HHsearch results for GI: 254781074 and protein with PDBid: 4eug_A

>4eug_A UDG, UNG, protein (glycosylase); hydrolase; 1.40A {Escherichia coli B} SCOP: c.18.1.1 PDB: 5eug_A 1eug_A 2uug_A 3eug_A 2eug_A 1uug_A 1lqj_A 1lqm_A 1lqg_A 1flz_A 1eui_A 2jhq_A
Probab=100.00  E-value=0  Score=596.88  Aligned_cols=218  Identities=52%  Similarity=0.961  Sum_probs=212.2

Q ss_pred             CHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCCCCEEECCCCC
Q ss_conf             73389998887265899999999999997798085887699999842998617799981188877520007100034798
Q gi|254781074|r    7 HESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGI   86 (227)
Q Consensus         7 ~~sW~~~L~~e~~~~~~~~i~~~l~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPY~~~g~A~GLaFsv~~~~   86 (227)
                      .-+|+++|.+|+.++||.+|.++|.+|+.++.+|||+.++|||||++||+++||||||||||||++|||+||||||+.++
T Consensus         4 ~~sW~~~L~~e~~~~yf~~l~~~l~~e~~~~~~i~P~~~~iF~af~~~p~~~vKVVIlGQDPY~~~~~A~GLaFsv~~~~   83 (229)
T 4eug_A            4 ELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI   83 (229)
T ss_dssp             -CCHHHHHTTGGGSHHHHHHHHHHHHHHTTTSCEESCGGGTTHHHHHSCGGGCCEEEEESSCCCSTTTCSSSTTCCCTTS
T ss_pred             CCCHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHEEEEEEECCCCCCCCCCCCEEEECCCCC
T ss_conf             65699999989758999999999999998599564987999998862896374899972479998887687654458998


Q ss_pred             CCHHHHHHHHHHHHHHC-CCCCCCCCHHHHHHCCCEEEECCHHCCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             63046999999999741-88887740124322089688601011236860445432599999999999961789879999
Q gi|254781074|r   87 RIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFML  165 (227)
Q Consensus        87 ~~p~SLrNI~Kel~~d~-~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gW~~ft~~ii~~l~~~~~~vVfiL  165 (227)
                      ++|||||||||||++|+ ++..+++|||+.||+||||||||+|||++|+++||+++||++||+.+|++|+++++++||||
T Consensus        84 k~PpSL~NI~kel~~d~~~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gWe~ft~~ii~~l~~~~~~vVf~L  163 (229)
T 4eug_A           84 AIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLL  163 (229)
T ss_dssp             CCCHHHHHHHHHHHHHSTTCCCCSCCCCHHHHTTTEEEEESSCCEETTBTTTTTTSSHHHHHHHHHHHHHHHCSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCEEEEECEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             88888999999999853898778988664375398799723388877788887787879999999999984689849999


Q ss_pred             ECCHHHHHHHCCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             753233344205766607998478882225788627870899999999878897465088
Q gi|254781074|r  166 WGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP  225 (227)
Q Consensus       166 wG~~A~~~~~~i~~~~~~il~~~HPSPls~~~gF~~~~~F~~~N~~L~~~~~~~IdW~lp  225 (227)
                      ||++||+++.+|+..+|+||+++|||||||+||||||+||++||++|+++|++|||| +|
T Consensus       164 WG~~A~~~~~~i~~~~~~Il~s~HPSPlsa~rgF~g~~~F~k~N~~L~~~~~~pIdW-~~  222 (229)
T 4eug_A          164 WGSHAQKKGAIIDKQRHHVLKAPQPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW-MP  222 (229)
T ss_dssp             ESHHHHHHTTTSCTTTSEEEEECCSSTTTGGGTTTTCCHHHHHHHHHHHTTCCCCCC-SC
T ss_pred             ECHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEC-CC
T ss_conf             676889877417988866997279980004789889987999999999869998327-88