HHsearch alignment of GI: 254781074 and MMDB domain: 2d3y_A_

>2d3y_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A*
Probab=93.55  E-value=0.28  Score=28.32  Aligned_cols=128  Identities=16%  Similarity=0.166  Sum_probs=65.3

Q ss_pred             HHCEEEEEECCCCCCCCCCCCCEEECC-CCCCCHHHHHHHHHHHHHHCCCCCCCC--CHHHHHHCCCEEEECCHHC-CCC
Q ss_conf             617799981188877520007100034-798630469999999997418888774--0124322089688601011-236
Q gi|254781074|r   57 NKVKVVILGQDPYHNYGQAHGLCFSVP-LGIRIPPSLVNVYKELQEDVNFIPPTH--GFLEHWGHEGVLLLNAVLT-VEE  132 (227)
Q Consensus        57 ~~vKVVIlGQDPY~~~g~A~GLaFsv~-~~~~~p~SLrNI~Kel~~d~~~~~~~~--g~L~~Wa~QGVLLLNt~LT-v~~  132 (227)
                      .+.+|+++|+.|=...+..+|..|+-. .+    .=|+++..+    .|.....-  -+...| ..++...|.+=- ...
T Consensus        49 ~~a~vl~VgeaPg~~~e~~~G~pF~g~~~g----~~l~~~l~~----~Gl~~~~~~~~~~~~~-~~~~~~t~~vk~~~~~  119 (219)
T 2d3y_A           49 PEARILLFGLAPGAHGSNRTGRPFTGDASG----AFLYPLLHE----AGLSSKPESLPGDDLR-LYGVYLTAAVRCAPPK  119 (219)
T ss_dssp             TTCSEEEEESCCCTTTHHHHSSTTTTSHHH----HHHHHHHHH----TTCBSCSCCCTTSCCC-BSSEEEEESCCSCCGG
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCEECCHHH----HHHHHHHHH----HCCCCCCHHCCCCCCC-CCCEEECCCCCCCCCC
T ss_conf             774789960542001023478641034037----788888998----4676430100121010-1120101553236766


Q ss_pred             CCCHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHC--------CCC---------CCCEEEEECCCCHHHC
Q ss_conf             86044543259999999999996178987999975323334420--------576---------6607998478882225
Q gi|254781074|r  133 GRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDV--------LDH---------KRHLVLKAAHPSPLSA  195 (227)
Q Consensus       133 g~~~SH~~~gW~~ft~~ii~~l~~~~~~vVfiLwG~~A~~~~~~--------i~~---------~~~~il~~~HPSPls~  195 (227)
                      ..+....-.-|.++...-|+.+   .++-|.++.|+.|-+..--        +..         ..-.++-+.|||++..
T Consensus       120 r~p~~~ei~~c~~~L~~ei~ll---~~P~iIv~lG~~a~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~hPs~l~~  196 (219)
T 2d3y_A          120 NKPTPEELRACARWTEVELGLL---PEVRVYVALGRIALEALLAHFGLRKSAHPFRHGAHYPLPGGRHLLASYHVSRQNT  196 (219)
T ss_dssp             GCCCHHHHHHHHHHHHHHHHTC---TTCCEEEEESHHHHHHHHHHHTCCTTTSCCCTTCEEEETTTEEEEEECCCSHHHH
T ss_pred             CCCCCHHHHHHCCHHHHHHHHH---CCCCEEEEECHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCEEEEEECCCCCCC
T ss_conf             6897088888486679999984---2861454303899998776516521223420221773799938999868886665


Q ss_pred             C
Q ss_conf             7
Q gi|254781074|r  196 S  196 (227)
Q Consensus       196 ~  196 (227)
                      +
T Consensus       197 ~  197 (219)
T 2d3y_A          197 Q  197 (219)
T ss_dssp             H
T ss_pred             C
T ss_conf             8