HHsearch alignment for GI: 254781074 and conserved domain: PRK05254

>PRK05254 uracil-DNA glycosylase; Provisional.
Probab=100.00  E-value=0  Score=630.70  Aligned_cols=222  Identities=55%  Similarity=1.044  Sum_probs=218.3

Q ss_pred             CCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCCCCEEEC
Q ss_conf             68687338999888726589999999999999779808588769999984299861779998118887752000710003
Q gi|254781074|r    3 GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSV   82 (227)
Q Consensus         3 ~l~i~~sW~~~L~~e~~~~~~~~i~~~l~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPY~~~g~A~GLaFsv   82 (227)
T Consensus         2 ~~~i~~~W~~~l~~e~~k~yf~~l~~~l~~e~~~~~~i~P~~~~iF~af~~~~~~~vKVVIlGQDPYh~~gqA~GLaFSv   81 (223)
T PRK05254          2 KMALEPSWKEVLKPEFKKPYFQELLEFLRAERAAGKTIYPPGEDIFRAFNLTPFDDVKVVILGQDPYHGPGQAHGLSFSV   81 (223)
T ss_pred             CCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCCCEEEEC
T ss_conf             88518789999999967699999999999999769977588589999984389878379998478999976558846567


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCEEEECCHHCCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             47986304699999999974188887740124322089688601011236860445432599999999999961789879
Q gi|254781074|r   83 PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIV  162 (227)
Q Consensus        83 ~~~~~~p~SLrNI~Kel~~d~~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gW~~ft~~ii~~l~~~~~~vV  162 (227)
T Consensus        82 ~~~~~~PpSL~NI~kEl~~d~~~~~~~~gdL~~Wa~QGVLLLNt~LTv~~g~~~SH~~~GWe~ft~~vi~~l~~~~~~~V  161 (223)
T PRK05254         82 PPGVPLPPSLRNIFKELEDDLGFPIPNHGDLTSWAEQGVLLLNTVLTVEAGQANSHAGKGWETFTDAVIKALNERREPVV  161 (223)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCEEEEECCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             99999983599999999986089888888689998579788835324557999986689979999999999972789809


Q ss_pred             EEEECCHHHHHHHCCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99975323334420576660799847888222578862787089999999987889746508
Q gi|254781074|r  163 FMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI  224 (227)
Q Consensus       163 fiLwG~~A~~~~~~i~~~~~~il~~~HPSPls~~~gF~~~~~F~~~N~~L~~~~~~~IdW~l  224 (227)
T Consensus       162 f~LWG~~Aq~~~~~i~~~~h~il~s~HPSPlSa~rgF~g~~~F~k~N~~L~~~~~~pIdW~l  223 (223)
T PRK05254        162 FILWGSHAQKKKALIDTSKHLILESPHPSPLSAHRGFFGSKHFSKANEYLKQHGKTPIDWQL  223 (223)
T ss_pred             EEECCHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99816689998742698787799617999523468998887799999999987999835709