HHsearch alignment of GI: 254781074 and MMDB domain: 2c2q_A_

>2c2q_A (A:) G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A
Probab=96.21  E-value=0.028  Score=34.49  Aligned_cols=130  Identities=9%  Similarity=-0.026  Sum_probs=79.6

Q ss_pred             HHHCEEEEEECCCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCEEEECCHHCCCCCCC
Q ss_conf             86177999811888775200071000347986304699999999974188887740124322089688601011236860
Q gi|254781074|r   56 FNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRA  135 (227)
Q Consensus        56 ~~~vKVVIlGQDPY~~~g~A~GLaFsv~~~~~~p~SLrNI~Kel~~d~~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~  135 (227)
                      ..+.+|+||||.|=.. +...|..|+-+.+.    =|+.++.....+...   .--+.......||-+.|.+=....+..
T Consensus        23 ~~~a~iliiG~aPg~~-~~~~G~pf~g~sg~----~l~~l~~~g~~~~~~---~~~~~~~l~~~~v~it~~vk~~~~~~~   94 (199)
T 2c2q_A           23 QPGLTLVLVGTAPSGI-SARARAYYANPENK----FWRTLHAVGLTPRQL---VPQEYATLPQYGLGLTDVAKRHSGVAA   94 (199)
T ss_dssp             CTTCSEEEEESCCCHH-HHHHTSSSCSTTCC----HHHHHHHTTSSSSCC---CGGGGGGGGGGTEEEEESCCSCCSCGG
T ss_pred             CCCCCEEEEECCCCHH-HHHCCCCCCCCCCH----HHHHHHHHHCCCCCC---CHHHHCCCCCCCCEEECCCCCCCCCCC
T ss_conf             9998489984697987-99749875686207----899998851688777---866623311246135413565688878


Q ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHCC---------------CCCCCEEEEECCCCHHHCCC
Q ss_conf             445432599999999999961789879999753233344205---------------76660799847888222578
Q gi|254781074|r  136 ASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL---------------DHKRHLVLKAAHPSPLSASH  197 (227)
Q Consensus       136 ~SH~~~gW~~ft~~ii~~l~~~~~~vVfiLwG~~A~~~~~~i---------------~~~~~~il~~~HPSPls~~~  197 (227)
                      .....---.++-...|+.+    ++.+.++.|+.|-+..-..               ....-.++-..||||+.+..
T Consensus        95 ~~~~~e~~~~~L~~ei~~~----~P~iiv~lG~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~hpS~~~~~~  167 (199)
T 2c2q_A           95 ALPGEAWRPDELRRKVEHY----RPRIVAFTSKRGASETLGVPTGKLPYGPQPQPLDWPAETELWVLPSTSPLGHNH  167 (199)
T ss_dssp             GSCGGGCCHHHHHHHHHHH----CCSEEEESSHHHHHHHHCSCGGGCCSEECCCCSSCCTTCEEEECCCCSGGGTTT
T ss_pred             CCCHHHHHHHHHHHHHHHH----CCCEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCHHHHCC
T ss_conf             8756666676799999960----996899817799999853564434334332002356787445643888587073