RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781073|ref|YP_003065486.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)



>2aex_A Coproporphyrinogen III oxidase, mitochondrial; FLAT beta-sheet
           sandwiched by helices, oxidoreductase; HET: CIT; 1.58A
           {Homo sapiens}
          Length = 346

 Score =  264 bits (675), Expect = 2e-71
 Identities = 112/313 (35%), Positives = 158/313 (50%), Gaps = 42/313 (13%)

Query: 12  DDIEERKRISQRKFE----NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
            ++  R    + K E      Q+ +C    +++  A+          F+V  W     ++
Sbjct: 31  GELRRRPGDMKTKMELLILETQAQVCQALAQVDGGAN----------FSVDRW-----ER 75

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-------YFWATGL 120
           ++ GGG    L  G VFEKA V +S V+G+LS +   Q+    K          F A G+
Sbjct: 76  KEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGV 135

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S ++HP NPH P +HFN R            +WFGGG DLTP+     +    D + FH 
Sbjct: 136 SSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPT-----YLNQEDAVHFHR 190

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           TLKE C QH    Y  +K+WCD YF++ HR E RGIGGIFFD      +    +  F F+
Sbjct: 191 TLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDD----LDSPSKEEVFRFV 246

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNV 293
            +     +  Y  LV+++    F+ Q++  Q +RRGRY EFNLLYD+GT FG  T G  +
Sbjct: 247 QSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRI 306

Query: 294 ESILASMPPLVAW 306
           ESIL S+P    W
Sbjct: 307 ESILMSLPLTARW 319


>1txn_A Coproporphyrinogen III oxidase; structural genomics, dimer, novel
           fold, PSI, protein structure initiative; 1.70A
           {Saccharomyces cerevisiae} SCOP: d.248.1.1 PDB: 1tkl_A
           1tlb_A 1tk1_A
          Length = 328

 Score =  248 bits (634), Expect = 1e-66
 Identities = 112/320 (35%), Positives = 152/320 (47%), Gaps = 49/320 (15%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
           P ++  R+++        Q+ I    E ++              F    W R      D 
Sbjct: 7   PRNLPIRQQMEA-LIRRKQAEITQGLESIDTVK-----------FHADTWTRGN----DG 50

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPY---------------- 114
           GGG    +  G  FEK  V VS VYG LSP     +    KN                  
Sbjct: 51  GGGTSMVIQDGTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVK 110

Query: 115 FWATGLSVIVHPYNPHVPAVHFNIRMIVTG-------AYWFGGGIDLTPSLESRRHSYDP 167
           F+A GLS+++HP NPH P  H N R   T         +WFGGG DLTPS     + Y+ 
Sbjct: 111 FFACGLSMVIHPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPS-----YLYEE 165

Query: 168 DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGI 227
           D   FH   K+   +H  A Y  +K+WCD YFY+ HR+E+RGIGGIFFD           
Sbjct: 166 DGQLFHQLHKDALDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQE-- 223

Query: 228 DADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGF 287
                 +    D F+  Y ++V+R     ++++++Q Q IRRGRY EFNL+YD+GT FG 
Sbjct: 224 --ILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGL 281

Query: 288 KT-GGNVESILASMPPLVAW 306
           +T G  VESIL S+P   +W
Sbjct: 282 RTPGSRVESILMSLPEHASW 301


>1vju_A Coproporphyrinogen III oxidase; structural genomics, PSI, protein
           structure initiative, structural genomics of pathogenic
           protozoa consortium; 1.40A {Leishmania major} SCOP:
           d.248.1.1 PDB: 2qt8_A* 3dwr_A 3dws_A* 3ejo_A 3e8j_A*
          Length = 309

 Score =  248 bits (634), Expect = 1e-66
 Identities = 102/288 (35%), Positives = 138/288 (47%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
              LQ  IC   E  + +A           F    W      +E     R   +  G V 
Sbjct: 20  LLKLQDDICEALEAEDGQAT----------FVEDKW-----TREXXXXXRTRVMVDGAVI 64

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+R+ V  
Sbjct: 65  EKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANVRLFVAE 124

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP               FH   +++C       Y  +K WCD Y
Sbjct: 125 REGKEPVWWFGGGFDLTPYYAVEEDC-----RDFHQVAQDLCKPFGADVYARFKGWCDEY 179

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F++P+R E+RGIGG+FFD L+        +  F F+ AVG  ++  Y  +V R  +  ++
Sbjct: 180 FFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGYMDAYIPIVNRRKNTPYT 235

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 236 EQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 283


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 37.2 bits (86), Expect = 0.004
 Identities = 56/392 (14%), Positives = 104/392 (26%), Gaps = 179/392 (45%)

Query: 25  FENLQSIICT------EF-----EKLENEAHENSANRSPKIFT----VKHWLRDKSQKED 69
           FE L+ +  T      +      E L           + K+FT    +  WL + S   D
Sbjct: 170 FEELRDLYQTYHVLVGDLIKFSAETLSELIRTTL--DAEKVFTQGLNILEWLENPSNTPD 227

Query: 70  -------------LGGGRMATLC-AGKVFEKAAVLVSTVYGDLSP-DFKDQILGTTKNPY 114
                        +G  ++A      K+               +P + +  + G      
Sbjct: 228 KDYLLSIPISCPLIGVIQLAHYVVTAKLL------------GFTPGELRSYLKGA----- 270

Query: 115 FWATGLS--VIVHPYNPHVPAV---------HF--NIRMIVTGAYWFG-------GGIDL 154
              TG S  ++         AV          F  ++R  +T  ++ G           L
Sbjct: 271 ---TGHSQGLVT--------AVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSL 319

Query: 155 TPSL--ESRRH-----SYDPDVIFFHNTLKEM-----CSQHAVANYTHYKEWCDRYFYLP 202
            PS+  +S  +     S              M      +Q  V    +  +  +   +LP
Sbjct: 320 PPSILEDSLENNEGVPSP-------------MLSISNLTQEQVQ--DYVNK-TNS--HLP 361

Query: 203 HRQESRGIGGI--------F-----------FD-HLHSSPEMGGIDAD---FS------- 232
                + +  I                     +  L  +    G+D     FS       
Sbjct: 362 ---AGKQV-EISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFS 417

Query: 233 --F--ISAVGDCFIKLYPSLVRRNYH--HLFSEQDR-QEQLIRRGRYAEFNLL----YD- 280
             F  +++         P      +H   L    D   + L++         +    YD 
Sbjct: 418 NRFLPVAS---------P------FHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDT 462

Query: 281 -KGTNFGFKTGGNVESILASM----PPLVAWP 307
             G++      G++   +       P  V W 
Sbjct: 463 FDGSDLR-VLSGSISERIVDCIIRLP--VKWE 491



 Score = 30.3 bits (68), Expect = 0.63
 Identities = 15/96 (15%), Positives = 32/96 (33%), Gaps = 30/96 (31%)

Query: 228 DADFSFISAVGDCFIKLYPS----------------LVRRNYHHLFSEQDRQEQLIRRGR 271
            A F   S + + F K+ P                 LV +   ++ S  +  +     G+
Sbjct: 24  TASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKV----GQ 79

Query: 272 YAEF-NLLYDKGTNFGFKT----GGNVESILASMPP 302
           + +  NL         F+     G ++ ++ A +  
Sbjct: 80  FDQVLNLCLT-----EFENCYLEGNDIHALAAKLLQ 110


>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A
           {Staphylococcus aureus RN4220} PDB: 3i46_A 3i48_A
          Length = 317

 Score = 30.0 bits (66), Expect = 0.65
 Identities = 23/176 (13%), Positives = 39/176 (22%), Gaps = 19/176 (10%)

Query: 136 FNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIF----FHNTLKEMCSQHAVANYTHY 191
            N+ M+ T  Y   G       +    +  + DV+     F N   +    +    Y + 
Sbjct: 35  HNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQ 94

Query: 192 KEWCDRYFYLPHRQESRGIGGIFFD--------------HLHSSPEMGGIDADFSFISAV 237
                R      + E      +  D                H      G D D +     
Sbjct: 95  TPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVY 154

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNV 293
                      V    H    +        R+ R  +   + D            V
Sbjct: 155 TKIEKNGKNVHV-IGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETV 209


>3agp_A Elongation factor TS, elongation factor TU, linke replicase; RNA
            polymerase, translation, transferase; 2.80A {Escherichia
            coli O157} PDB: 3agq_A
          Length = 1289

 Score = 29.4 bits (66), Expect = 1.2
 Identities = 23/129 (17%), Positives = 44/129 (34%), Gaps = 17/129 (13%)

Query: 144  GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
            G +++ G +D+TP     R     D+I   N L    +   V +   +  +      LP 
Sbjct: 1092 GKHYYSG-VDVTPFYIRHRIVSPADLILVLNNLYRWATIDGVWDPRAHSVYLKYRKLLPK 1150

Query: 204  RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
            + +   I   + D       +G +  +  F    G  +I+  P +          +  R 
Sbjct: 1151 QLQRNTIPDGYGD----GALVGSVLIN-PFAKNRG--WIRYVPVIT---------DHTRD 1194

Query: 264  EQLIRRGRY 272
             +    G Y
Sbjct: 1195 RERAELGSY 1203


>3mmp_G RNA-directed RNA polymerase beta chain; RDRP,HOST-factor complex,
           translation, transferase; HET: PXN; 2.50A
           {Enterobacteria phage qbeta}
          Length = 589

 Score = 28.7 bits (63), Expect = 2.0
 Identities = 23/129 (17%), Positives = 42/129 (32%), Gaps = 17/129 (13%)

Query: 144 GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPH 203
           G +++ G +D+TP     R     D+I   N L    +   V +   +  +      LP 
Sbjct: 398 GKHYYSG-VDVTPFYIRHRIVSPADLILVLNNLYRWATIDGVWDPRAHSVYLKYRKLLPK 456

Query: 204 RQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQ 263
           + +   I   + D       + G      F    G  +I+  P +          +  R 
Sbjct: 457 QLQRNTIPDGYGD-----GALVGSVLINPFAKNRG--WIRYVPVIT---------DHTRD 500

Query: 264 EQLIRRGRY 272
            +    G Y
Sbjct: 501 RERAELGSY 509


>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI,
           protein structure initiative; 1.90A {Vibrio cholerae}
          Length = 361

 Score = 27.7 bits (60), Expect = 3.1
 Identities = 20/149 (13%), Positives = 33/149 (22%), Gaps = 1/149 (0%)

Query: 123 IVHPYNPHVPAVHFNIRMIVTGAYWF-GGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCS 181
                         N       A  F     D++  L      YD               
Sbjct: 147 RFDILVKQQYLGEHNTGNSEIKAISFKLAKGDVSAFLAEDGRFYDRAGNSLERAFNRYPV 206

Query: 182 QHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCF 241
             A    T       ++          G                G           G+  
Sbjct: 207 DKAYRQITSGFNPKRKHPVTGRVVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYL 266

Query: 242 IKLYPSLVRRNYHHLFSEQDRQEQLIRRG 270
           +  + S+ +  Y HL     ++ QL++RG
Sbjct: 267 VIEHNSVYKTRYLHLDKILVKKGQLVKRG 295


>2dyt_A Autophagy-related protein 3; E2 fold, ligase; 2.50A {Saccharomyces
           cerevisiae}
          Length = 312

 Score = 27.7 bits (61), Expect = 3.1
 Identities = 10/35 (28%), Positives = 20/35 (57%)

Query: 94  VYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYN 128
           ++ D+S D++ +     K P++  + LSV +HP  
Sbjct: 203 MFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCK 237


>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP:
           a.133.1.1
          Length = 134

 Score = 27.5 bits (61), Expect = 3.7
 Identities = 13/66 (19%), Positives = 25/66 (37%), Gaps = 8/66 (12%)

Query: 161 RRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFY-----LPHRQESRGIGGIFF 215
           R H   PDV+    +   + +     ++T     CD  FY           S  +G ++F
Sbjct: 32  RTHDMCPDVMSAGESKHGLTNTA---SHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYF 88

Query: 216 DHLHSS 221
           + + + 
Sbjct: 89  NLIDTK 94


>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A
           {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*
          Length = 695

 Score = 26.6 bits (58), Expect = 8.0
 Identities = 28/166 (16%), Positives = 51/166 (30%), Gaps = 16/166 (9%)

Query: 2   NLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWL 61
            +  I+I   D ++ +  + +   E L  II    +K   +        +PK       L
Sbjct: 139 RVSFIDIDYSDLLKIKIELIKTIPE-LSKIIGLSEDKDYVDDSNVDFLTTPKYLARPCDL 197

Query: 62  RDKSQKEDLGGGRMATLCAGKVFEKAAVLVS---TVYGDLSPDFKDQILGTTKNPYFWAT 118
            D      L        C         V V+     Y  + P+  D I+  T        
Sbjct: 198 NDSKMFSTL-----LNECQLYDPNVVKVFVAEVSLAY--MKPERSDSIIEATSKM---EN 247

Query: 119 GLSVIVHPYNPHVPAVHFNIRMIVTGAYWFG--GGIDLTPSLESRR 162
              +I+    P  P   F+ +M+            +    ++ES+ 
Sbjct: 248 SHFIILEQLIPKGPFEPFSKQMLAHFKRNDSPLQSVLKYNTIESQV 293


>1pq3_A Arginase II, mitochondrial precursor; biosynthetic protein,
           hydrolase; HET: S2C; 2.70A {Homo sapiens} SCOP: c.42.1.1
          Length = 306

 Score = 26.3 bits (57), Expect = 8.6
 Identities = 16/105 (15%), Positives = 33/105 (31%), Gaps = 1/105 (0%)

Query: 70  LGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYF-WATGLSVIVHPYN 128
           LGG     +       +    +  V+ D   D    +  ++ N +    + L   +    
Sbjct: 93  LGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKV 152

Query: 129 PHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFH 173
           P +P   +    I + +  + G  D+ P       +YD       
Sbjct: 153 PQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMR 197


>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding,
           structural genomics, NPPSFA; 2.52A {Thermus thermophilus
           HB8}
          Length = 524

 Score = 26.3 bits (56), Expect = 8.9
 Identities = 15/86 (17%), Positives = 22/86 (25%), Gaps = 17/86 (19%)

Query: 117 ATGLSVIVHPYNPHV--PAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           A G+ V V     +   P V   I            G+ LTPS               HN
Sbjct: 88  AHGIEVRVEADGDYTPTPLVSLAILEHNAHHEAKADGVLLTPS---------------HN 132

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFY 200
             ++   ++             R   
Sbjct: 133 PPEDGGFKYNPPTGGPANARITRAIE 158


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.322    0.139    0.442 

Gapped
Lambda     K      H
   0.267   0.0473    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,884,239
Number of extensions: 136836
Number of successful extensions: 410
Number of sequences better than 10.0: 1
Number of HSP's gapped: 393
Number of HSP's successfully gapped: 28
Length of query: 307
Length of database: 5,693,230
Length adjustment: 92
Effective length of query: 215
Effective length of database: 3,462,782
Effective search space: 744498130
Effective search space used: 744498130
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.0 bits)