CSCVLSGGQVIEKAGVMFSHIHIKQMPASATVRHPELVGAQAQALGVSLVVHPKNPYVPT 113

Query: 134 VHFNIRMIVTGA-------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVA 186
            H N+R+ V          +WFGGG DLTP   +       DV  +H    E+C      
Sbjct: 114 SHANVRLFVATPTDGSAPIWWFGGGFDLTPFYPNLN-----DVKHWHQVAYELCQPFGDE 168

Query: 187 NYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYP 246
            Y  YK WCD YFYL HR E RG+GG+F+D ++++         F F+ AVG  ++    
Sbjct: 169 VYPKYKTWCDEYFYLKHRHERRGVGGLFYDDMNTASTNWDFMTCFKFMQAVGQGYLDGII 228

Query: 247 SLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +   N H  ++E +RQ QL RRGRY E+NL++D+GT FG ++ G  ESIL SMPPL AW
Sbjct: 229 PIFEHNKHRSYTEHERQFQLYRRGRYVEYNLVFDRGTLFGLQSNGRTESILVSMPPLAAW 288


>gi|326793391|ref|YP_004311211.1| coproporphyrinogen-III oxidase aerobic [Marinomonas mediterranea
           MMB-1]
 gi|326544155|gb|ADZ89375.1| Coproporphyrinogen-III oxidase, aerobic [Marinomonas mediterranea
           MMB-1]
          Length = 309

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 112/304 (36%), Positives = 149/304 (49%), Gaps = 35/304 (11%)

Query: 10  CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKED 69
            P+DI       +    +LQ  IC   E  E             +F    W R      +
Sbjct: 6   SPNDI----AAVKAYLMSLQDQICHALEGFE----------PNLVFHEDAWDR-----PN 46

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNP 129
            GGGR   +  G V EK  V  S V GD  P              F A G+S+++HP NP
Sbjct: 47  GGGGRTRVIADGDVIEKGGVNFSHVMGDTLPPSATAERPELAGGRFEAMGVSLVIHPKNP 106

Query: 130 HVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQH 183
             P  H N+R+ V         +WFGGG DLTP      + ++ D I +H T  +  S  
Sbjct: 107 MAPTSHANVRLFVVHKDGMDPVWWFGGGFDLTPY-----YGFEEDCISWHQTAFDALSPF 161

Query: 18