BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase
[Candidatus Liberibacter asiaticus str. psy62]
         (227 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040751|gb|ACT57547.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 227

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK
Sbjct: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG
Sbjct: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK
Sbjct: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
Sbjct: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227


>gi|218682331|ref|ZP_03529932.1| uracil-DNA glycosylase [Rhizobium etli CIAT 894]
          Length = 233

 Score =  315 bits (807), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 179/223 (80%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWK+ L   F S +M+ LK FL+++K+ GKRIFPRGS YFRA D+TP + VKVVI
Sbjct: 6   VSLEESWKAALAGEFSSPYMQQLKAFLVAQKQVGKRIFPRGSEYFRALDLTPISNVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMETDLGITPARHGFLEHWAKQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RHL
Sbjct: 126 LNSVLTVEEGQAATHQGKGWEKFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTTRHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VLKA HPSPLSA +GFFGC HFSKAN +LQ  G+T V+WQ+P+
Sbjct: 186 VLKAPHPSPLSAHNGFFGCAHFSKANAFLQSRGRTPVDWQLPV 228


>gi|294013125|ref|YP_003546585.1| uracil-DNA glycosylase [Sphingobium japonicum UT26S]
 gi|292676455|dbj|BAI97973.1| uracil-DNA glycosylase [Sphingobium japonicum UT26S]
          Length = 231

 Score =  314 bits (804), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 180/224 (80%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           + +++ ESW++ L   F+S +M+ LK FL  EKR+GKRIFP+GS YFRA D+TP +KVKV
Sbjct: 3   DTIRLDESWRAPLLGEFESPYMQGLKRFLEEEKRQGKRIFPKGSEYFRALDLTPLDKVKV 62

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           V+LGQDPYH  GQAHGLCFSV  G+R PPSLVN+YKELQ D+   PP HGFLEHW  +GV
Sbjct: 63  VVLGQDPYHGEGQAHGLCFSVKPGVRTPPSLVNIYKELQSDLGLRPPRHGFLEHWARQGV 122

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVE G+AASH+ RGWEQFTD++I L++  ++ +VF+LWG+ AQ+K + +D  R
Sbjct: 123 LLLNSVLTVEMGKAASHQKRGWEQFTDAIIRLVNQKNEPVVFLLWGSYAQRKAEFVDRTR 182

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVLKAAHPSPLSA +GF GCRHFS+AN +L+E G+  ++W +P
Sbjct: 183 HLVLKAAHPSPLSAHNGFLGCRHFSQANAFLEEKGRGAIDWGLP 226


>gi|327190494|gb|EGE57590.1| uracil-DNA glycosylase protein [Rhizobium etli CNPAF512]
          Length = 233

 Score =  313 bits (803), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 138/223 (61%), Positives = 179/223 (80%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWKS LE  F S +M+ LK FL+++K+ GKRIFP+GS YFRA D+TP   VK VI
Sbjct: 6   VSLEESWKSALEGEFSSPYMQQLKSFLVAQKQVGKRIFPKGSEYFRALDLTPIANVKAVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+  +P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMEADLGIVPARHGFLEHWARQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RH+
Sbjct: 126 LNSVLTVEEGQAAAHQGKGWERFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTSRHM 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VLKA HPSPLSA +GFFGC+HFSKAN +LQ  G+  ++WQ+P+
Sbjct: 186 VLKAPHPSPLSAHNGFFGCKHFSKANAFLQSRGRAPIDWQLPV 228


>gi|209550568|ref|YP_002282485.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536324|gb|ACI56259.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 235

 Score =  313 bits (801), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 139/222 (62%), Positives = 178/222 (80%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWK+ L   F S +M+ LK FL+++K+ GKRIFPRGS YFRA D+TP + VKVVI
Sbjct: 6   VSLEESWKAALAGEFSSPYMQQLKSFLVAQKQGGKRIFPRGSEYFRALDLTPISSVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE+Q D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMQTDLGIAPARHGFLEHWARQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RHL
Sbjct: 126 LNSVLTVEEGQAAAHQGKGWERFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDATRHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL+A HPSPLSA +GFFGC HFSKAN +LQ  G++ ++WQ+P
Sbjct: 186 VLRAPHPSPLSAHNGFFGCGHFSKANDFLQSRGRSPIDWQLP 227


>gi|190893069|ref|YP_001979611.1| uracil-DNA glycosylase [Rhizobium etli CIAT 652]
 gi|190698348|gb|ACE92433.1| uracil-DNA glycosylase protein [Rhizobium etli CIAT 652]
          Length = 233

 Score =  312 bits (799), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 179/223 (80%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWKS LE  F S +M+ LK FL+++K+ GK+IFP+GS YFRA D+TP   VK VI
Sbjct: 6   VSLEESWKSALEGEFSSPYMQQLKSFLVAQKQVGKQIFPKGSEYFRALDLTPIANVKAVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+  +P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMEADLGIVPARHGFLEHWARQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RH+
Sbjct: 126 LNSVLTVEEGQAAAHQGKGWERFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTARHM 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VLKA HPSPLSA +GFFGC+HFSKAN +LQ  G+  ++WQ+P+
Sbjct: 186 VLKAPHPSPLSAHNGFFGCKHFSKANAFLQSRGRAPIDWQLPV 228


>gi|218513978|ref|ZP_03510818.1| uracil-DNA glycosylase [Rhizobium etli 8C-3]
          Length = 224

 Score =  310 bits (795), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 137/218 (62%), Positives = 176/218 (80%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ESWKS LE  F S +M+ LK FL+++K+ GKRIFP+GS YFRA D+TP   VK VILGQD
Sbjct: 1   ESWKSALEGEFSSPYMQQLKSFLVAQKQVGKRIFPKGSEYFRALDLTPIANVKAVILGQD 60

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+  +P  HGFLEHW  +GVLLLN+V
Sbjct: 61  PYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMEADLGIVPARHGFLEHWARQGVLLLNSV 120

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RH+VLKA
Sbjct: 121 LTVEEGQAAAHQGKGWERFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTARHMVLKA 180

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            HPSPLSA +GFFGC+HFSKAN +LQ  G+  ++WQ+P
Sbjct: 181 PHPSPLSAHNGFFGCKHFSKANAFLQSRGRAPIDWQLP 218


>gi|307293772|ref|ZP_07573616.1| uracil-DNA glycosylase [Sphingobium chlorophenolicum L-1]
 gi|306879923|gb|EFN11140.1| uracil-DNA glycosylase [Sphingobium chlorophenolicum L-1]
          Length = 232

 Score =  310 bits (793), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 176/224 (78%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           + +K+ ESW++ L   F+S +M+ LK FL  EK +GKRIFP+G  YFRA D+TP +KVKV
Sbjct: 3   DTIKLDESWRAPLLQEFESPYMQGLKRFLQEEKAQGKRIFPKGGEYFRALDLTPLDKVKV 62

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           V+LGQDPYH  GQAHGLCFSV  G+R PPSLVN+YKELQ D+   PP HGFLEHW  +GV
Sbjct: 63  VVLGQDPYHGEGQAHGLCFSVKPGVRTPPSLVNIYKELQSDLGLRPPRHGFLEHWARQGV 122

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVE G+AASH+ RGWEQFTD+++ L++     +VF+LWG+ AQ+K + +D  R
Sbjct: 123 LLLNSVLTVEMGKAASHQKRGWEQFTDAIVRLVNQKSDPVVFLLWGSYAQRKAEFVDRSR 182

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVLKAAHPSPLSA +GF GCRHFS+AN +L+E G+  ++W +P
Sbjct: 183 HLVLKAAHPSPLSAHNGFLGCRHFSQANAFLEEKGRGAIDWGLP 226


>gi|222086867|ref|YP_002545401.1| uracil-DNA glycosylase [Agrobacterium radiobacter K84]
 gi|221724315|gb|ACM27471.1| uracil-DNA glycosylase [Agrobacterium radiobacter K84]
          Length = 233

 Score =  307 bits (787), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 173/222 (77%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+ ESWK  L   F S +M+ LK FL+ EK++GK IFPRGS YFRA D+TP ++V+VVI
Sbjct: 6   IKLEESWKEALSPEFDSPYMQQLKSFLVEEKQRGKVIFPRGSEYFRALDLTPLDEVQVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKEL+ D+   P  HGFLE W  +GVLL
Sbjct: 66  LGQDPYHGAGQAHGLCFSVRPGVRIPPSLVNIYKELETDLGIPPARHGFLESWAKQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEE +AASH+G+GWE+FTD+VI  +++    +VFMLWG+ AQKK   +D  RHL
Sbjct: 126 LNSVLTVEESQAASHQGKGWERFTDAVIRQVNDECDGVVFMLWGSYAQKKAAFVDTDRHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA +GFFGCRHFSKAN YL EHG+  + W +P
Sbjct: 186 VLKSVHPSPLSAHNGFFGCRHFSKANAYLVEHGREPIEWALP 227


>gi|116253414|ref|YP_769252.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258062|emb|CAK09162.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 235

 Score =  307 bits (786), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 137/222 (61%), Positives = 176/222 (79%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWK+ LE  F S +M+ LK FL+++K+ GKRIFP+GS YFRA D+TP + VK VI
Sbjct: 6   VSLEESWKAALEGEFSSPYMQQLKSFLVAQKQVGKRIFPKGSEYFRALDLTPISNVKAVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMETDLGIAPARHGFLEHWAKQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  + +VFMLWG+ AQ+K   +D  RHL
Sbjct: 126 LNSVLTVEEGQAAAHQGKGWERFTDAVIRKVNDECEPVVFMLWGSYAQRKAAFVDTARHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL+A HPSPLSA +GFFGC HFSKAN +LQ  G+  ++WQ+P
Sbjct: 186 VLRAPHPSPLSAHNGFFGCGHFSKANAFLQLRGRAPIDWQLP 227


>gi|25009525|sp|Q8UCM8|UNG_AGRT5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
          Length = 241

 Score =  305 bits (782), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 177/223 (79%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           GVK+ +SWK +L   F S +M+ LKEFLL+EK  GKRIFP+G+ YFRA D+TP ++VKVV
Sbjct: 9   GVKLEDSWKHVLSGEFASPYMQKLKEFLLAEKTAGKRIFPKGAEYFRALDLTPLDEVKVV 68

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKELQ D+   P  HGFLE W  +GVL
Sbjct: 69  ILGQDPYHGLGQAHGLCFSVQPGVRIPPSLVNIYKELQSDLGIRPVKHGFLESWAKQGVL 128

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN+VLTVEE RAASH+G+GWE+FTD+VI  +++   ++VF+LWG+ AQKK   +D ++H
Sbjct: 129 LLNSVLTVEEARAASHQGQGWEKFTDAVIRAVNDECDHVVFLLWGSYAQKKAAFVDQRKH 188

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           LVL++ HPSPLSA +GFFG  HFSKAN +L  HG+  ++WQ+P
Sbjct: 189 LVLRSPHPSPLSAHNGFFGNGHFSKANAFLVSHGRDPIDWQLP 231


>gi|241205932|ref|YP_002977028.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859822|gb|ACS57489.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 233

 Score =  305 bits (782), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 175/222 (78%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +  SWK+ LE  F S +M+ LK FL+++K  GKRIFP+GS YFRA D+TP + VK VI
Sbjct: 6   ISLEGSWKAALEGEFSSPYMQQLKSFLVTQKEVGKRIFPKGSEYFRALDLTPISNVKAVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMETDLGIAPARHGFLEHWAKQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RHL
Sbjct: 126 LNSVLTVEEGQAAAHQGKGWERFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTTRHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL+A HPSPLSA +GFFGC HFSKAN +LQ  G+  ++WQ+P
Sbjct: 186 VLRAPHPSPLSAHNGFFGCGHFSKANAFLQSRGRAPIDWQLP 227


>gi|325293806|ref|YP_004279670.1| uracil-DNA glycosylase [Agrobacterium sp. H13-3]
 gi|325061659|gb|ADY65350.1| uracil-DNA glycosylase [Agrobacterium sp. H13-3]
          Length = 230

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 138/223 (61%), Positives = 178/223 (79%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           GVK+ +SWK +L   F S +M+ LK+FLL+EK  GK IFP+G+ YFRA D+TP ++VKVV
Sbjct: 5   GVKLEDSWKRVLSTEFASPYMQKLKDFLLAEKTAGKHIFPKGAEYFRALDLTPLDRVKVV 64

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKELQ D+   P +HGFLE W  +GVL
Sbjct: 65  ILGQDPYHGVGQAHGLCFSVQPGVRIPPSLVNIYKELQSDLGIRPVSHGFLERWAKQGVL 124

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN+VLTVEE RAASH+G+GWE+FTD+VI  +++  +++VF+LWG+ AQKK   +D K+H
Sbjct: 125 LLNSVLTVEESRAASHQGQGWEKFTDAVIRAVNDECEHVVFLLWGSYAQKKAAFVDQKKH 184

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           LVL++ HPSPLSA +GFFG  HFSKAN +L  HG+  ++WQ+P
Sbjct: 185 LVLRSPHPSPLSAHNGFFGNGHFSKANAFLVSHGREPIDWQLP 227


>gi|159185223|ref|NP_355407.2| uracil-DNA glycosylase [Agrobacterium tumefaciens str. C58]
 gi|159140486|gb|AAK88192.2| uracil-DNA glycosylase [Agrobacterium tumefaciens str. C58]
          Length = 237

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 177/223 (79%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           GVK+ +SWK +L   F S +M+ LKEFLL+EK  GKRIFP+G+ YFRA D+TP ++VKVV
Sbjct: 5   GVKLEDSWKHVLSGEFASPYMQKLKEFLLAEKTAGKRIFPKGAEYFRALDLTPLDEVKVV 64

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKELQ D+   P  HGFLE W  +GVL
Sbjct: 65  ILGQDPYHGLGQAHGLCFSVQPGVRIPPSLVNIYKELQSDLGIRPVKHGFLESWAKQGVL 124

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN+VLTVEE RAASH+G+GWE+FTD+VI  +++   ++VF+LWG+ AQKK   +D ++H
Sbjct: 125 LLNSVLTVEEARAASHQGQGWEKFTDAVIRAVNDECDHVVFLLWGSYAQKKAAFVDQRKH 184

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           LVL++ HPSPLSA +GFFG  HFSKAN +L  HG+  ++WQ+P
Sbjct: 185 LVLRSPHPSPLSAHNGFFGNGHFSKANAFLVSHGRDPIDWQLP 227


>gi|222149618|ref|YP_002550575.1| uracil-DNA glycosylase [Agrobacterium vitis S4]
 gi|221736600|gb|ACM37563.1| uracil-DNA glycosylase [Agrobacterium vitis S4]
          Length = 233

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 176/222 (79%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++ +SWK+++   F+  +M+ LK+FL+ EK++GK IFP+G  YFRA D+TP +KV+VVI
Sbjct: 6   LRLEDSWKAVVGEEFEKPYMQTLKQFLVEEKQQGKPIFPKGPEYFRALDLTPIDKVRVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKELQ D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGAGQAHGLCFSVQPGVRIPPSLVNIYKELQADLGIAPVRHGFLEHWARQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEGRA SH+G+GWE+FTD VI  ++   +++VF+LWGA AQKK   +D  RHL
Sbjct: 126 LNSVLTVEEGRAGSHQGKGWEKFTDRVIHAVAERREHVVFILWGAYAQKKAAFVDPARHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA +GFFG + FSKAN YL+ HG+  ++WQ+P
Sbjct: 186 VLKSVHPSPLSAHNGFFGSKPFSKANAYLEAHGEVPIDWQLP 227


>gi|15966679|ref|NP_387032.1| uracil-DNA glycosylase [Sinorhizobium meliloti 1021]
 gi|307300286|ref|ZP_07580066.1| uracil-DNA glycosylase [Sinorhizobium meliloti BL225C]
 gi|307319569|ref|ZP_07598995.1| uracil-DNA glycosylase [Sinorhizobium meliloti AK83]
 gi|25009531|sp|Q92LU5|UNG_RHIME RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|15075951|emb|CAC47505.1| Probable uracil-DNA glycosylase [Sinorhizobium meliloti 1021]
 gi|306894691|gb|EFN25451.1| uracil-DNA glycosylase [Sinorhizobium meliloti AK83]
 gi|306904452|gb|EFN35036.1| uracil-DNA glycosylase [Sinorhizobium meliloti BL225C]
          Length = 241

 Score =  302 bits (774), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 137/222 (61%), Positives = 171/222 (77%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++ ESWK++L   F+  +M  LK FLL EK++G++IFPRG  YFRA D+TP ++V+VVI
Sbjct: 5   IRLEESWKAVLGGEFRHGYMAELKRFLLEEKQQGRQIFPRGVEYFRALDLTPLDRVRVVI 64

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+R PPSLVN+YKELQED+   P  HGFLE W  +GVLL
Sbjct: 65  LGQDPYHGDGQAHGLCFSVRPGVRTPPSLVNIYKELQEDLGIPPARHGFLESWARQGVLL 124

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE GRAASH+GRGWE+FTD+VI  ++   Q +VFMLWG+ AQ+K   +D  RHL
Sbjct: 125 LNSVLTVERGRAASHQGRGWERFTDAVIRAVNEQAQPVVFMLWGSYAQRKAAFVDRSRHL 184

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPLSA  GFFGCRHFSKAN +L   G   ++W++P
Sbjct: 185 VLTAPHPSPLSAHAGFFGCRHFSKANAFLTSKGLDPIDWRLP 226


>gi|150398018|ref|YP_001328485.1| uracil-DNA glycosylase [Sinorhizobium medicae WSM419]
 gi|166227478|sp|A6UDC0|UNG_SINMW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|150029533|gb|ABR61650.1| uracil-DNA glycosylase [Sinorhizobium medicae WSM419]
          Length = 241

 Score =  301 bits (770), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 171/222 (77%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++ ESWK+ L   F++ +M  LK FLL EK++G+++FPRG  YFRA D+TP ++V+VVI
Sbjct: 5   IRLEESWKAALGPEFRNGYMTELKRFLLDEKQQGRQVFPRGGEYFRALDLTPLDRVRVVI 64

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+R PPSLVN+YKEL+ED+   P  HGFLE W  +GVLL
Sbjct: 65  LGQDPYHGDGQAHGLCFSVRPGVRTPPSLVNIYKELKEDLGIDPARHGFLESWARQGVLL 124

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE GRAASH+GRGWE+FTD+VI  ++   Q +VFMLWG+ AQ+K   +D  RHL
Sbjct: 125 LNSVLTVERGRAASHQGRGWERFTDAVIRAVNEQAQPVVFMLWGSYAQRKAAFVDRSRHL 184

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPLSA  GFFGCRHFSKAN +L   G   ++W++P
Sbjct: 185 VLTAPHPSPLSAHSGFFGCRHFSKANAFLTSKGLDPIDWRLP 226


>gi|315500068|ref|YP_004088871.1| uracil-DNA glycosylase [Asticcacaulis excentricus CB 48]
 gi|315418080|gb|ADU14720.1| uracil-DNA glycosylase [Asticcacaulis excentricus CB 48]
          Length = 262

 Score =  300 bits (768), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 138/224 (61%), Positives = 172/224 (76%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           +G+ +   WK+ L   F S +M++LK FL  EK  GKRIFPRGS YFRA D+TP +KVKV
Sbjct: 33  DGISLEPGWKAALTPEFHSPYMQSLKAFLKEEKAHGKRIFPRGSEYFRALDLTPLDKVKV 92

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           VILGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE+Q D+   P  HGFLEHW  +GV
Sbjct: 93  VILGQDPYHGEGQAHGLCFSVRPGVRIPPSLVNIYKEMQSDLGIPPARHGFLEHWARQGV 152

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVEEG+AA+H+GRGWE+FTD+VI  ++   Q +VF+LWGA AQKK   +D  R
Sbjct: 153 LLLNSVLTVEEGKAAAHQGRGWEKFTDAVIARVNALPQPVVFILWGAYAQKKTAFVDASR 212

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVLK+AHPSPLSA +GF G + FSK N +L+  G T ++W++P
Sbjct: 213 HLVLKSAHPSPLSAHNGFLGSQPFSKTNAWLKAQGVTPIDWKLP 256


>gi|297568722|ref|YP_003690066.1| uracil-DNA glycosylase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924637|gb|ADH85447.1| uracil-DNA glycosylase [Desulfurivibrio alkaliphilus AHT2]
          Length = 234

 Score =  298 bits (764), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           E +++ ESWK+LL   F   +M+ L+EFLL EKR GK I+P G   F A ++T F  VKV
Sbjct: 6   EQIQLEESWKNLLLEEFAQPYMQQLREFLLQEKRAGKVIYPPGGEMFNALNLTHFADVKV 65

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           VILGQDPYH  GQAHGLCFSV  G  +PPSL+N+YKELQ DV F PP HG+L+ W  +GV
Sbjct: 66  VILGQDPYHGPGQAHGLCFSVRPGTAVPPSLLNIYKELQSDVGFSPPNHGYLQSWTRQGV 125

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLNA L+VE G+A SH+G+GWE+FTD ++ L++   +++VF+LWG+ AQKK  ++D +R
Sbjct: 126 LLLNATLSVERGKAGSHQGKGWERFTDRIVALLNEQGEHLVFLLWGSYAQKKGAIIDTRR 185

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVL+A HPSPLSA+ GFFGCRHFSKAN+YL  +GKT +NWQIP
Sbjct: 186 HLVLRAPHPSPLSANRGFFGCRHFSKANQYLTANGKTPINWQIP 229


>gi|227823506|ref|YP_002827479.1| uracil-DNA glycosylase [Sinorhizobium fredii NGR234]
 gi|227342508|gb|ACP26726.1| uracil-DNA glycosylase [Sinorhizobium fredii NGR234]
          Length = 258

 Score =  296 bits (758), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/222 (59%), Positives = 171/222 (77%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++ ESWK++L   F+  +M +LK FLL EK++G++I+P+GS YFRA D+TP  KV+VVI
Sbjct: 22  IRLEESWKAVLTPEFRHGYMVDLKRFLLDEKQQGRQIYPKGSEYFRALDLTPLEKVRVVI 81

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+R PPSLVN+YKEL++D+   P  HGFLE W  +GVLL
Sbjct: 82  LGQDPYHGDGQAHGLCFSVQPGVRTPPSLVNIYKELRDDLGIPPARHGFLESWARQGVLL 141

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE GRAASH+G+GWE+FTD+VI  ++   Q +VFMLWG+ AQKK   +D  RHL
Sbjct: 142 LNSVLTVERGRAASHQGKGWERFTDAVIRAVNEQAQPVVFMLWGSYAQKKAAFVDRSRHL 201

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPLSA  GF GCRHFSKAN +L+      ++W++P
Sbjct: 202 VLTAPHPSPLSAHSGFLGCRHFSKANAFLESKRLDPIDWRLP 243


>gi|148556109|ref|YP_001263691.1| uracil-DNA glycosylase [Sphingomonas wittichii RW1]
 gi|148501299|gb|ABQ69553.1| Uracil-DNA glycosylase [Sphingomonas wittichii RW1]
          Length = 261

 Score =  295 bits (756), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/226 (60%), Positives = 168/226 (74%), Gaps = 4/226 (1%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+H+SW+  L   F S +M  L+EFL+ E+ KGKRIFP  S +FRA D+TP +KV+VVI
Sbjct: 30  IKLHDSWRDPLAEEFSSPYMAALREFLMGERAKGKRIFPVASDWFRALDLTPLDKVRVVI 89

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL  D+    P HGFLEHW  +GVLL
Sbjct: 90  LGQDPYHGLGQAHGLCFSVRPGVAPPPSLVNIYKELDSDLGIARPAHGFLEHWARQGVLL 149

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK--- 180
           LN+VLTVE G AASHR RGWE+FTD++I L++     +VFMLWG+ AQKK   +D     
Sbjct: 150 LNSVLTVEMGIAASHRDRGWEKFTDAIIRLVNAKPDPVVFMLWGSYAQKKAAFVDSTDRG 209

Query: 181 -RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            RHLVLKA HPSPLSA +GFFGC+HFSKAN +L EHG   ++W +P
Sbjct: 210 GRHLVLKAPHPSPLSAHNGFFGCKHFSKANAFLAEHGMAPIDWALP 255


>gi|86358841|ref|YP_470733.1| uracil-DNA glycosylase [Rhizobium etli CFN 42]
 gi|86282943|gb|ABC92006.1| uracil-DNA glycosylase protein [Rhizobium etli CFN 42]
          Length = 209

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/203 (63%), Positives = 165/203 (81%)

Query: 23  MRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSV 82
           M+ LK FL+++KR GKRIFP+GS YFRA D+TP   VK VILGQDPYH  GQAHGLCFSV
Sbjct: 1   MQQLKSFLVAQKRVGKRIFPKGSEYFRALDLTPIANVKAVILGQDPYHGLGQAHGLCFSV 60

Query: 83  PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRG 142
             G+RIPPSLVN+YKE++ D+   P  HGFLEHW  +GVLLLN+VLTVEEG+AA+H+G+G
Sbjct: 61  RPGVRIPPSLVNIYKEMETDLGIAPARHGFLEHWARQGVLLLNSVLTVEEGQAAAHQGKG 120

Query: 143 WEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGC 202
           WE+FTD++I  +++  +++VFMLWG+ AQ+K   +D  RHLVLKA HPSPLSA +GFFGC
Sbjct: 121 WERFTDAIIGKVNDECESVVFMLWGSYAQRKAAFVDTARHLVLKAPHPSPLSAHNGFFGC 180

Query: 203 RHFSKANRYLQEHGKTTVNWQIP 225
           +HFSKAN +LQ  G+  ++WQ+P
Sbjct: 181 KHFSKANAFLQSRGRPPIDWQLP 203


>gi|94264320|ref|ZP_01288113.1| Uracil-DNA glycosylase [delta proteobacterium MLMS-1]
 gi|94268939|ref|ZP_01291328.1| Uracil-DNA glycosylase [delta proteobacterium MLMS-1]
 gi|93451403|gb|EAT02255.1| Uracil-DNA glycosylase [delta proteobacterium MLMS-1]
 gi|93455286|gb|EAT05496.1| Uracil-DNA glycosylase [delta proteobacterium MLMS-1]
          Length = 249

 Score =  291 bits (744), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 166/224 (74%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + + +SWK  L   F   +M+NLK FL  E   GK IFPRG   F A D+TPF +VKVVI
Sbjct: 25  ISLEDSWKQRLLPEFAKPYMQNLKAFLKEEMAAGKTIFPRGGEMFAALDLTPFEQVKVVI 84

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH   QAHGLCFSV  G  IPPSL+N+YKEL +D+ F  P HGFL+ W  +GVLL
Sbjct: 85  IGQDPYHGPNQAHGLCFSVRPGTAIPPSLLNIYKELHDDLGFTIPNHGFLQSWATQGVLL 144

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA L+V+ G+A SH+G+GWE FTD +I L++   +++VFMLWG+ AQKK   +D  RHL
Sbjct: 145 LNATLSVQAGQAGSHQGKGWEAFTDRIIHLLNEEGEHLVFMLWGSYAQKKGSFIDRHRHL 204

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           VL A HPSPLSA  GFFGCRHFS+AN+YLQEHGK+ +NWQ+PL+
Sbjct: 205 VLTAPHPSPLSAHRGFFGCRHFSRANQYLQEHGKSPINWQLPLT 248


>gi|90416423|ref|ZP_01224354.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2207]
 gi|90331622|gb|EAS46850.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2207]
          Length = 237

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 164/222 (73%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+H SW S +   F   +M  L+EFL+++K  GK I+P  S +F AFD TPF+KV+VVI
Sbjct: 9   IKLHPSWCSAIGEEFDKPYMAQLREFLMAQKTAGKTIYPPASQWFGAFDTTPFDKVRVVI 68

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+++PPSL N+YKELQ D++ +PP HG L  W  +GVLL
Sbjct: 69  LGQDPYHGPGQAHGLCFSVLPGVKVPPSLANIYKELQADLDLVPPGHGCLTSWAEQGVLL 128

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTVE+  A +H+G+GWEQFTD  I  +++  + IVF+LWG+ AQKK   +D  RHL
Sbjct: 129 LNATLTVEQADAGAHQGKGWEQFTDRAIRALNDQREGIVFLLWGSYAQKKGAFIDQSRHL 188

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC+HFSK N++LQ+ G   ++WQ+P
Sbjct: 189 VLKSVHPSPLSAYRGFLGCKHFSKTNKFLQQQGGAPIDWQLP 230


>gi|329851071|ref|ZP_08265828.1| uracil-DNA glycosylase [Asticcacaulis biprosthecum C19]
 gi|328839917|gb|EGF89489.1| uracil-DNA glycosylase [Asticcacaulis biprosthecum C19]
          Length = 231

 Score =  287 bits (734), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 168/225 (74%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  VK+ ESWK+ L   F   +M +LK FL +EK  GKRIFP+GS +FRA D+TP ++V+
Sbjct: 1   MAEVKLEESWKAPLAGEFDKPYMHDLKAFLQAEKAAGKRIFPKGSDFFRALDLTPLDRVR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGLCFSV  G++ PPSLVN+YKELQ D+   P  HGFLEHW  +G
Sbjct: 61  VVILGQDPYHGEGQAHGLCFSVQPGVKTPPSLVNIYKELQTDLGIPPARHGFLEHWAKQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNAVLTV+ G A +H+G+GWE FTD+VI  +++    +VF+LWGA AQKK   +D  
Sbjct: 121 VLLLNAVLTVQMGVANAHQGKGWETFTDAVIRAVNDQPHPVVFILWGAYAQKKAAFVDTT 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HLVLK+ HPSPLSA +GFFG + FSK N +L+ HG   ++W++P
Sbjct: 181 KHLVLKSVHPSPLSAYNGFFGSKPFSKTNHFLEAHGFAPIDWRVP 225


>gi|89094636|ref|ZP_01167573.1| uracil-DNA glycosylase [Oceanospirillum sp. MED92]
 gi|89081106|gb|EAR60341.1| uracil-DNA glycosylase [Oceanospirillum sp. MED92]
          Length = 227

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/217 (58%), Positives = 162/217 (74%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ L + F+  +M  LKEFL  EK   K I+PR   +F A + TP ++VKVVILGQDP
Sbjct: 8   AWQAELADQFEQPYMLELKEFLRQEKDLKKIIYPRSESWFHALEATPLDQVKVVILGQDP 67

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH   QAHGLCFSV  G++IPPSLVN+YKEL  D+   P THG+LE W ++GVLLLN+VL
Sbjct: 68  YHQPNQAHGLCFSVLPGVKIPPSLVNIYKELNSDLGIQPVTHGYLESWANQGVLLLNSVL 127

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE+  AASH+G+GWEQFTD VI +++    N+VFMLWG+ AQKK   +D  RHLVLKA 
Sbjct: 128 TVEQSNAASHQGKGWEQFTDEVIRVVNERCSNVVFMLWGSYAQKKGACIDQSRHLVLKAP 187

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA  GF GCRHFS+AN YL++ G+T + WQ+P
Sbjct: 188 HPSPLSAHRGFLGCRHFSQANAYLEQTGRTAIQWQLP 224


>gi|254492584|ref|ZP_05105755.1| uracil-DNA glycosylase [Methylophaga thiooxidans DMS010]
 gi|224462105|gb|EEF78383.1| uracil-DNA glycosylase [Methylophaga thiooxydans DMS010]
          Length = 230

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 164/217 (75%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW+  L++ F + +M+ LK+FL +EK   K I+P  S++F A + TP N+VKVVILGQDP
Sbjct: 8   SWQPALKDEFSAPYMQELKQFLQAEKANHKVIYPNSSNWFHALETTPLNQVKVVILGQDP 67

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGLCFSV  G++ PPSLVN+YKEL +D+   P  HG+LE W  +GVLLLNAVL
Sbjct: 68  YHQPGQAHGLCFSVKPGVKTPPSLVNIYKELDKDLGIKPVNHGYLESWAKQGVLLLNAVL 127

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVEE  A +H+G+GWEQFTD +I +++    ++VFMLWG+ AQKK   +D ++HL+LKA 
Sbjct: 128 TVEESNANAHQGKGWEQFTDKIISIVNEQCNHVVFMLWGSYAQKKGSAIDPQKHLILKAP 187

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA  GF GC+HFS+AN YLQ+HG   +NWQ+P
Sbjct: 188 HPSPLSAYRGFLGCQHFSQANAYLQQHGTAAINWQLP 224


>gi|158337272|ref|YP_001518447.1| uracil-DNA glycosylase [Acaryochloris marina MBIC11017]
 gi|158307513|gb|ABW29130.1| uracil-DNA glycosylase [Acaryochloris marina MBIC11017]
          Length = 233

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/221 (56%), Positives = 169/221 (76%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK++LE+ F   +M+ LK+FL +EK  GK I+PRGS  F A D TPF+ VKVVI
Sbjct: 13  IKLDPSWKAVLEHVFAMSYMQELKQFLKAEKAAGKTIYPRGSLMFNAMDSTPFDHVKVVI 72

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSVP G+  PPSLVN++KE+++D+   PP HG L+ W  +GVLL
Sbjct: 73  LGQDPYHGPRQAHGLCFSVPEGVAPPPSLVNIFKEIEQDLGIKPPRHGCLQSWAAQGVLL 132

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE+ +AASHR +GWEQFTD++I  ++   +++VF+LWG+ AQ+K  ++D +RHL
Sbjct: 133 LNSVLTVEQHKAASHRNKGWEQFTDAIISALNQQREHLVFLLWGSYAQQKGKIIDRRRHL 192

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL + HPSPLSA  GFFG +HFSKAN YLQ++G   ++W +
Sbjct: 193 VLTSPHPSPLSAHRGFFGNQHFSKANAYLQKNGIEPISWSL 233


>gi|315122465|ref|YP_004062954.1| uracil-DNA glycosylase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495867|gb|ADR52466.1| uracil-DNA glycosylase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 148

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 141/148 (95%)

Query: 78  LCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAAS 137
           +CFSVPLGIRIPPSLVNVYKELQEDV+FIPP HGFLEHWGHEGVLLLN VLTVEEGRAAS
Sbjct: 1   MCFSVPLGIRIPPSLVNVYKELQEDVDFIPPIHGFLEHWGHEGVLLLNTVLTVEEGRAAS 60

Query: 138 HRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASH 197
           HRG+GWEQFTDSVI+LI+ N +N+VFMLWGASA KKQD++D+KRHLVLKAAHPSPLSA +
Sbjct: 61  HRGQGWEQFTDSVIELINKNRKNVVFMLWGASAHKKQDIIDNKRHLVLKAAHPSPLSARY 120

Query: 198 GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           GFFGCRHFS+AN+YLQE+G+T +NWQIP
Sbjct: 121 GFFGCRHFSQANQYLQEYGQTPINWQIP 148


>gi|9107933|gb|AAF85489.1|AE004075_4 uracil-DNA glycosylase [Xylella fastidiosa 9a5c]
          Length = 256

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + N      MR+L  FL + K  G  ++P GS  F AF+ TPF +VK VI
Sbjct: 19  IQLESSWKAHVGNWLLRPEMRDLSAFLRARKVAGVSVYPPGSQIFAAFEATPFQRVKAVI 78

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKEL+ED+  + P HG L  W   GVLL
Sbjct: 79  LGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRPDHGCLLPWAKRGVLL 138

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+G+GWE FTD V+D ++   + +VFMLWG+ AQ K  V+D +RHL
Sbjct: 139 LNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKVIDTRRHL 198

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKAAHPSPLSA  GF GCRHFS  N+YL +HG   V+W +P
Sbjct: 199 VLKAAHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLP 240


>gi|197117200|ref|YP_002137627.1| uracil-DNA glycosylase [Geobacter bemidjiensis Bem]
 gi|197086560|gb|ACH37831.1| uracil-DNA glycosylase [Geobacter bemidjiensis Bem]
          Length = 231

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 163/224 (72%), Gaps = 2/224 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++   WKS L   FQ  +M  LKEFL  E  + K I+P+GS YF AF+ T F+KVKVV+
Sbjct: 7   IQLEAGWKSHLLEEFQKLYMSELKEFLRLEIARKKTIYPKGSEYFNAFNSTSFDKVKVVV 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPT--HGFLEHWGHEGV 121
           LGQDPYH  GQAHGL FSVP G+ IPPSLVN++KE+Q D+        HG+L+ W  +GV
Sbjct: 67  LGQDPYHGPGQAHGLSFSVPRGVDIPPSLVNIFKEIQTDLGLTQEDFRHGYLKSWADQGV 126

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVE GRAASH+ +GWE FTD  + +++    ++VFMLWGA AQ+K  V+D KR
Sbjct: 127 LLLNSVLTVEAGRAASHQAKGWEIFTDRAVSMLNEKKDHLVFMLWGAYAQRKGGVIDEKR 186

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVL+A HPSPLSA  GF GCRHFS+AN YL  HG+  ++W++P
Sbjct: 187 HLVLRAPHPSPLSAHRGFLGCRHFSQANAYLARHGRDPIDWRLP 230


>gi|77747619|ref|NP_299969.2| uracil-DNA glycosylase [Xylella fastidiosa 9a5c]
 gi|32130446|sp|Q9PA28|UNG_XYLFA RecName: Full=Uracil-DNA glycosylase; Short=UDG
          Length = 253

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + N      MR+L  FL + K  G  ++P GS  F AF+ TPF +VK VI
Sbjct: 16  IQLESSWKAHVGNWLLRPEMRDLSAFLRARKVAGVSVYPPGSQIFAAFEATPFQRVKAVI 75

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKEL+ED+  + P HG L  W   GVLL
Sbjct: 76  LGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRPDHGCLLPWAKRGVLL 135

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+G+GWE FTD V+D ++   + +VFMLWG+ AQ K  V+D +RHL
Sbjct: 136 LNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKVIDTRRHL 195

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKAAHPSPLSA  GF GCRHFS  N+YL +HG   V+W +P
Sbjct: 196 VLKAAHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLP 237


>gi|148653388|ref|YP_001280481.1| uracil-DNA glycosylase [Psychrobacter sp. PRwf-1]
 gi|148572472|gb|ABQ94531.1| Uracil-DNA glycosylase [Psychrobacter sp. PRwf-1]
          Length = 269

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 124/223 (55%), Positives = 162/223 (72%), Gaps = 1/223 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VK+ E WK  L +   S++M NL++FL  E   GK I+P+ S  F AF++TP ++VKVVI
Sbjct: 46  VKMPEDWKQALADELTSDNMDNLRDFLRQEYGSGKSIYPKASQMFNAFNLTPLSQVKVVI 105

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA GL FSVP  I +PPSL N+ KE+ +D+  +PP HG L +W  +GVLL
Sbjct: 106 LGQDPYHGPGQAMGLSFSVPKMIPMPPSLRNIVKEMADDIGTVPPKHGDLTNWAKQGVLL 165

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTVEEG A SH+G+GWEQFTD+VID+++    N VF+LWG+ A+ K   +D  +HL
Sbjct: 166 LNASLTVEEGMAGSHQGKGWEQFTDAVIDVVNQQTNNTVFILWGSKAKLKGKFVDTDKHL 225

Query: 184 VLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPL+A+  GFFG + FSK N YLQ+HGKT ++WQ+P
Sbjct: 226 VLSAVHPSPLAANRGGFFGSKPFSKTNDYLQQHGKTPIDWQLP 268


>gi|71275286|ref|ZP_00651573.1| Uracil-DNA glycosylase [Xylella fastidiosa Dixon]
 gi|71902026|ref|ZP_00684070.1| Uracil-DNA glycosylase [Xylella fastidiosa Ann-1]
 gi|170731289|ref|YP_001776722.1| uracil-DNA glycosylase [Xylella fastidiosa M12]
 gi|238687966|sp|B0U620|UNG_XYLFM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|71164095|gb|EAO13810.1| Uracil-DNA glycosylase [Xylella fastidiosa Dixon]
 gi|71728205|gb|EAO30392.1| Uracil-DNA glycosylase [Xylella fastidiosa Ann-1]
 gi|167966082|gb|ACA13092.1| uracil-DNA glycosylase [Xylella fastidiosa M12]
          Length = 253

 Score =  271 bits (693), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 159/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + N      MR+L  FL + K  G  ++P GS  F AF+ TPF +VK VI
Sbjct: 16  IQLESSWKAHVGNWLLRPEMRDLSSFLRARKVAGVSVYPPGSQIFAAFEATPFQRVKAVI 75

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKEL+ED+  + P HG L  W + GVLL
Sbjct: 76  LGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRPDHGCLLPWANRGVLL 135

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+G+GWE FTD V+D ++   + +VFMLWG+ AQ K  V+D +RHL
Sbjct: 136 LNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKVIDTRRHL 195

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GCRHFS  N+YL +HG   V+W +P
Sbjct: 196 VLKAPHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLP 237


>gi|304311882|ref|YP_003811480.1| Uracil-DNA glycosylase [gamma proteobacterium HdN1]
 gi|301797615|emb|CBL45836.1| Uracil-DNA glycosylase [gamma proteobacterium HdN1]
          Length = 254

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (72%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK  L + F+  +M+ L++FL +EK+ GK I+PRGS YF+A + TPF +VKVV+
Sbjct: 30  IRLEGSWKQFLISEFEQPYMKGLRDFLNAEKQAGKSIYPRGSEYFQALNSTPFEEVKVVV 89

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G   PPSL+N++KELQ DV    P HG L HW  +GVLL
Sbjct: 90  LGQDPYHGPGQAHGLSFSVLPGTPFPPSLINIFKELQTDVGVPVPAHGCLSHWAEQGVLL 149

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE G+A SH+GRGWE FTD ++  +++  + +VF+LWG+ A KK   +D KRHL
Sbjct: 150 LNSVLTVEAGKAGSHQGRGWEIFTDRIVRELASQREGLVFLLWGSYAHKKGQFIDRKRHL 209

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL A HPSPLSA  GFFGC+HFS+ N +L  HGK  ++W +
Sbjct: 210 VLSAVHPSPLSAYRGFFGCKHFSQTNAFLLAHGKKPIDWTV 250


>gi|332187248|ref|ZP_08388987.1| uracil-DNA glycosylase [Sphingomonas sp. S17]
 gi|332012669|gb|EGI54735.1| uracil-DNA glycosylase [Sphingomonas sp. S17]
          Length = 231

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 123/228 (53%), Positives = 164/228 (71%), Gaps = 3/228 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  +++HESW + L   F   +M+ LK FL  E+  G+RIFPR + +FRA D+TP ++V+
Sbjct: 1   MSDIRLHESWLAPLRPEFDEPYMKALKTFLAQERAAGQRIFPRPTEWFRALDLTPLDQVR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSV  G+R PPSLVN+YKE+ +D+   PP HG L+HW  +G
Sbjct: 61  VVILGQDPYHGEGQAHGLAFSVQPGVRPPPSLVNIYKEMADDLGIAPPGHGLLDHWARQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDV---L 177
           VLLLN+VLTV  G+AASH+GRGWE+FTD+VI  ++   + +VF+LWGA AQKK      +
Sbjct: 121 VLLLNSVLTVRMGQAASHQGRGWERFTDAVIRAVAAKPEPVVFILWGAYAQKKAGFVREM 180

Query: 178 DHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              RH V+ + HPSPLSA  GFFG + FS+AN +L EHG+  ++W +P
Sbjct: 181 GGGRHGVITSVHPSPLSARGGFFGSKPFSRANAFLVEHGQKPIDWALP 228


>gi|71901712|ref|ZP_00683786.1| Uracil-DNA glycosylase [Xylella fastidiosa Ann-1]
 gi|71728529|gb|EAO30686.1| Uracil-DNA glycosylase [Xylella fastidiosa Ann-1]
          Length = 253

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 158/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + N      MR+L  FL + K  G  ++P GS  F AF+ TPF +VK VI
Sbjct: 16  IQLESSWKAHVGNWLLRPEMRDLSSFLRARKVAGVSVYPPGSQIFAAFEATPFQRVKAVI 75

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKEL+ED+  + P HG L  W   GVLL
Sbjct: 76  LGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRPDHGCLLPWAKRGVLL 135

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+G+GWE FTD V+D ++   + +VFMLWG+ AQ K  V+D +RHL
Sbjct: 136 LNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKVIDTRRHL 195

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GCRHFS  N+YL +HG   V+W +P
Sbjct: 196 VLKAPHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLP 237


>gi|267238|sp|P29950|UNG_PSEDE RecName: Full=Uracil-DNA glycosylase; Short=UDG
          Length = 217

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 156/208 (75%)

Query: 18  FQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHG 77
           F S +M +LK+FL+++K +G++IFPRG  YFRA D+TP +KV+VVILGQDPYH  GQAHG
Sbjct: 2   FASAYMADLKQFLVAQKNEGRQIFPRGPEYFRALDLTPLDKVRVVILGQDPYHGDGQAHG 61

Query: 78  LCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAAS 137
           LCFSV  G+R PPSLVN+YKEL  D+   P  HGFLE W  +GVLLLN+VLTV     AS
Sbjct: 62  LCFSVRPGVRTPPSLVNIYKELNTDLGIPPARHGFLESWARQGVLLLNSVLTVRARERAS 121

Query: 138 HRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASH 197
           H+G GWE+FTD++I  ++     +VFMLWG+ AQKK   +D  RHLVL+A HPSPLSA  
Sbjct: 122 HQGHGWEKFTDAIIRAVNEAEHPVVFMLWGSYAQKKAAFVDRSRHLVLRAPHPSPLSAHS 181

Query: 198 GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           GF GCRHFS+AN +L+  G   ++W++P
Sbjct: 182 GFLGCRHFSQANAFLESKGFDPIDWRLP 209


>gi|28199910|ref|NP_780224.1| uracil-DNA glycosylase [Xylella fastidiosa Temecula1]
 gi|182682662|ref|YP_001830822.1| uracil-DNA glycosylase [Xylella fastidiosa M23]
 gi|32130268|sp|Q879Z0|UNG_XYLFT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238691208|sp|B2IAB2|UNG_XYLF2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|28058041|gb|AAO29873.1| uracil-DNA glycosylase [Xylella fastidiosa Temecula1]
 gi|182632772|gb|ACB93548.1| uracil-DNA glycosylase [Xylella fastidiosa M23]
 gi|307578943|gb|ADN62912.1| uracil-DNA glycosylase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 253

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 157/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + N      MR+L  FL + K  G  ++P GS  F AF+ TPF +VK VI
Sbjct: 16  IQLESSWKAHVGNWLLRPEMRDLSSFLRARKVAGVSVYPPGSQIFAAFEATPFQRVKAVI 75

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKEL+ED+  + P HG L  W   GVLL
Sbjct: 76  LGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRPDHGCLLPWAKRGVLL 135

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+G+GWE FTD V+D ++   + +VFMLWG+ AQ K   +D +RHL
Sbjct: 136 LNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKAIDTRRHL 195

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GCRHFS  N+YL +HG   V+W +P
Sbjct: 196 VLKAPHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLP 237


>gi|307545582|ref|YP_003898061.1| uracil-DNA glycosylase [Halomonas elongata DSM 2581]
 gi|307217606|emb|CBV42876.1| uracil-DNA glycosylase [Halomonas elongata DSM 2581]
          Length = 227

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 163/222 (73%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + + +SW+  L   F++ +M+ L++FL  EK   K I+P  S++FRAF++TP  +V+VVI
Sbjct: 3   IPLPDSWQQWLGAEFEAPYMQALRDFLAGEKAARKVIYPHSSNWFRAFELTPLEEVRVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+++PPSLVN+YKEL  DV F P  HGFLE W  +GVLL
Sbjct: 63  LGQDPYHGPNQAHGLCFSVRPGVQVPPSLVNIYKELAADVGFQPVNHGFLESWARQGVLL 122

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE+G A SHRGRGWE FTD  I  ++ +    VF+LWG+ A+KK+ ++D  RHL
Sbjct: 123 LNTSLTVEQGNAGSHRGRGWETFTDRAIATVNEHAGPTVFLLWGSHARKKKALVDTSRHL 182

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL++ HPSPLSA  GFFG RHFS+AN +L E G+T ++WQ+P
Sbjct: 183 VLESPHPSPLSAHRGFFGNRHFSRANAFLAEQGRTPIDWQLP 224


>gi|322418242|ref|YP_004197465.1| uracil-DNA glycosylase [Geobacter sp. M18]
 gi|320124629|gb|ADW12189.1| uracil-DNA glycosylase [Geobacter sp. M18]
          Length = 230

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/223 (57%), Positives = 159/223 (71%), Gaps = 2/223 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWKS L   F   +M++L+EFL  E  + K I+P+GS YF AF+ T F KV+VVI
Sbjct: 7   IRLEPSWKSHLLGEFDKPYMQDLREFLRQEISRRKVIYPKGSEYFNAFNSTSFEKVRVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPT--HGFLEHWGHEGV 121
           LGQDPYH   QAHGLCFSV  G+  PPSLVN++KE+Q D+   P    HG L+ W  +GV
Sbjct: 67  LGQDPYHGPDQAHGLCFSVQHGVETPPSLVNIFKEIQSDLGLSPADFRHGHLKAWADQGV 126

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVE GRAASH+GRGWE FTD  I L++     +VFMLWGA AQKK  V+D  R
Sbjct: 127 LLLNSVLTVEAGRAASHQGRGWETFTDRAISLLNEEKDRLVFMLWGAYAQKKGAVIDQTR 186

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HLVL A HPSPLSA  GF GCRHFSKAN YL +HG   ++W++
Sbjct: 187 HLVLCAPHPSPLSAHRGFLGCRHFSKANAYLVQHGLEPIDWRL 229


>gi|104783285|ref|YP_609783.1| uracil-DNA glycosylase [Pseudomonas entomophila L48]
 gi|122402100|sp|Q1I5T6|UNG_PSEE4 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|95112272|emb|CAK16999.1| uracil-DNA glycosylase [Pseudomonas entomophila L48]
          Length = 230

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP  +VKVVI
Sbjct: 7   IKLEPSWKAALRAEFDQPYMHQLREFLRQEYAAGKEIYPPGPLIFNALNSTPLEQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N   P HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELQRDLNLPIPNHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TV+   AASH  +GWE FTD +I ++S    N+VF+LWGA AQ KQ ++D  RHL
Sbjct: 127 LNTTMTVQRANAASHAKKGWEFFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTRHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GFFGC HFS+AN +LQ+HG   ++W +P
Sbjct: 187 VLKSVHPSPLSAYRGFFGCGHFSRANGFLQQHGMAPIDWSLP 228


>gi|110834507|ref|YP_693366.1| uracil-DNA glycosylase [Alcanivorax borkumensis SK2]
 gi|110647618|emb|CAL17094.1| uracil-DNA glycosylase [Alcanivorax borkumensis SK2]
          Length = 237

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 161/222 (72%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V +   WK  LE  FQ ++M  L+ FL  +KR+GK +FP G   F AF++TPF+ VKVVI
Sbjct: 15  VPLEPGWKQHLEGEFQRDYMAQLRHFLAQQKREGKTVFPPGPDIFNAFNLTPFDCVKVVI 74

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G++ PPSL+N+YKE+  D+ F  PTHG L +W  +GVLL
Sbjct: 75  LGQDPYHGPNQAHGLCFSVQHGVKTPPSLMNIYKEIHRDLGFDIPTHGNLTYWAEQGVLL 134

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE G+A SH+ +GWE FTD  I+ ++   + +VF+LWG+ AQKK  ++D ++H 
Sbjct: 135 LNAVLTVEAGQAGSHQKQGWETFTDQAIEHLNREREGLVFLLWGSHAQKKGRLIDREKHC 194

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPLSA  GF GC HFS+AN+YL +HG+T ++W +P
Sbjct: 195 VLSAPHPSPLSAYRGFLGCGHFSRANQYLLQHGETAIDWSVP 236


>gi|254523381|ref|ZP_05135436.1| uracil-DNA glycosylase [Stenotrophomonas sp. SKA14]
 gi|219720972|gb|EED39497.1| uracil-DNA glycosylase [Stenotrophomonas sp. SKA14]
          Length = 237

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK  + ++     MR L  FL   K  G  +FP G   F AFD TPF +VKVVI
Sbjct: 11  IQLEPSWKQHVGDYLLQPQMRELSSFLRQRKAGGASVFPPGPQIFAAFDATPFEQVKVVI 70

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+ +PPSL+N+YKE++ D+    P HG L  W   GVLL
Sbjct: 71  LGQDPYHGRGQAHGLSFSVAPGVPVPPSLLNIYKEIESDLGLPRPDHGCLIPWAQRGVLL 130

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVEEG+A +H+GRGWE FTD V+D+++   + +VFMLWGA AQ+K  V+D +RH 
Sbjct: 131 LNAVLTVEEGKAGAHQGRGWEGFTDHVVDVLNREREGLVFMLWGAYAQQKGKVIDTRRHR 190

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GCRHFS AN YLQ  G+  ++W +P
Sbjct: 191 VLKSPHPSPLSAHRGFLGCRHFSMANEYLQRRGQAPIDWSLP 232


>gi|254427115|ref|ZP_05040822.1| uracil-DNA glycosylase [Alcanivorax sp. DG881]
 gi|196193284|gb|EDX88243.1| uracil-DNA glycosylase [Alcanivorax sp. DG881]
          Length = 238

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 159/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V +   WK  L   F+ ++M  L+ FL  +KR GK +FP G   F AF++TPF +VKVVI
Sbjct: 15  VPLEPGWKRHLAGEFEQDYMAQLRAFLAEQKRAGKTVFPPGPDIFNAFNLTPFEQVKVVI 74

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G++ PPSLVN+YKE+  D+ F  P+HG L HW  +GVLL
Sbjct: 75  LGQDPYHGPNQAHGLCFSVQHGVKTPPSLVNIYKEIHRDLGFEIPSHGNLTHWAEQGVLL 134

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE G+AASH+ +GWE+FTD  I+ ++   + +VF+LWG+ AQKK  ++D  +H 
Sbjct: 135 LNAVLTVEAGQAASHQKQGWERFTDEAIEHLNREREGLVFLLWGSHAQKKGRLIDRDKHC 194

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL A HPSPLSA  GF GC HFS+AN+YL + GKT ++W +P
Sbjct: 195 VLSAPHPSPLSAYRGFLGCGHFSRANQYLLQQGKTAIDWSVP 236


>gi|42524853|ref|NP_970233.1| uracil-DNA glycosylase [Bdellovibrio bacteriovorus HD100]
 gi|39577063|emb|CAE78292.1| Uracil-DNA glycosylase [Bdellovibrio bacteriovorus HD100]
          Length = 262

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 161/221 (72%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F++E M+ L +FL +E + GK I+P G  YF A ++TPF+KVKVVI
Sbjct: 41  IKLDSSWKQHLHLEFETERMQKLNKFLSAEYKAGKTIYPHGDDYFAAMNLTPFDKVKVVI 100

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+R PPSL N++KEL +DV    P  G L  W  EGVLL
Sbjct: 101 VGQDPYHGPGQAHGLCFSVQDGVRFPPSLRNIFKELHDDVGATIPQSGSLTKWAQEGVLL 160

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+G+AA+H+G+GWE+FTD +I +++   +N+VF+LWG+ AQKK   +D K+HL
Sbjct: 161 LNAVLTVEDGKAAAHQGKGWEEFTDKIIHVLNEEKENLVFILWGSYAQKKASFVDRKKHL 220

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL+A HPSPLSA  GFFG + FSK N YL+  G   +NW +
Sbjct: 221 VLEAVHPSPLSAHRGFFGTKPFSKTNAYLKSKGIGEINWNL 261


>gi|331005232|ref|ZP_08328625.1| Uracil-DNA glycosylase [gamma proteobacterium IMCC1989]
 gi|330420975|gb|EGG95248.1| Uracil-DNA glycosylase [gamma proteobacterium IMCC1989]
          Length = 225

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 161/224 (71%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  + +  SW   +E+ F   +M+ LK FL +EKR+GK I+P     F AF  TPFN VK
Sbjct: 1   MSKIDLPSSWLVHVESEFSQSYMKQLKLFLQAEKREGKTIYPASDSIFNAFKATPFNDVK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VV+LGQDPYH  GQAHGL FSVP G+R PPSLVN++KE   D+    P+HG L+ W  +G
Sbjct: 61  VVVLGQDPYHGIGQAHGLSFSVPKGVRTPPSLVNIFKEANRDLGIQIPSHGCLQSWAEQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTVE+  A SH+G+GWE FTD VI+++S+  +++VF+LWG+ AQKK  V+D  
Sbjct: 121 VLLLNATLTVEQANAGSHQGQGWELFTDKVIEVLSDQREHVVFLLWGSYAQKKGRVIDQN 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL++AHPSPLSA  GF G  HFS  N YL++HG++ ++WQ+
Sbjct: 181 KHLVLRSAHPSPLSAYRGFIGNGHFSATNEYLEKHGQSPIDWQV 224


>gi|253702045|ref|YP_003023234.1| uracil-DNA glycosylase [Geobacter sp. M21]
 gi|251776895|gb|ACT19476.1| uracil-DNA glycosylase [Geobacter sp. M21]
          Length = 229

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 161/224 (71%), Gaps = 2/224 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++   WKS +   FQ  +M  LKEFL  E  + K I+P+GS YF AF+ T F+KVKVV+
Sbjct: 5   IQMEAGWKSHMLEEFQKLYMSELKEFLRLEIARKKTIYPKGSEYFNAFNSTSFDKVKVVV 64

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPT--HGFLEHWGHEGV 121
           LGQDPYH  GQAHGL FSVP G+ IPPSLVN+ KE+Q D+        HG L+ W  +GV
Sbjct: 65  LGQDPYHGPGQAHGLSFSVPRGVDIPPSLVNIIKEIQRDLVLTQEDFRHGHLKSWADQGV 124

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN+VLTVE GRAASH+G+GWE FTD  + +++    ++VFMLWGA AQ+K  V+D KR
Sbjct: 125 LLLNSVLTVEAGRAASHQGKGWEIFTDRAVSMLNGKKNHLVFMLWGAYAQRKGGVIDDKR 184

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HLVL+A HPSPLSA  GF GCRHFS+AN YL  HG   ++W++P
Sbjct: 185 HLVLRAPHPSPLSAHRGFLGCRHFSQANAYLARHGMDPIDWRLP 228


>gi|332973010|gb|EGK10949.1| uracil-DNA glycosylase [Psychrobacter sp. 1501(2011)]
          Length = 246

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/223 (55%), Positives = 162/223 (72%), Gaps = 1/223 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VK+ E WK  L +   S++M NL+EFL  E   GK I+P+GS  F AF++TP ++VKVVI
Sbjct: 23  VKMPEDWKLALADELTSQNMDNLREFLRQEYSAGKTIYPKGSQMFNAFNLTPLSEVKVVI 82

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA GL FSVP  I  PPSL N+ KE+ +D+  +P  HG L HW  +GVLL
Sbjct: 83  LGQDPYHGPGQAMGLSFSVPKIIPKPPSLNNILKEMADDIGTVPSRHGDLTHWAKQGVLL 142

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTVEEG A SH+G+GWEQFTD+VID+I+   ++ VF+LWG+ A+ K   +D  +HL
Sbjct: 143 LNASLTVEEGDAGSHQGKGWEQFTDAVIDVINKQTEHTVFILWGSKAKLKGKFIDTDKHL 202

Query: 184 VLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +L A HPSPL+A+  GFFG + FSKAN YL +HGK+ ++WQ+P
Sbjct: 203 ILSAVHPSPLAANRGGFFGTKPFSKANEYLIQHGKSAIDWQLP 245


>gi|70728814|ref|YP_258563.1| uracil-DNA glycosylase [Pseudomonas fluorescens Pf-5]
 gi|123657370|sp|Q4KGS0|UNG_PSEF5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|68343113|gb|AAY90719.1| uracil-DNA glycosylase [Pseudomonas fluorescens Pf-5]
          Length = 230

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 157/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M  L+EFL  E   GK I+P G   F A + TP +KVKVVI
Sbjct: 7   IKLEPSWKEALRAEFDQPYMSELREFLRQEHAAGKEIYPPGPMIFNALNSTPLDKVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG+L+ W  +GVL+
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNHGYLQSWAEQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH G+GW+ FTD +I+++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAGKGWQFFTDRIIEVVSEHQPHLVFLLWGAHAQSKQKLIDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF GC HFS+ N+YL+++G+T + W++P
Sbjct: 187 VLTSVHPSPLSAYRGFLGCGHFSRTNKYLEQNGETPIEWRLP 228


>gi|26988146|ref|NP_743571.1| uracil-DNA glycosylase [Pseudomonas putida KT2440]
 gi|32171732|sp|Q88N05|UNG_PSEPK RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|24982878|gb|AAN67035.1|AE016332_5 uracil-DNA glycosylase [Pseudomonas putida KT2440]
          Length = 230

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP ++VKVVI
Sbjct: 7   IKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLDQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N   P+HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIPSHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD +I ++S    N+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWELFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+AN +L++ G   ++W +P
Sbjct: 187 VLKSVHPSPLSAYRGFIGCGHFSRANSFLEQRGLGPIDWALP 228


>gi|330808055|ref|YP_004352517.1| uracil-DNA glycosylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376163|gb|AEA67513.1| uracil-DNA glycosylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 230

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 157/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M  L+EFL  E   GK I+P     F A + TP +KVKVVI
Sbjct: 7   IKLEPSWKQALRAEFDQPYMAELREFLRREYAAGKEIYPPAPLIFNALNSTPLDKVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN++KEL+ D+N   P HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIFKELKRDLNIDIPNHGYLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   A +H G+GW+ FTD VI+++S + QN+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANANAHAGKGWQHFTDRVIEVVSEHQQNLVFLLWGAHAQGKQKLIDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF GC HFS+AN++L++HG+  ++W++P
Sbjct: 187 VLTSVHPSPLSAYRGFLGCGHFSRANKFLEQHGEAPIDWRLP 228


>gi|78049506|ref|YP_365681.1| uracil-DNA glycosylase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|123584012|sp|Q3BNI2|UNG_XANC5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|78037936|emb|CAJ25681.1| uracil-DNA glycosylase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 241

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF +VKVVI
Sbjct: 8   IQLEPSWKARVGDWLLRPQMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFEQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V+D ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVDTLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GCRHFSK N +L+  G + ++W +P
Sbjct: 188 VLKAPHPSPLSAHRGFLGCRHFSKTNDHLRRRGLSPIDWSLP 229


>gi|311693660|gb|ADP96533.1| uracil-DNA glycosylase [marine bacterium HP15]
          Length = 244

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 118/216 (54%), Positives = 157/216 (72%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           WK  L   F+  +M+ L EFL +E++ GK +FP   H F A + TP + V+VVILGQDPY
Sbjct: 17  WKDHLAEEFRQPYMQGLAEFLAAEEQAGKVLFPASQHCFNALNSTPLDNVRVVILGQDPY 76

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H  GQAHGLCFSV   + IPPSLVN++KE+Q+D+   PP HG L+ W  +GVLLLN+VLT
Sbjct: 77  HGPGQAHGLCFSVRPNVAIPPSLVNIFKEIQDDLGIAPPDHGCLQPWAEQGVLLLNSVLT 136

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           V +G+A +H+G+GWE FTD VI+ ++   + +VF+LWG+ A+KK   +D  +HLVL   H
Sbjct: 137 VVQGQAGAHQGKGWETFTDKVIETVNREREGVVFLLWGSYAKKKGQHIDRNKHLVLDGPH 196

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           PSPLSA  GFFGC+HFSKAN +L++ GK TVNW +P
Sbjct: 197 PSPLSAYRGFFGCKHFSKANDWLEQQGKPTVNWALP 232


>gi|313500359|gb|ADR61725.1| Uracil-DNA glycosylase [Pseudomonas putida BIRD-1]
          Length = 230

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP  +VKVVI
Sbjct: 7   IKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLGQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N   P+HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIPSHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD +I ++S    N+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWELFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+AN +L++ G   ++W +P
Sbjct: 187 VLKSVHPSPLSAYRGFIGCGHFSRANSFLEQRGLGPIDWTLP 228


>gi|167035390|ref|YP_001670621.1| uracil-DNA glycosylase [Pseudomonas putida GB-1]
 gi|189037443|sp|B0KV50|UNG_PSEPG RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166861878|gb|ABZ00286.1| uracil-DNA glycosylase [Pseudomonas putida GB-1]
          Length = 230

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP ++VKVVI
Sbjct: 7   IKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLDQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N    +HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIASHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD VI ++S    N+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWEFFTDRVIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+ N +L++ G   +NW +P
Sbjct: 187 VLKSVHPSPLSAYRGFLGCGHFSRTNSFLEQRGMAPINWALP 228


>gi|294626530|ref|ZP_06705129.1| uracil-DNA glycosylase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292599220|gb|EFF43358.1| uracil-DNA glycosylase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 241

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 156/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP GS  F AFD TPF +VKVVI
Sbjct: 8   IQLEPSWKARVGDWLLRPQMQELSAFLRQRKAAGARVFPPGSQIFAAFDATPFEQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GC+HFSK N +L+  G + ++W +P
Sbjct: 188 VLKAPHPSPLSAHRGFLGCQHFSKTNDHLRRRGLSPIDWSLP 229


>gi|148549514|ref|YP_001269616.1| uracil-DNA glycosylase [Pseudomonas putida F1]
 gi|166227476|sp|A5W8H2|UNG_PSEP1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|148513572|gb|ABQ80432.1| Uracil-DNA glycosylase [Pseudomonas putida F1]
          Length = 230

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP  +VKVVI
Sbjct: 7   IKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLGQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N   P+HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIPSHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD +I ++S    N+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWELFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+ N +L++ G   ++W +P
Sbjct: 187 VLKSVHPSPLSAYRGFIGCGHFSRTNSFLEQRGLGPIDWALP 228


>gi|294665097|ref|ZP_06730401.1| uracil-DNA glycosylase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605139|gb|EFF48486.1| uracil-DNA glycosylase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 241

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 156/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP GS  F AFD TPF +VKVVI
Sbjct: 8   IQLEPSWKARVGDWLLRPQMQELSAFLRQRKAAGARVFPPGSQIFAAFDATPFEQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GC+HFSK N +L+  G + ++W +P
Sbjct: 188 VLKAPHPSPLSAHRGFLGCQHFSKTNDHLRRRGLSPIDWSLP 229


>gi|21244549|ref|NP_644131.1| uracil-DNA glycosylase [Xanthomonas axonopodis pv. citri str. 306]
 gi|25009523|sp|Q8PFZ6|UNG_XANAC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|21110223|gb|AAM38667.1| uracil-DNA glycosylase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      MR L  FL   K  G R+FP G   F AFD TPF +VKVVI
Sbjct: 8   IQLEPSWKARVGDWLLRPQMRELSAFLRQRKAAGARVFPPGPQIFAAFDATPFEQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQTRHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GC+HFSK N +L+  G + ++W +P
Sbjct: 188 VLKAPHPSPLSAHRGFLGCQHFSKTNDHLRRRGLSPIDWSLP 229


>gi|254785322|ref|YP_003072751.1| uracil-DNA glycosylase [Teredinibacter turnerae T7901]
 gi|237684223|gb|ACR11487.1| uracil-DNA glycosylase [Teredinibacter turnerae T7901]
          Length = 227

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 159/222 (71%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V++  +W   +   F   +M++LK FL  EKR GK +FP G+H F A + TPF++VKVVI
Sbjct: 5   VQLDPTWLEQVGGEFDQPYMKSLKAFLREEKRAGKVVFPAGNHIFNALNTTPFDQVKVVI 64

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL N++KE+ +D+     THG+L+ W  +GVLL
Sbjct: 65  LGQDPYHGPGQAHGLCFSVLPGVPTPPSLQNIFKEIHQDLGLPVATHGYLQSWAEQGVLL 124

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTVE+GRA SH+ +GWE FTD+VI  + N  +++VF+LWG+ AQ+K  ++D KRH 
Sbjct: 125 LNATLTVEQGRAGSHQNKGWETFTDAVITAL-NGREHVVFLLWGSYAQRKGAIIDAKRHY 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GFFGC HFS  NRYL+  G   ++W +P
Sbjct: 184 VLKSPHPSPLSAHRGFFGCHHFSCTNRYLESFGIAPIDWSLP 225


>gi|120555183|ref|YP_959534.1| uracil-DNA glycosylase [Marinobacter aquaeolei VT8]
 gi|120325032|gb|ABM19347.1| Uracil-DNA glycosylase [Marinobacter aquaeolei VT8]
          Length = 243

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 157/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K    W   L + F+  +MR L EFL +E++ GK ++P  +H F A + TP   V VVI
Sbjct: 11  LKPGRGWDQWLADEFRQPYMRQLAEFLAAEEQAGKVLYPPSTHCFNALNSTPLANVNVVI 70

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV   +  PPSLVN++KE++ D+   PP HG L+ W  +GVLL
Sbjct: 71  LGQDPYHGPGQAHGLCFSVRPQVPPPPSLVNIFKEIETDLGIAPPDHGCLQPWAEQGVLL 130

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE+  A +H+G+GWE+FTD VI++I+    N+VF+LWG+ A+KK   +D  RHL
Sbjct: 131 LNSVLTVEQSNAGAHQGKGWERFTDKVIEVINRERDNVVFLLWGSYAKKKGQHIDRNRHL 190

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL   HPSPLSA  GFFGCRHFSKAN +L+E G+ +V+W +P
Sbjct: 191 VLDGPHPSPLSAYRGFFGCRHFSKANEWLREQGRPSVDWALP 232


>gi|289664835|ref|ZP_06486416.1| uracil-DNA glycosylase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 241

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF++VKVVI
Sbjct: 8   IQLEPSWKAKVGDWLLRPEMQELSAFLRQRKAAGARVFPPGPQIFTAFDATPFDQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGVVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G + ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCQHFSKTNAHLQRRGISPIDWSLP 229


>gi|166710449|ref|ZP_02241656.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 241

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF++VKVVI
Sbjct: 8   IQLEPSWKAKVGDWLLRPQMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFDQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G + ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCQHFSKTNAHLQRRGISPIDWSLP 229


>gi|325273362|ref|ZP_08139625.1| uracil-DNA glycosylase [Pseudomonas sp. TJI-51]
 gi|324101501|gb|EGB99084.1| uracil-DNA glycosylase [Pseudomonas sp. TJI-51]
          Length = 230

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L   F   +M  L+EFL SE   GK+I+P G   F A + TP  +VKVVI
Sbjct: 7   IKLEPSWKAALRGEFDQPYMHQLREFLRSEYAAGKQIYPPGPLIFNALNSTPLQQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKELQ D+N    +HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIASHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD +I ++S    ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWEHFTDRIIQVVSEQCPHVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+ N +L++ G   +NW +P
Sbjct: 187 VLKSVHPSPLSAYRGFLGCGHFSRTNSFLEQRGLAPINWALP 228


>gi|58583920|ref|YP_202936.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625708|ref|YP_453080.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188574756|ref|YP_001911685.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|75508049|sp|Q5GUS2|UNG_XANOR RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|123520668|sp|Q2NY21|UNG_XANOM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238691587|sp|B2SJF5|UNG_XANOP RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|58428514|gb|AAW77551.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369648|dbj|BAE70806.1| Uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519208|gb|ACD57153.1| uracil-DNA glycosylase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 241

 Score =  261 bits (666), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF++VKVVI
Sbjct: 8   IQLEPSWKAKVGDWLLCSQMQELSAFLRQRKAVGARVFPPGPQIFAAFDATPFDQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGRVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G + ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCQHFSKTNAHLQRRGISPIDWSLP 229


>gi|325913817|ref|ZP_08176176.1| Uracil-DNA glycosylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325539892|gb|EGD11529.1| Uracil-DNA glycosylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 241

 Score =  261 bits (666), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF +VKVVI
Sbjct: 8   IQLEPSWKAKVGDWLLRPEMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFEQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIPRPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GCRHFSK N +LQ  G   ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCRHFSKTNEHLQRRGLQPIDWSLP 229


>gi|229588970|ref|YP_002871089.1| uracil-DNA glycosylase [Pseudomonas fluorescens SBW25]
 gi|259563561|sp|C3KDS6|UNG_PSEFS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|229360836|emb|CAY47694.1| uracil-DNA glycosylase [Pseudomonas fluorescens SBW25]
          Length = 230

 Score =  260 bits (665), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 158/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP +KVKVVI
Sbjct: 7   IKLEPSWKHALRDQFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDKVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG+L+ W  +GVL+
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNHGYLQSWADQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   A +H G+GW+ FTD +I+++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANANAHAGKGWQFFTDRIIEVVSEHQPHLVFLLWGAHAQGKQKLIDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF GC HFS+ N++L+++G+T +NW +P
Sbjct: 187 VLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGETPINWVLP 228


>gi|226943485|ref|YP_002798558.1| uracil-DNA glycosylase [Azotobacter vinelandii DJ]
 gi|259563554|sp|C1DQR0|UNG_AZOVD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226718412|gb|ACO77583.1| uracil-DNA glycosylase [Azotobacter vinelandii DJ]
          Length = 232

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 160/222 (72%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V++  SWK  L + F+  +M+ L +FL  EK  GK I+P GS  F A D TP ++VKVVI
Sbjct: 8   VRLEASWKEALHDEFEKPYMQELSDFLRREKAAGKEIYPPGSLIFNALDSTPLDQVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+ +PPSL N++KEL+ D+N   P HG L+ W  +GVLL
Sbjct: 68  IGQDPYHGPGQAHGLCFSVQPGVPVPPSLQNIFKELKRDLNIDIPKHGHLQRWAEQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE G A SH G GW++FTD VI+++S   +++VFMLWG+ AQ K+ ++D  +HL
Sbjct: 128 LNTSLTVERGNAGSHAGMGWQRFTDRVIEVVSQRREHVVFMLWGSHAQSKRRLIDSSKHL 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL +AHPSPLSA  GF G  HFS+AN++L++HG T ++W +P
Sbjct: 188 VLCSAHPSPLSAHRGFIGNGHFSRANQFLEQHGLTPIDWHLP 229


>gi|289671389|ref|ZP_06492464.1| uracil-DNA glycosylase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 241

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF+++KVVI
Sbjct: 8   IQLEPSWKAKVGDWLLRPEMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFDQLKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G + ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCQHFSKTNAHLQRRGISPIDWSLP 229


>gi|92114218|ref|YP_574146.1| uracil-DNA glycosylase [Chromohalobacter salexigens DSM 3043]
 gi|91797308|gb|ABE59447.1| Uracil-DNA glycosylase [Chromohalobacter salexigens DSM 3043]
          Length = 229

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 159/219 (72%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +SW+  L   F + +M+ L++FL  EK   K I+P  +H+FRAF++TP ++V+VVILGQD
Sbjct: 7   DSWQHHLGPEFDAPYMQALRDFLAREKAARKVIYPHSAHWFRAFELTPLDQVRVVILGQD 66

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGLCFSV  GI  PPSL N+YKEL +D+   P  HGFLE W  +GVLLLN+V
Sbjct: 67  PYHGPHQAHGLCFSVRPGIPAPPSLQNIYKELAQDLGVTPVPHGFLETWARQGVLLLNSV 126

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A +HRG+GWE FTD  I +++   + +VF+LWG+ AQKK   +D ++HLVL A
Sbjct: 127 LTVEQGNAGAHRGQGWETFTDRAIQVVNEQCEGVVFLLWGSYAQKKAAFVDRQKHLVLHA 186

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFG RHFS+AN +L   G+  ++WQ+P+
Sbjct: 187 PHPSPLSAHRGFFGQRHFSQANAFLSARGRQGIDWQLPM 225


>gi|53715100|ref|YP_101092.1| uracil-DNA glycosylase [Bacteroides fragilis YCH46]
 gi|60683058|ref|YP_213202.1| uracil-DNA glycosylase [Bacteroides fragilis NCTC 9343]
 gi|253566250|ref|ZP_04843704.1| uracil-DNA glycosylase 2 [Bacteroides sp. 3_2_5]
 gi|265766951|ref|ZP_06094780.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_16]
 gi|73920161|sp|Q5L9D9|UNG2_BACFN RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|73920162|sp|Q64PM3|UNG2_BACFR RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|52217965|dbj|BAD50558.1| uracil-DNA glycosylase [Bacteroides fragilis YCH46]
 gi|60494492|emb|CAH09289.1| putative uracil-DNA glycosylase [Bacteroides fragilis NCTC 9343]
 gi|251945354|gb|EES85792.1| uracil-DNA glycosylase 2 [Bacteroides sp. 3_2_5]
 gi|263253328|gb|EEZ24804.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_16]
          Length = 220

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/219 (55%), Positives = 160/219 (73%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ LE  F+ ++ R L EF+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKTHLEPEFEKDYFRTLTEFVRSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ED+    P+ G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVAFPPSLVNIFKEIKEDIGTPAPSTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRVLAEERENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+ HGKT +NW
Sbjct: 182 VLSSAHPSPLSAYNGFFGNKHFSKTNEYLKAHGKTEINW 220


>gi|152995115|ref|YP_001339950.1| uracil-DNA glycosylase [Marinomonas sp. MWYL1]
 gi|150836039|gb|ABR70015.1| uracil-DNA glycosylase [Marinomonas sp. MWYL1]
          Length = 240

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 156/216 (72%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+  L   F+ ++M  L++FL +EK+  K ++P  + YF A ++TPFNKVKVVI+GQDP
Sbjct: 7   DWQEYLAGEFEKDYMLALQKFLYAEKQY-KILYPAEAEYFTALNVTPFNKVKVVIIGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV  G+++PPSLVN+YKEL+ D+   P  HGFL  W  +GVLLLN+VL
Sbjct: 66  YHGEGQAHGLSFSVKPGVKVPPSLVNIYKELEMDLGITPAQHGFLLQWAEQGVLLLNSVL 125

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE  +A SH+ +GWE FTD +I+LI+N HQ +VFMLWG+ AQKK   +D  +H VL++ 
Sbjct: 126 TVEASKAGSHQNKGWEIFTDRIIELINNEHQGVVFMLWGSYAQKKGRHIDRDKHYVLESV 185

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GF GC+HFSKAN YL   GK  + W +
Sbjct: 186 HPSPLSAYRGFLGCQHFSKANDYLVGLGKEPIKWAL 221


>gi|90020865|ref|YP_526692.1| uracil-DNA glycosylase [Saccharophagus degradans 2-40]
 gi|89950465|gb|ABD80480.1| Uracil-DNA glycosylase [Saccharophagus degradans 2-40]
          Length = 218

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 156/210 (74%)

Query: 18  FQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHG 77
           F+  +M  LK FLL EK+ GK I+P G + F A + TPF  VKVVILGQDPYH  GQAHG
Sbjct: 8   FEQPYMAELKAFLLREKKAGKTIYPAGENIFNALNTTPFEHVKVVILGQDPYHGPGQAHG 67

Query: 78  LCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAAS 137
           LCFSV  G+R PPSL+N++KE+  D+ F  P+HG L+ W  +GVLLLNA LTVE+ +A S
Sbjct: 68  LCFSVLPGVRFPPSLLNIFKEIHNDLGFDIPSHGCLQSWAEQGVLLLNATLTVEQAKAGS 127

Query: 138 HRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASH 197
           H+G+GWE FTD+VI  ++N+ + IVF+LWG+ A KK +++D  RH VLK+ HPSPLSA  
Sbjct: 128 HQGKGWETFTDAVIGALNNHREGIVFLLWGSYAHKKGNIIDTTRHHVLKSVHPSPLSAHR 187

Query: 198 GFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           GFFG  HFS+AN++L + G T ++W++P S
Sbjct: 188 GFFGNSHFSQANKFLAQQGLTEIDWRVPPS 217


>gi|301164574|emb|CBW24133.1| putative uracil-DNA glycosylase [Bacteroides fragilis 638R]
          Length = 220

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/219 (55%), Positives = 160/219 (73%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ LE  F+ ++ R L EF+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKTHLEPEFEKDYFRTLTEFVRSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ED+    P+ G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVAFPPSLVNIFKEIKEDIGTPAPSTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRVLAEERENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+ HGKT +NW
Sbjct: 182 VLSSAHPSPLSAYNGFFGNKHFSKTNGYLKAHGKTEINW 220


>gi|77457576|ref|YP_347081.1| uracil-DNA glycosylase [Pseudomonas fluorescens Pf0-1]
 gi|123605621|sp|Q3KGL4|UNG_PSEPF RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|77381579|gb|ABA73092.1| uracil-DNA glycosylase [Pseudomonas fluorescens Pf0-1]
          Length = 231

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 113/222 (50%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M  L+ FL  E+  GK I+P G   F A + TP +KVKVVI
Sbjct: 7   IKLEPSWKEALRAEFDQPYMTELRTFLQQERAAGKEIYPPGPMIFNALNSTPLDKVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG+L+ W  +GVL+
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNHGYLQSWADQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   A +H+ +GW+ FTD +I+++S    ++VFMLWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANANAHKDKGWQFFTDRIIEVVSQKQPHLVFMLWGAHAQSKQKLIDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF GC HFS+ N++L+++G+  + W++P
Sbjct: 187 VLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGEAPIEWRLP 228


>gi|146306413|ref|YP_001186878.1| uracil-DNA glycosylase [Pseudomonas mendocina ymp]
 gi|145574614|gb|ABP84146.1| Uracil-DNA glycosylase [Pseudomonas mendocina ymp]
          Length = 229

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 158/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M+ L+EFL +EK  GK I+P G   F A + TP ++VKVVI
Sbjct: 6   IKLEASWKHALREEFDKPYMKELREFLRAEKAAGKEIYPPGPLIFNALNSTPLDQVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G++ PPSLVN+YKEL+ D+N   P HG+L+ W  +GVLL
Sbjct: 66  IGQDPYHGPGQAHGLCFSVQPGVQTPPSLVNIYKELKRDLNLDIPAHGYLQSWADQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE G A SH  +GW+ FTD VI+++S +   +VF+LWG+ AQ KQ ++D  +HL
Sbjct: 126 LNTSLTVERGNAGSHAAKGWQPFTDRVIEVVSEHQPKVVFLLWGSHAQSKQRLIDPTKHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL++ HPSPLSA  GF G  HFS+ N++L ++G + ++W++P
Sbjct: 186 VLRSPHPSPLSAHRGFIGNGHFSRCNQFLAQNGMSPIDWRLP 227


>gi|330502350|ref|YP_004379219.1| uracil-DNA glycosylase [Pseudomonas mendocina NK-01]
 gi|328916636|gb|AEB57467.1| uracil-DNA glycosylase [Pseudomonas mendocina NK-01]
          Length = 229

 Score =  258 bits (658), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 157/222 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M+ L+EFL +EK  GK I+P G   F A + TP ++VKVVI
Sbjct: 6   IKLEASWKEALREEFDKPYMKELREFLRAEKAAGKEIYPPGPLIFNALNSTPLDQVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G++ PPSLVN+YKEL+ D+N   P HG+L+ W  +GVLL
Sbjct: 66  IGQDPYHGPGQAHGLCFSVQPGVQTPPSLVNIYKELKRDLNIDIPAHGYLQSWADQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   A SH  +GW+ FTD VI+++S +   +VF+LWG+ AQ KQ ++D  +HL
Sbjct: 126 LNTSLTVERANAGSHANKGWQFFTDRVIEVVSEHQPKLVFLLWGSHAQSKQRLIDPTKHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL++ HPSPLSA  GF G  HFS+ N++L ++G T ++WQ+P
Sbjct: 186 VLRSPHPSPLSAHRGFIGNGHFSRCNQFLSQNGMTPIDWQLP 227


>gi|116048665|ref|YP_792535.1| uracil-DNA glycosylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390901|ref|ZP_06880376.1| uracil-DNA glycosylase [Pseudomonas aeruginosa PAb1]
 gi|313105571|ref|ZP_07791837.1| uracil-DNA glycosylase [Pseudomonas aeruginosa 39016]
 gi|122257771|sp|Q02HQ1|UNG_PSEAB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|115583886|gb|ABJ09901.1| uracil-DNA glycosylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310878339|gb|EFQ36933.1| uracil-DNA glycosylase [Pseudomonas aeruginosa 39016]
          Length = 231

 Score =  257 bits (657), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M+ L EFL  EK  GK IFP G   F A + TP   VKVVI
Sbjct: 8   IKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKAIFPPGPLIFNALNTTPLENVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N+YKEL  D+N   P +G+L+ W  +GVLL
Sbjct: 68  IGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE+ +A SH   GW+ FTD VI++++   + +VF+LWG+ AQ KQ ++D +RHL
Sbjct: 128 LNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHL 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +LK+AHPSPLSA  GF G  HFS+ N++L+++GKT ++W +P
Sbjct: 188 ILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLP 229


>gi|285019636|ref|YP_003377347.1| uracil-DNA glycosylase [Xanthomonas albilineans GPE PC73]
 gi|283474854|emb|CBA17353.1| putative uracil-dna glycosylase protein [Xanthomonas albilineans]
          Length = 246

 Score =  257 bits (656), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 151/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      MR L  +L   K  G  +FP G   F AF  TPF+ VKVVI
Sbjct: 10  IQLEPSWKAQVGDWLLRPEMRELAAYLRQRKAAGAHVFPPGRQIFAAFQATPFDAVKVVI 69

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+++D+    P HG L  W   GVLL
Sbjct: 70  LGQDPYHGRGQAHGLCFSVLPGVPVPPSLLNIYKEIEDDLGIRRPDHGCLLPWAQRGVLL 129

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVEEGRA +H+G+GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D +RH 
Sbjct: 130 LNAVLTVEEGRAGAHQGKGWEGFTDHVVETLNREREGLVFLLWGSYAQAKGKVIDTRRHR 189

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GC+HFS AN YL   G   ++W +P
Sbjct: 190 VLKAPHPSPLSAHRGFLGCKHFSAANEYLCRRGSAPIDWSLP 231


>gi|15595947|ref|NP_249441.1| uracil-DNA glycosylase [Pseudomonas aeruginosa PAO1]
 gi|107100210|ref|ZP_01364128.1| hypothetical protein PaerPA_01001233 [Pseudomonas aeruginosa PACS2]
 gi|152989543|ref|YP_001350112.1| uracil-DNA glycosylase [Pseudomonas aeruginosa PA7]
 gi|218893307|ref|YP_002442176.1| uracil-DNA glycosylase [Pseudomonas aeruginosa LESB58]
 gi|254239113|ref|ZP_04932436.1| uracil-DNA glycosylase [Pseudomonas aeruginosa C3719]
 gi|254245005|ref|ZP_04938327.1| uracil-DNA glycosylase [Pseudomonas aeruginosa 2192]
 gi|25009536|sp|Q9I5H9|UNG_PSEAE RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166227475|sp|A6VAM7|UNG_PSEA7 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725945|sp|B7UYZ2|UNG_PSEA8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|9946637|gb|AAG04139.1|AE004510_3 uracil-DNA glycosylase [Pseudomonas aeruginosa PAO1]
 gi|126171044|gb|EAZ56555.1| uracil-DNA glycosylase [Pseudomonas aeruginosa C3719]
 gi|126198383|gb|EAZ62446.1| uracil-DNA glycosylase [Pseudomonas aeruginosa 2192]
 gi|150964701|gb|ABR86726.1| uracil-DNA glycosylase [Pseudomonas aeruginosa PA7]
 gi|218773535|emb|CAW29347.1| uracil-DNA glycosylase [Pseudomonas aeruginosa LESB58]
          Length = 231

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L   F   +M+ L EFL  EK  GK IFP G   F A + TP   VKVVI
Sbjct: 8   IKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVI 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N+YKEL  D+N   P +G+L+ W  +GVLL
Sbjct: 68  IGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE+ +A SH   GW+ FTD VI++++   + +VF+LWG+ AQ KQ ++D +RHL
Sbjct: 128 LNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHL 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +LK+AHPSPLSA  GF G  HFS+ N++L+++GKT ++W +P
Sbjct: 188 ILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLP 229


>gi|21233200|ref|NP_639117.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66770142|ref|YP_244904.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188993349|ref|YP_001905359.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|25009521|sp|Q8P4D7|UNG_XANCP RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|81303906|sp|Q4UPY9|UNG_XANC8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|229557957|sp|B0RWT2|UNG_XANCB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|21115548|gb|AAM43472.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66575474|gb|AAY50884.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167735109|emb|CAP53321.1| uracil-DNA glycosylase [Xanthomonas campestris pv. campestris]
          Length = 241

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ +        M+ L  FL   K    R+FP G   F AFD TPF +VKVV+
Sbjct: 8   IQLEPSWKARVGEWLLQPQMQELSAFLRQRKAANARVFPPGPQIFAAFDATPFEQVKVVV 67

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLL
Sbjct: 68  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNIYKEIQDDLGIPRPDHGYLMPWARQGVLL 127

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 128 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 187

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G + ++W +P
Sbjct: 188 VFKAPHPSPLSAHRGFLGCKHFSKTNEHLQRRGLSPIDWSLP 229


>gi|325928800|ref|ZP_08189967.1| Uracil-DNA glycosylase [Xanthomonas perforans 91-118]
 gi|325540773|gb|EGD12348.1| Uracil-DNA glycosylase [Xanthomonas perforans 91-118]
          Length = 224

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/204 (56%), Positives = 146/204 (71%)

Query: 22  HMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFS 81
            M+ L  FL   K  G R+FP G   F AFD TPF +VKVVILGQDPYH  GQAHGLCFS
Sbjct: 9   QMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFEQVKVVILGQDPYHGEGQAHGLCFS 68

Query: 82  VPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGR 141
           V  G+ +PPSL+N+YKE+Q+D+    P HG+L  W  +GVLLLNAVLTVE+GRA +H+ +
Sbjct: 69  VLPGVPVPPSLLNIYKEIQDDLGIARPDHGYLMPWARQGVLLLNAVLTVEQGRAGAHQNK 128

Query: 142 GWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFG 201
           GWE FTD V+D ++   + +VF+LWG+ AQ K  V+D  RH VLKA HPSPLSA  GF G
Sbjct: 129 GWEGFTDHVVDTLNREREGLVFLLWGSYAQSKGKVIDQARHRVLKAPHPSPLSAHRGFLG 188

Query: 202 CRHFSKANRYLQEHGKTTVNWQIP 225
           CRHFSK N +L+  G + ++W +P
Sbjct: 189 CRHFSKTNDHLRRRGLSPIDWSLP 212


>gi|325924310|ref|ZP_08185854.1| Uracil-DNA glycosylase [Xanthomonas gardneri ATCC 19865]
 gi|325545175|gb|EGD16485.1| Uracil-DNA glycosylase [Xanthomonas gardneri ATCC 19865]
          Length = 247

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      M+ L  FL   K  G R+FP G   F AFD TPF +VKVVI
Sbjct: 14  IQLEPSWKARVGDWLLRPEMQELSAFLRQRKAAGARVFPPGPQIFAAFDATPFEQVKVVI 73

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL+N+ KE+Q+D+    P HG+L  W  +GVLL
Sbjct: 74  LGQDPYHGEGQAHGLCFSVLPGVPVPPSLLNISKEIQDDLGIARPDHGYLMPWASQGVLL 133

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE+GRA +H+ +GWE FTD V++ ++   + +VF+LWG+ AQ K  V+D  RH 
Sbjct: 134 LNAVLTVEQGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKVIDQARHR 193

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V KA HPSPLSA  GF GC+HFSK N +LQ  G   ++W +P
Sbjct: 194 VFKAPHPSPLSAHRGFLGCQHFSKTNDHLQRRGLGPIDWSLP 235


>gi|313159600|gb|EFR58962.1| uracil-DNA glycosylase [Alistipes sp. HGB5]
          Length = 220

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/219 (54%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI   WK LL   F+  +  +L +F+  E    +RI+PRGS+ FRAFD  PF+K+KVVI
Sbjct: 3   VKIAPDWKELLAPEFEKPYFADLTQFVRQEYAT-RRIYPRGSNIFRAFDKCPFDKLKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+  PPSL N++KE+ +D    PP  G L+ W  +GVLL
Sbjct: 62  IGQDPYHGPGQANGLCFSVGDGVPFPPSLQNIFKEVADDTGTPPPATGNLDRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV    AASH GRGWE FTD+V+  IS   Q +V+MLWG+ AQKK  + D +R+ 
Sbjct: 122 LNAVLTVRAHEAASHAGRGWETFTDAVVRAISERKQGVVYMLWGSYAQKKGAIADPQRNF 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LK+ HPSPLS   GFFGCRHFS+AN YL+  GK  + W
Sbjct: 182 ILKSVHPSPLSVYRGFFGCRHFSRANEYLRSIGKEPIVW 220


>gi|330950078|gb|EGH50338.1| uracil-DNA glycosylase [Pseudomonas syringae Cit 7]
          Length = 230

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L + F+  +M  L+EFL  E   GK I+P G   F A + TP N VKVVI
Sbjct: 7   IKLEPSWKNALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLNNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIAPIDWRLP 228


>gi|170720240|ref|YP_001747928.1| uracil-DNA glycosylase [Pseudomonas putida W619]
 gi|229557922|sp|B1J4J3|UNG_PSEPW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|169758243|gb|ACA71559.1| uracil-DNA glycosylase [Pseudomonas putida W619]
          Length = 230

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 149/222 (67%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   WK+ L   F   +M  L+EFL  E   GK I+P G   F A + TP  +VKVVI
Sbjct: 7   IKLEPGWKNALRAEFDQPYMHQLREFLRQEYAAGKEIYPPGPMIFNALNSTPLEQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL  D+N    +HG+L+ W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPTPPSLVNIYKELHRDLNIPIASHGYLQSWAEQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   AASH  +GWE FTD +I ++S    N+VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANAASHAKKGWEFFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLIDGTKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GC HFS+ N +L++ G   +NW +P
Sbjct: 187 VLKSVHPSPLSAYRGFLGCGHFSRTNGFLEQRGLAPINWALP 228


>gi|257486543|ref|ZP_05640584.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289628124|ref|ZP_06461078.1| uracil-DNA glycosylase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649909|ref|ZP_06481252.1| uracil-DNA glycosylase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488660|ref|ZP_07006689.1| Uracil-DNA glycosylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298156733|gb|EFH97824.1| Uracil-DNA glycosylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320325548|gb|EFW81610.1| uracil-DNA glycosylase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320327165|gb|EFW83179.1| uracil-DNA glycosylase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330871260|gb|EGH05969.1| uracil-DNA glycosylase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330889481|gb|EGH22142.1| uracil-DNA glycosylase [Pseudomonas syringae pv. mori str. 301020]
 gi|330989052|gb|EGH87155.1| uracil-DNA glycosylase [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010026|gb|EGH90082.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 230

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 154/223 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP N VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLNNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P+
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIEPIDWRLPV 229


>gi|149277984|ref|ZP_01884123.1| uracil-DNA glycosylase [Pedobacter sp. BAL39]
 gi|149231182|gb|EDM36562.1| uracil-DNA glycosylase [Pedobacter sp. BAL39]
          Length = 225

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + +SW  +L+  F   +M++LK FL+ EK  G++I+PRG+  F A + TPF+KVKVVI
Sbjct: 3   VDLDQSWLQVLKPEFDKAYMKSLKAFLVEEKEDGRQIYPRGTDIFNALNHTPFDKVKVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVL 122
           LGQDPYH  GQAHGL FSV  G+ +PPSL N+YKEL+ D++ F  P HG L  W  +GVL
Sbjct: 63  LGQDPYHGAGQAHGLSFSVQKGVAVPPSLKNIYKELETDIDEFHIPPHGNLTSWADQGVL 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNA LTV   +A SH+G+GWE FTD +I  +S     IVF+LWG  AQ K +++D  +H
Sbjct: 123 LLNATLTVRAQQAGSHQGKGWEIFTDKIISELSAGRTGIVFLLWGKYAQNKSELIDASKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +L A HPSP SA  GF GCRHFSKAN+ L E G   +NWQI
Sbjct: 183 TILMAPHPSPFSAHKGFLGCRHFSKANQKLTEQGLQPINWQI 224


>gi|87118921|ref|ZP_01074820.1| uracil-DNA glycosylase [Marinomonas sp. MED121]
 gi|86166555|gb|EAQ67821.1| uracil-DNA glycosylase [Marinomonas sp. MED121]
          Length = 235

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 158/222 (71%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++   W++ L +   + +M+ L  F+  ++ KG  +FP+    F AF +T F++VKVVI
Sbjct: 1   MQLAAKWQAKLASELDAGYMQKLLSFIAQQRAKGIEVFPQEEECFSAFKLTDFDQVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL+N+YKEL +D+N     HG L+ W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVKPGVKIPPSLMNMYKELNQDLNIPIADHGNLQAWAQQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+V+TVE  +  SH+ +GWE FTD V++L+S  H+ +VFMLWG+ AQKK   +D  +HL
Sbjct: 121 LNSVMTVERSKPNSHQKKGWETFTDKVVELLSQEHEGLVFMLWGSYAQKKGKAIDRDKHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL+A HPSPLS   GFFGC+HFS AN YL++ GKT ++W IP
Sbjct: 181 VLEAVHPSPLSVYRGFFGCQHFSLANHYLKQQGKTEIDWLIP 222


>gi|114778360|ref|ZP_01453207.1| uracil-DNA glycosylase [Mariprofundus ferrooxydans PV-1]
 gi|114551323|gb|EAU53880.1| uracil-DNA glycosylase [Mariprofundus ferrooxydans PV-1]
          Length = 226

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 156/224 (69%), Gaps = 3/224 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M    +  SW   L   F   +M+ L  FL    R+   I P  + ++ AF  TPF +VK
Sbjct: 1   MHQPSVSPSWDPYLAAEFDKPYMQALHSFL---HRQQTVIHPPANQWYAAFRQTPFERVK 57

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSVP G+RIPPSL N+Y+ELQ+D++  P THG L  W  +G
Sbjct: 58  VVILGQDPYHGSGQAHGLSFSVPHGVRIPPSLRNIYRELQQDLDIRPATHGNLLSWAAQG 117

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTV +G  ASH+ +GWEQFTD  +  ++ + +++VFMLWG +AQ K D++D  
Sbjct: 118 VLLLNSTLTVADGSPASHQKQGWEQFTDRALQALNADREHLVFMLWGNAAQAKADMIDAT 177

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RHL+LKA HPSPLSA  GFFGCRHFS+AN +LQ HG++ ++WQ+
Sbjct: 178 RHLILKATHPSPLSAYRGFFGCRHFSQANSWLQTHGRSPIDWQL 221


>gi|312959539|ref|ZP_07774056.1| Uracil-DNA glycosylase [Pseudomonas fluorescens WH6]
 gi|311286256|gb|EFQ64820.1| Uracil-DNA glycosylase [Pseudomonas fluorescens WH6]
          Length = 362

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 155/220 (70%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F   +M  L+EFL  E   GK I+P G   F A + TP +KVKVVI
Sbjct: 7   IKLEPSWKHALRDEFDKPYMSELREFLRQEHAAGKEIYPPGPLIFNALNSTPLDKVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG+L+ W  +GVL+
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNHGYLQSWADQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  +TVE   A +H G+GW+ FTD +I+++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTMTVERANANAHAGKGWQFFTDRIIEVVSAHQPHLVFLLWGAHAQSKQKLIDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           VL + HPSPLSA  GF GC HFS+ N++L+++G+T + W+
Sbjct: 187 VLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGETPIEWR 226


>gi|260072582|gb|ACX30482.1| uracil DNA glycosylase [uncultured SUP05 cluster bacterium]
 gi|269467984|gb|EEZ79712.1| uracil DNA glycosylase [uncultured SUP05 cluster bacterium]
          Length = 222

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 150/222 (67%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M G  + + W   L+  F+ +H R+L EFL  E    K I+P     F AFD++ F   K
Sbjct: 1   MVGWALTKDWSEQLDFIFKQDHYRHLLEFLEYESAHNKTIYPPKDQMFNAFDLSSFKNTK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           V+ILGQDPYHN GQAHGL FSVP GIR+PPSL N+Y+EL  D++  P   G L HW  +G
Sbjct: 61  VIILGQDPYHNEGQAHGLSFSVPDGIRVPPSLRNIYQELSSDLSITPSQSGNLTHWATQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTVE+    SH   GW  FTD+VID+++   QN+VF+LWGA AQKK +++D  
Sbjct: 121 VLLLNSALTVEKNSPGSHAKSGWVDFTDTVIDILNEKKQNLVFLLWGAYAQKKTELIDQD 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HLVL AAHPSP SA  GFFGC+HFSK N YL+ H   T+NW
Sbjct: 181 KHLVLTAAHPSPFSAHKGFFGCKHFSKTNDYLKIHKLKTINW 222


>gi|192360624|ref|YP_001981564.1| uracil-DNA glycosylase [Cellvibrio japonicus Ueda107]
 gi|190686789|gb|ACE84467.1| uracil-DNA glycosylase [Cellvibrio japonicus Ueda107]
          Length = 202

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 148/202 (73%)

Query: 23  MRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSV 82
           M+ L+ FL++EK+ GK I+P   + F AF+ TP + VKVVILGQDPYH   QAHGLCFSV
Sbjct: 1   MQQLRAFLVAEKQMGKVIYPASKNIFNAFNSTPLDNVKVVILGQDPYHGPNQAHGLCFSV 60

Query: 83  PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRG 142
             GI  PPSL+N++KEL+ D+    P HG L+ W ++GVLLLNA LTVE+ RA SH+GRG
Sbjct: 61  QPGIPAPPSLLNMFKELERDLGIPAPNHGCLQSWANQGVLLLNATLTVEQARAGSHQGRG 120

Query: 143 WEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGC 202
           WE+FTD  I L++     +VF+LWG+ AQKK   +D  RHL+LKA HPSPLSA  GF GC
Sbjct: 121 WEEFTDRAIQLVNQQCNQVVFLLWGSYAQKKGAFIDRNRHLILKAPHPSPLSAHRGFIGC 180

Query: 203 RHFSKANRYLQEHGKTTVNWQI 224
            HFS ANRYL +HGK  ++W++
Sbjct: 181 GHFSAANRYLLDHGKAAIDWRL 202


>gi|237798695|ref|ZP_04587156.1| uracil-DNA glycosylase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237806128|ref|ZP_04592832.1| uracil-DNA glycosylase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021548|gb|EGI01605.1| uracil-DNA glycosylase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027241|gb|EGI07296.1| uracil-DNA glycosylase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 230

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVL+
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   +NW++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGLAPINWRLP 228


>gi|332663010|ref|YP_004445798.1| Uracil-DNA glycosylase [Haliscomenobacter hydrossis DSM 1100]
 gi|332331824|gb|AEE48925.1| Uracil-DNA glycosylase [Haliscomenobacter hydrossis DSM 1100]
          Length = 221

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 156/222 (70%), Gaps = 1/222 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  VKI  SWK+ L   F+  + + L +FL  EK  GK IFP G   F AF++TP +KVK
Sbjct: 1   MSEVKIEASWKAALAAEFEKPYFQALIDFLKKEKAAGKVIFPPGPLIFHAFELTPLDKVK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYHN G+A GL FSVP G++IPPSL N+YKEL  D+    P HG L HW  +G
Sbjct: 61  VVILGQDPYHNPGEAMGLSFSVPKGVKIPPSLQNIYKELLSDLQVPIPNHGDLSHWATQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           V LLNA+LTVE+ RA +H+  GW+ FTD+VI  +S   +++VFMLWG  A+KK  ++D  
Sbjct: 121 VFLLNAMLTVEKSRAGAHQNAGWQHFTDAVIRTLSEQREHLVFMLWGNFAKKKAALIDGS 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HL+L+AAHPSPL A   FF C+HFSKAN YL+E+G   VNW
Sbjct: 181 KHLILEAAHPSPL-AGGAFFNCKHFSKANEYLRENGYEEVNW 221


>gi|330981464|gb|EGH79567.1| uracil-DNA glycosylase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 230

 Score =  254 bits (650), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKNALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   V+W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIAPVDWRLP 228


>gi|291515543|emb|CBK64753.1| Uracil-DNA glycosylase [Alistipes shahii WAL 8301]
          Length = 220

 Score =  254 bits (649), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 120/219 (54%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI   WK LL   F+  +   L EF+  E    +RIFPRGS+ FRAFD  PF+++KVV+
Sbjct: 3   VKIAPDWKELLAPEFEKPYFAQLTEFVRQEY-ASRRIFPRGSNIFRAFDKCPFDRLKVVV 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+  PPSL N++KE+ +D     P+ G L+ W  +GVLL
Sbjct: 62  IGQDPYHGPGQANGLCFSVADGVPFPPSLQNIFKEVSDDTGTPIPSTGNLDRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV    AASH GRGWE FTD+V+  I+   + IV+MLWG+ AQKK  + D +R+L
Sbjct: 122 LNAVLTVRAHEAASHAGRGWETFTDAVVRAIAQRKEGIVYMLWGSYAQKKGAIADPQRNL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LKA HPSPLS   GFFGCRHFS+AN YL+  GK  + W
Sbjct: 182 ILKAVHPSPLSVYRGFFGCRHFSRANEYLRSVGKEPIVW 220


>gi|255011245|ref|ZP_05283371.1| uracil-DNA glycosylase [Bacteroides fragilis 3_1_12]
 gi|313149057|ref|ZP_07811250.1| uracil-DNA glycosylase [Bacteroides fragilis 3_1_12]
 gi|313137824|gb|EFR55184.1| uracil-DNA glycosylase [Bacteroides fragilis 3_1_12]
          Length = 220

 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 120/219 (54%), Positives = 158/219 (72%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F+ ++ R L EF+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLQPEFEKDYFRTLTEFVRSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ED+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVAFPPSLVNIFKEIKEDIGTATPPTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+  GWE+FTD+ I +++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRHGWEEFTDAAIRVLAEERENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+ HGKT +NW
Sbjct: 182 VLSSAHPSPLSAYNGFFGNKHFSKTNEYLKTHGKTEINW 220


>gi|312901509|ref|ZP_07760783.1| uracil-DNA glycosylase [Enterococcus faecalis TX0470]
 gi|311291409|gb|EFQ69965.1| uracil-DNA glycosylase [Enterococcus faecalis TX0470]
          Length = 226

 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 159/220 (72%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSLVN+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLVNIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T+++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALESLGETSIDWQLP 223


>gi|66047197|ref|YP_237038.1| uracil-DNA glycosylase [Pseudomonas syringae pv. syringae B728a]
 gi|289674697|ref|ZP_06495587.1| uracil-DNA glycosylase [Pseudomonas syringae pv. syringae FF5]
 gi|302188275|ref|ZP_07264948.1| uracil-DNA glycosylase [Pseudomonas syringae pv. syringae 642]
 gi|81307966|sp|Q4ZPC2|UNG_PSEU2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|63257904|gb|AAY39000.1| Uracil-DNA glycosylase [Pseudomonas syringae pv. syringae B728a]
 gi|330973012|gb|EGH73078.1| uracil-DNA glycosylase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 230

 Score =  254 bits (648), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK+ L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKNALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIAPIDWRLP 228


>gi|254481402|ref|ZP_05094647.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2148]
 gi|214038565|gb|EEB79227.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2148]
          Length = 230

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 153/221 (69%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           ++   W++ L   F   +MR L  F+ SEK  GK +FP    ++ AF  TP ++VKVVI+
Sbjct: 7   QLEPGWRARLAPEFDKAYMRQLATFINSEKELGKTVFPAEDQFYSAFSHTPLDRVKVVIV 66

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGLCFSV  G++ PPSL N+Y+E+  ++    P HG L +W  +GVLLL
Sbjct: 67  GQDPYHGEGQAHGLCFSVKPGVKTPPSLNNIYQEINAELGLPVPAHGCLANWADQGVLLL 126

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N+VL+VE G+AASH G GWE FTD VI++I+++ + +VF+LWG  AQ+K   +D  RH V
Sbjct: 127 NSVLSVECGKAASHEGMGWESFTDKVIEVINDDREAVVFLLWGNYAQRKGASIDTDRHCV 186

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           LKA HPSPLSA  GFFGC HF   N YL++ G++ ++W +P
Sbjct: 187 LKAPHPSPLSAYRGFFGCGHFKATNEYLKQRGRSAIDWSLP 227


>gi|319788355|ref|YP_004147830.1| uracil-DNA glycosylase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466867|gb|ADV28599.1| uracil-DNA glycosylase [Pseudoxanthomonas suwonensis 11-1]
          Length = 246

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 151/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK+ + +      MR L  FL   K  G +++P G   F AFD TPF++VKVVI
Sbjct: 7   IRLEPSWKARIGDWLLRPEMRELSAFLRQRKAAGAQVYPPGPRLFAAFDATPFDQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+ +PPSL N++KE+  ++    P HG L  W   GVLL
Sbjct: 67  LGQDPYHGPGQAHGLCFSVLPGVPVPPSLENIFKEIGTELGLPRPDHGCLLPWARRGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVL+VE+G+A +H+G+GWE FTD  I+ ++   + +VFMLWG+ AQ K  ++D +RH 
Sbjct: 127 LNAVLSVEQGKAGAHQGKGWEGFTDHAIETLAREREGLVFMLWGSYAQAKGRIIDSRRHR 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GFFGC HF+ AN YL   G+  V+W +P
Sbjct: 187 VLKAPHPSPLSAYRGFFGCGHFTAANEYLARRGQAPVDWSLP 228


>gi|257081191|ref|ZP_05575552.1| uracil-DNA glycosylase [Enterococcus faecalis E1Sol]
 gi|256989221|gb|EEU76523.1| uracil-DNA glycosylase [Enterococcus faecalis E1Sol]
          Length = 226

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 158/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+TT++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETTIDWQLP 223


>gi|190576085|ref|YP_001973930.1| uracil-DNA glycosylase [Stenotrophomonas maltophilia K279a]
 gi|190014007|emb|CAQ47647.1| putative uracil-DNA glycosylase [Stenotrophomonas maltophilia
           K279a]
          Length = 237

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK  + ++     MR L  FL   K  G  +FP G   F AFD TPF +VKVVI
Sbjct: 11  IQLEPSWKQHVGDYLLQPQMRELSSFLRQRKASGAAVFPPGPQIFAAFDATPFEQVKVVI 70

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSVP G+ +PPSL+N+YKE++ D+    P HG L  W   GVLL
Sbjct: 71  LGQDPYHGRGQAHGLSFSVPPGVPVPPSLLNIYKEIESDLGIPRPDHGCLIPWAQRGVLL 130

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVEEG+A +H+GRGWE FTD V+D+++   + +VFMLWGA AQ+K  V+D +RH 
Sbjct: 131 LNAVLTVEEGKAGAHQGRGWEGFTDHVVDVLNREREGLVFMLWGAYAQQKGKVIDTRRHR 190

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLKA HPSPLSA  GF GCRHFS AN YLQ  G+  ++W +P
Sbjct: 191 VLKAPHPSPLSAHRGFLGCRHFSMANEYLQRRGQAPIDWSLP 232


>gi|330898486|gb|EGH29905.1| uracil-DNA glycosylase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 230

 Score =  254 bits (648), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIAPIDWRLP 228


>gi|325104702|ref|YP_004274356.1| Uracil-DNA glycosylase [Pedobacter saltans DSM 12145]
 gi|324973550|gb|ADY52534.1| Uracil-DNA glycosylase [Pedobacter saltans DSM 12145]
          Length = 224

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 115/223 (51%), Positives = 159/223 (71%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
            V++  SW  +L+  F+ ++M +LK+FL+SEK++ K IFP  +  F AF++TPF+KVKVV
Sbjct: 2   SVQLESSWLKVLDKEFEKDYMVSLKQFLISEKQQNKVIFPPSTEIFNAFNLTPFDKVKVV 61

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGV 121
           I+GQDPYH YGQAHGL FSV   +R+PPSL N+YKEL+ D+  F  PT G L  W  +GV
Sbjct: 62  IIGQDPYHGYGQAHGLSFSVKDHVRLPPSLQNIYKELETDIEGFKIPTSGNLTKWAKQGV 121

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLNA LTVE  +A SH+ RGWE FTD  I  +S+  Q +VF+LWG  AQ K+ ++D  +
Sbjct: 122 LLLNATLTVEANKAGSHQKRGWETFTDEAIKAVSDYKQGVVFILWGRFAQDKERLIDTSK 181

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           H ++K+AHPSP SA +GFFG + FSK N +L++     ++WQ+
Sbjct: 182 HYIIKSAHPSPFSAYNGFFGSKPFSKTNEFLKKQNLQPIDWQV 224


>gi|255971398|ref|ZP_05421984.1| uracil-DNA glycosylase [Enterococcus faecalis T1]
 gi|255962416|gb|EET94892.1| uracil-DNA glycosylase [Enterococcus faecalis T1]
          Length = 229

 Score =  253 bits (646), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 158/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 8   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSLVN+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 67  QDPYHGPNQAHGLSFSVQPGVKVPPSLVNIYKELQADLGYQPVNHGFLESWAKQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 127 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 187 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 226


>gi|229546793|ref|ZP_04435518.1| uracil-DNA glycosylase [Enterococcus faecalis TX1322]
 gi|229548884|ref|ZP_04437609.1| uracil-DNA glycosylase [Enterococcus faecalis ATCC 29200]
 gi|256854209|ref|ZP_05559573.1| uracil-DNA glycosylase [Enterococcus faecalis T8]
 gi|257086287|ref|ZP_05580648.1| uracil-DNA glycosylase [Enterococcus faecalis D6]
 gi|257421192|ref|ZP_05598182.1| uracil-DNA glycosylase [Enterococcus faecalis X98]
 gi|307275365|ref|ZP_07556508.1| uracil-DNA glycosylase [Enterococcus faecalis TX2134]
 gi|307290964|ref|ZP_07570854.1| uracil-DNA glycosylase [Enterococcus faecalis TX0411]
 gi|312952785|ref|ZP_07771647.1| uracil-DNA glycosylase [Enterococcus faecalis TX0102]
 gi|229305905|gb|EEN71901.1| uracil-DNA glycosylase [Enterococcus faecalis ATCC 29200]
 gi|229308142|gb|EEN74129.1| uracil-DNA glycosylase [Enterococcus faecalis TX1322]
 gi|256709769|gb|EEU24813.1| uracil-DNA glycosylase [Enterococcus faecalis T8]
 gi|256994317|gb|EEU81619.1| uracil-DNA glycosylase [Enterococcus faecalis D6]
 gi|257163016|gb|EEU92976.1| uracil-DNA glycosylase [Enterococcus faecalis X98]
 gi|306498034|gb|EFM67561.1| uracil-DNA glycosylase [Enterococcus faecalis TX0411]
 gi|306507999|gb|EFM77126.1| uracil-DNA glycosylase [Enterococcus faecalis TX2134]
 gi|310629301|gb|EFQ12584.1| uracil-DNA glycosylase [Enterococcus faecalis TX0102]
 gi|315027136|gb|EFT39068.1| uracil-DNA glycosylase [Enterococcus faecalis TX2137]
 gi|315029818|gb|EFT41750.1| uracil-DNA glycosylase [Enterococcus faecalis TX4000]
 gi|315153020|gb|EFT97036.1| uracil-DNA glycosylase [Enterococcus faecalis TX0031]
 gi|315155251|gb|EFT99267.1| uracil-DNA glycosylase [Enterococcus faecalis TX0043]
 gi|315157578|gb|EFU01595.1| uracil-DNA glycosylase [Enterococcus faecalis TX0312]
 gi|315172050|gb|EFU16067.1| uracil-DNA glycosylase [Enterococcus faecalis TX1342]
          Length = 226

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 158/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSLVN+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLVNIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|28871378|ref|NP_793997.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971138|ref|ZP_03399257.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato T1]
 gi|301381846|ref|ZP_07230264.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato Max13]
 gi|302059015|ref|ZP_07250556.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato K40]
 gi|302132814|ref|ZP_07258804.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|32171728|sp|Q87XE2|UNG_PSESM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|28854629|gb|AAO57692.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213924127|gb|EEB57703.1| uracil-DNA glycosylase [Pseudomonas syringae pv. tomato T1]
 gi|330877454|gb|EGH11603.1| uracil-DNA glycosylase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330964539|gb|EGH64799.1| uracil-DNA glycosylase [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331015584|gb|EGH95640.1| uracil-DNA glycosylase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 230

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 153/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVL+
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQGKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGLAPIDWRLP 228


>gi|71736036|ref|YP_276102.1| uracil-DNA glycosylase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|123635334|sp|Q48ET5|UNG_PSE14 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|71556589|gb|AAZ35800.1| uracil-DNA glycosylase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 230

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 153/223 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   WK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP N VKVVI
Sbjct: 7   IKLEPIWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLNNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P+
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIEPIDWRLPV 229


>gi|256964223|ref|ZP_05568394.1| uracil-DNA glycosylase [Enterococcus faecalis HIP11704]
 gi|307271957|ref|ZP_07553225.1| uracil-DNA glycosylase [Enterococcus faecalis TX0855]
 gi|256954719|gb|EEU71351.1| uracil-DNA glycosylase [Enterococcus faecalis HIP11704]
 gi|306511463|gb|EFM80465.1| uracil-DNA glycosylase [Enterococcus faecalis TX0855]
          Length = 226

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 158/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T+++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETSIDWQLP 223


>gi|255531459|ref|YP_003091831.1| uracil-DNA glycosylase [Pedobacter heparinus DSM 2366]
 gi|255344443|gb|ACU03769.1| uracil-DNA glycosylase [Pedobacter heparinus DSM 2366]
          Length = 225

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 154/222 (69%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I ESW  +L++ F+  +M++LK FLL EK+KG +++P+G+  F A + TPF+KVKVVI
Sbjct: 3   VAIEESWLKVLKDEFEKPYMKSLKAFLLEEKQKGYKVYPKGADIFNALNHTPFDKVKVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH  GQAHGL FSV  GI +PPSL N+YKEL  D+  F  P HG L  W  EGVL
Sbjct: 63  LGQDPYHGTGQAHGLSFSVQKGITVPPSLKNIYKELSADIPGFSIPNHGNLTQWADEGVL 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNA LTV    A SH+G+GWE FTD +I  +S     +VF+LWG  AQ K  ++D K+H
Sbjct: 123 LLNATLTVRAHEAGSHQGKGWEIFTDKIISELSEKRTGLVFLLWGRYAQNKAVLIDQKKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            ++ AAHPSP SA +GF   + FS+AN  L E G++ +NWQI
Sbjct: 183 TIIAAAHPSPFSAYNGFLDSKPFSRANAKLIEQGQSPINWQI 224


>gi|149374724|ref|ZP_01892498.1| uracil-DNA glycosylase [Marinobacter algicola DG893]
 gi|149361427|gb|EDM49877.1| uracil-DNA glycosylase [Marinobacter algicola DG893]
          Length = 246

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 154/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K +  W   L N F   +M+ L +FL  E++ GK +FP   H F A + TP +KV+VVI
Sbjct: 11  LKPNRGWTEHLGNEFSQPYMQQLADFLAKEEQAGKTLFPASHHCFNALNSTPLDKVRVVI 70

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV   +  PPSLVN++KE+  D+   PP HG L+ W  +GVLL
Sbjct: 71  LGQDPYHGPGQAHGLCFSVRPHVATPPSLVNIFKEIHADLGIQPPDHGCLQPWAEQGVLL 130

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTV + +A +H+G+GWE FTD VI+ I+   + +VF+LWG+ A+KK   +D  +HL
Sbjct: 131 LNSVLTVVQSQAGAHQGKGWETFTDRVIETINREREGVVFLLWGSYAKKKGQHIDRSKHL 190

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL   HPSPLSA  GFFGC+HFS+AN +LQ+ G  TV+W +P
Sbjct: 191 VLDGPHPSPLSAYRGFFGCKHFSRANEWLQQKGLPTVDWSLP 232


>gi|261416843|ref|YP_003250526.1| uracil-DNA glycosylase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373299|gb|ACX76044.1| uracil-DNA glycosylase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326670|gb|ADL25871.1| uracil-DNA glycosylase [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 225

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 152/222 (68%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VK+ ESW  LL + F+  + + +K  LL E  +   ++P G   F A D  P +KVK VI
Sbjct: 3   VKLEESWLKLLADQFEQPYFKQIKAKLLQEHAEHHVVYPPGPQIFAALDYCPVDKVKAVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYHN GQAHGLCFSVP GI  PPSL+N+++EL +D+   PP HG LE W H+G+LL
Sbjct: 63  IGQDPYHNPGQAHGLCFSVPFGIEPPPSLINIFQELHDDLGITPPPHGNLEGWAHQGILL 122

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR-H 182
           LNA LTV    AASH G GW+QFTD++I  +S   +N+VF+LWG+ A KKQ ++   R H
Sbjct: 123 LNASLTVRAHMAASHAGIGWQQFTDTIIQRLSQVRENLVFLLWGSFAIKKQVLIAPNRGH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L+L A HPSPLSA  GFFGC+HFSKAN YL   G   ++W I
Sbjct: 183 LILTAPHPSPLSAYRGFFGCKHFSKANAYLVSKGLEPIDWSI 224


>gi|312904508|ref|ZP_07763667.1| uracil-DNA glycosylase [Enterococcus faecalis TX0635]
 gi|310632206|gb|EFQ15489.1| uracil-DNA glycosylase [Enterococcus faecalis TX0635]
          Length = 226

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGKAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|194367442|ref|YP_002030052.1| uracil-DNA glycosylase [Stenotrophomonas maltophilia R551-3]
 gi|194350246|gb|ACF53369.1| uracil-DNA glycosylase [Stenotrophomonas maltophilia R551-3]
          Length = 237

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 155/222 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SWK  + ++     MR L  FL   K  G  +FP G   F AFD TPF + KVVI
Sbjct: 11  IQLEPSWKQHVGDYLLQPQMRELSSFLRQRKASGAAVFPPGPQIFAAFDATPFEQAKVVI 70

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSVP G+ +PPSL+N+YKE++ D++   P HG L  W   GVLL
Sbjct: 71  LGQDPYHGRGQAHGLSFSVPPGVPVPPSLLNIYKEIESDLSIPRPDHGCLIPWAQRGVLL 130

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVEEG+A +H+GRGWE FTD V+D+++   + +VFMLWGA AQ+K  V+D +RH 
Sbjct: 131 LNAVLTVEEGKAGAHQGRGWEGFTDHVVDVLNREREGLVFMLWGAYAQQKGKVIDTRRHR 190

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VLK+ HPSPLSA  GF GCRHFS AN YLQ  G+  ++W +P
Sbjct: 191 VLKSPHPSPLSAHRGFLGCRHFSMANEYLQRRGQAPIDWSLP 232


>gi|255974016|ref|ZP_05424602.1| uracil-DNA glycosylase [Enterococcus faecalis T2]
 gi|255966888|gb|EET97510.1| uracil-DNA glycosylase [Enterococcus faecalis T2]
          Length = 229

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 8   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 67  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 127 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 187 KSPHPSPLSAHRGFFGSRPFSQANAALESLGETPIDWQLP 226


>gi|307278357|ref|ZP_07559432.1| uracil-DNA glycosylase [Enterococcus faecalis TX0860]
 gi|306504863|gb|EFM74058.1| uracil-DNA glycosylase [Enterococcus faecalis TX0860]
          Length = 226

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALESLGETPIDWQLP 223


>gi|256761702|ref|ZP_05502282.1| uracil-DNA glycosylase [Enterococcus faecalis T3]
 gi|256682953|gb|EEU22648.1| uracil-DNA glycosylase [Enterococcus faecalis T3]
          Length = 229

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 8   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 67  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 127 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 187 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 226


>gi|167754495|ref|ZP_02426622.1| hypothetical protein ALIPUT_02791 [Alistipes putredinis DSM 17216]
 gi|167659120|gb|EDS03250.1| hypothetical protein ALIPUT_02791 [Alistipes putredinis DSM 17216]
          Length = 220

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI   WK +L   F+  + R L +F+  E    +RIFPRGS+ FRAFD  PF+K+KVVI
Sbjct: 3   VKIASDWKEILSEEFEKPYFRELTDFVRQEY-ASRRIFPRGSNIFRAFDKCPFDKLKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+  PPSL N+++E+ +D     PT G L+ W  +GVLL
Sbjct: 62  IGQDPYHGEGQANGLCFSVADGVPFPPSLQNIFQEVADDTGSPIPTSGNLDRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV    AASH G GWE FTD+V+  I+   Q IV+MLWG+ AQ+K  + D +R+ 
Sbjct: 122 LNAVLTVRAHEAASHAGHGWETFTDAVVRAIAQRKQGIVYMLWGSYAQRKGAIADPQRNC 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LKA HPSPLSA  GFFG +HFS+AN YLQ  GK  + W
Sbjct: 182 ILKAVHPSPLSAYRGFFGSKHFSRANEYLQSIGKAPILW 220


>gi|295113866|emb|CBL32503.1| Uracil-DNA glycosylase [Enterococcus sp. 7L76]
          Length = 226

 Score =  251 bits (641), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTILSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|227517868|ref|ZP_03947917.1| uracil-DNA glycosylase [Enterococcus faecalis TX0104]
 gi|256617817|ref|ZP_05474663.1| uracil-DNA glycosylase [Enterococcus faecalis ATCC 4200]
 gi|256957196|ref|ZP_05561367.1| uracil-DNA glycosylase [Enterococcus faecalis DS5]
 gi|257077832|ref|ZP_05572193.1| uracil-DNA glycosylase [Enterococcus faecalis JH1]
 gi|257089358|ref|ZP_05583719.1| uracil-DNA glycosylase [Enterococcus faecalis CH188]
 gi|257415510|ref|ZP_05592504.1| uracil-DNA glycosylase [Enterococcus faecalis AR01/DG]
 gi|294780535|ref|ZP_06745898.1| uracil-DNA glycosylase [Enterococcus faecalis PC1.1]
 gi|300859773|ref|ZP_07105861.1| uracil-DNA glycosylase [Enterococcus faecalis TUSoD Ef11]
 gi|307268023|ref|ZP_07549411.1| uracil-DNA glycosylase [Enterococcus faecalis TX4248]
 gi|307286756|ref|ZP_07566842.1| uracil-DNA glycosylase [Enterococcus faecalis TX0109]
 gi|227074683|gb|EEI12646.1| uracil-DNA glycosylase [Enterococcus faecalis TX0104]
 gi|256597344|gb|EEU16520.1| uracil-DNA glycosylase [Enterococcus faecalis ATCC 4200]
 gi|256947692|gb|EEU64324.1| uracil-DNA glycosylase [Enterococcus faecalis DS5]
 gi|256985862|gb|EEU73164.1| uracil-DNA glycosylase [Enterococcus faecalis JH1]
 gi|256998170|gb|EEU84690.1| uracil-DNA glycosylase [Enterococcus faecalis CH188]
 gi|257157338|gb|EEU87298.1| uracil-DNA glycosylase [Enterococcus faecalis ARO1/DG]
 gi|294452362|gb|EFG20801.1| uracil-DNA glycosylase [Enterococcus faecalis PC1.1]
 gi|300850591|gb|EFK78340.1| uracil-DNA glycosylase [Enterococcus faecalis TUSoD Ef11]
 gi|306502234|gb|EFM71518.1| uracil-DNA glycosylase [Enterococcus faecalis TX0109]
 gi|306515664|gb|EFM84191.1| uracil-DNA glycosylase [Enterococcus faecalis TX4248]
 gi|315032422|gb|EFT44354.1| uracil-DNA glycosylase [Enterococcus faecalis TX0017]
 gi|315034343|gb|EFT46275.1| uracil-DNA glycosylase [Enterococcus faecalis TX0027]
 gi|315144327|gb|EFT88343.1| uracil-DNA glycosylase [Enterococcus faecalis TX2141]
 gi|315148105|gb|EFT92121.1| uracil-DNA glycosylase [Enterococcus faecalis TX4244]
 gi|315162993|gb|EFU07010.1| uracil-DNA glycosylase [Enterococcus faecalis TX0645]
 gi|315165192|gb|EFU09209.1| uracil-DNA glycosylase [Enterococcus faecalis TX1302]
 gi|315173412|gb|EFU17429.1| uracil-DNA glycosylase [Enterococcus faecalis TX1346]
 gi|315577270|gb|EFU89461.1| uracil-DNA glycosylase [Enterococcus faecalis TX0630]
 gi|323480128|gb|ADX79567.1| uracil-DNA glycosylase [Enterococcus faecalis 62]
 gi|327534528|gb|AEA93362.1| uracil-DNA glycosylase [Enterococcus faecalis OG1RF]
 gi|329574101|gb|EGG55678.1| uracil-DNA glycosylase [Enterococcus faecalis TX1467]
          Length = 226

 Score =  251 bits (641), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|254448984|ref|ZP_05062438.1| uracil-DNA glycosylase [gamma proteobacterium HTCC5015]
 gi|198261378|gb|EDY85669.1| uracil-DNA glycosylase [gamma proteobacterium HTCC5015]
          Length = 224

 Score =  251 bits (641), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 114/224 (50%), Positives = 156/224 (69%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  +K+  SW   L   F+ ++M+ L++FL++EK   K I+P   H F AF+ TPF  VK
Sbjct: 1   MSQIKMIGSWLDQLSAEFEKDYMQQLRDFLIAEKAAKKVIYPHSDHTFAAFNETPFESVK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGLCFSV  G+++PPSL N+YKE+ +++       G L  W  +G
Sbjct: 61  VVILGQDPYHGPGQAHGLCFSVQSGVKLPPSLRNIYKEIHQELGLEMSGSGDLRPWAKQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           V LLN  L+VE+G+A SH+GRGWE+FTD+ I  ++   + +VFMLWG+ AQKK   +D +
Sbjct: 121 VFLLNTSLSVEQGKAGSHQGRGWERFTDTAIQRLNEQREQLVFMLWGSHAQKKGAFIDTQ 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H VLKA HPSPLSA  GFFGC HF++AN YL+  G+T ++W +
Sbjct: 181 KHCVLKAPHPSPLSAHRGFFGCGHFARANDYLKSTGQTPIDWTV 224


>gi|209695969|ref|YP_002263899.1| uracil-DNA glycosylase [Aliivibrio salmonicida LFI1238]
 gi|254790566|sp|B6EKY3|UNG_ALISL RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|208009922|emb|CAQ80235.1| uracil-DNA glycosylase (UDG) [Aliivibrio salmonicida LFI1238]
          Length = 224

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 117/218 (53%), Positives = 152/218 (69%), Gaps = 1/218 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++ SW  +LE   +  + + +  ++   + +GK+IFP+    F AF +TPFN V VVILG
Sbjct: 1   MNTSWNDILETEKEKPYYQEMMTYINEARSQGKKIFPKEEDVFTAFSLTPFNNVTVVILG 60

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLL 124
           QDPYH  GQAHGL FSV  G++IPPSL N+YKEL ED+  FIPPTHG+LE W  +GVLLL
Sbjct: 61  QDPYHGEGQAHGLSFSVLPGVKIPPSLRNMYKELAEDIEGFIPPTHGYLESWAEQGVLLL 120

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVEE +A SH   GWE FTDS+I+ ++   + I+F+LWGA AQKK   +D  +H +
Sbjct: 121 NTVLTVEESQAHSHAKLGWETFTDSIIEQLNEKKEGIIFLLWGAHAQKKGINIDAMKHSI 180

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           L A HPSPLSA  GFFGC+HFSK N  L+E   + +NW
Sbjct: 181 LVAPHPSPLSARRGFFGCQHFSKTNELLREKNLSEINW 218


>gi|153808760|ref|ZP_01961428.1| hypothetical protein BACCAC_03059 [Bacteroides caccae ATCC 43185]
 gi|149128586|gb|EDM19804.1| hypothetical protein BACCAC_03059 [Bacteroides caccae ATCC 43185]
          Length = 220

 Score =  251 bits (640), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 158/219 (72%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F  ++ R L EF+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKTHLQPEFDKDYFRTLTEFVRSEYSQ-YQIFPPGRLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G++ PPSLVN++KE++ D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVQFPPSLVNIFKEIKADIGTDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++ + +++VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALAESKEHLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HG+T +NW
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKAHGETEINW 220


>gi|330937676|gb|EGH41578.1| uracil-DNA glycosylase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 230

 Score =  251 bits (640), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E    K I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAACKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GF G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKGFLGNGHFGRANKYLEQNGIAPIDWRLP 228


>gi|256960074|ref|ZP_05564245.1| uracil-DNA glycosylase [Enterococcus faecalis Merz96]
 gi|257083859|ref|ZP_05578220.1| uracil-DNA glycosylase [Enterococcus faecalis Fly1]
 gi|293383827|ref|ZP_06629734.1| uracil-DNA glycosylase [Enterococcus faecalis R712]
 gi|293388698|ref|ZP_06633191.1| uracil-DNA glycosylase [Enterococcus faecalis S613]
 gi|312906958|ref|ZP_07765954.1| uracil-DNA glycosylase [Enterococcus faecalis DAPTO 512]
 gi|312978786|ref|ZP_07790513.1| uracil-DNA glycosylase [Enterococcus faecalis DAPTO 516]
 gi|256950570|gb|EEU67202.1| uracil-DNA glycosylase [Enterococcus faecalis Merz96]
 gi|256991889|gb|EEU79191.1| uracil-DNA glycosylase [Enterococcus faecalis Fly1]
 gi|291078903|gb|EFE16267.1| uracil-DNA glycosylase [Enterococcus faecalis R712]
 gi|291081855|gb|EFE18818.1| uracil-DNA glycosylase [Enterococcus faecalis S613]
 gi|310626943|gb|EFQ10226.1| uracil-DNA glycosylase [Enterococcus faecalis DAPTO 512]
 gi|311288493|gb|EFQ67049.1| uracil-DNA glycosylase [Enterococcus faecalis DAPTO 516]
          Length = 226

 Score =  251 bits (640), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNAREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|312886768|ref|ZP_07746375.1| Uracil-DNA glycosylase [Mucilaginibacter paludis DSM 18603]
 gi|311300870|gb|EFQ77932.1| Uracil-DNA glycosylase [Mucilaginibacter paludis DSM 18603]
          Length = 225

 Score =  251 bits (640), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 151/222 (68%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++  SW ++L++ F+ ++M  LK FL  EK  G+ ++PRG   F AF  TPF  +KVVI
Sbjct: 3   IELEPSWLNILKSEFEQDYMLKLKNFLKEEKNTGQVVYPRGKDIFNAFWTTPFTNLKVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH   QAHGL FSV  G+ +PPSL N+YKELQ D+  FI PTHG L  W  +GVL
Sbjct: 63  LGQDPYHGANQAHGLSFSVQKGVPLPPSLQNIYKELQTDIPGFIMPTHGDLTEWAEQGVL 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNA LTV    A SH+  GWE FTD VI  IS   + +VF+LWG  AQ K  ++D K+H
Sbjct: 123 LLNATLTVRANSAGSHQKSGWEIFTDKVISQISEQKEGVVFLLWGKFAQAKAVLIDEKKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +LKAAHPSP SA +GFFGC HFSK N  L + GK  ++WQI
Sbjct: 183 HILKAAHPSPFSAYNGFFGCHHFSKTNAILTKEGKQPIDWQI 224


>gi|29375532|ref|NP_814686.1| uracil-DNA glycosylase [Enterococcus faecalis V583]
 gi|227555059|ref|ZP_03985106.1| uracil-DNA glycosylase [Enterococcus faecalis HH22]
 gi|45593580|sp|Q836Z5|UNG_ENTFA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|29342992|gb|AAO80756.1| uracil-DNA glycosylase [Enterococcus faecalis V583]
 gi|227175800|gb|EEI56772.1| uracil-DNA glycosylase [Enterococcus faecalis HH22]
 gi|315167916|gb|EFU11933.1| uracil-DNA glycosylase [Enterococcus faecalis TX1341]
 gi|315574139|gb|EFU86330.1| uracil-DNA glycosylase [Enterococcus faecalis TX0309B]
 gi|315581718|gb|EFU93909.1| uracil-DNA glycosylase [Enterococcus faecalis TX0309A]
          Length = 226

 Score =  250 bits (639), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQNILSAEFEKPYYQELREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|330957826|gb|EGH58086.1| uracil-DNA glycosylase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 230

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 152/222 (68%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+  SWK  L + F+  +M  L+EFL  E   GK I+P G   F A + TP + VKVVI
Sbjct: 7   IKLEPSWKEALRDEFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLDNVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  G+  PPSLVN+YKEL+ D+N   P HG L+ W  +GVLL
Sbjct: 67  LGQDPYHGPNQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPNHGCLQSWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE   AASH G+GW+ FTD +I ++S +  ++VF+LWGA AQ KQ ++D  +HL
Sbjct: 127 LNTTLTVERANAASHAGKGWQHFTDRIIQVVSEHQPHLVFLLWGAHAQSKQKLVDATKHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA   F G  HF +AN+YL+++G   ++W++P
Sbjct: 187 VLTSVHPSPLSAYKVFLGNGHFGRANKYLEQNGIEPIDWRLP 228


>gi|257418542|ref|ZP_05595536.1| uracil-DNA glycosylase [Enterococcus faecalis T11]
 gi|257160370|gb|EEU90330.1| uracil-DNA glycosylase [Enterococcus faecalis T11]
          Length = 226

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E +  + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQNILSAEFEKPYYQVLREFLKKEYQT-QTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFFG R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFGSRPFSQANAALERLGETPIDWQLP 223


>gi|293373860|ref|ZP_06620202.1| uracil-DNA glycosylase [Bacteroides ovatus SD CMC 3f]
 gi|299147899|ref|ZP_07040962.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_23]
 gi|292631081|gb|EFF49717.1| uracil-DNA glycosylase [Bacteroides ovatus SD CMC 3f]
 gi|298514082|gb|EFI37968.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_23]
          Length = 220

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ LE  F+ ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLEPEFEKDYFRTLTDFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGTDAPATGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALAEEKENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HGKT + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKTHGKTEIAW 220


>gi|297539602|ref|YP_003675371.1| uracil-DNA glycosylase [Methylotenera sp. 301]
 gi|297258949|gb|ADI30794.1| uracil-DNA glycosylase [Methylotenera sp. 301]
          Length = 227

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 155/220 (70%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           ++H SW++++   F   +M++L+ FL  EK  GK IFP     F AF+ TPF+KV+VVI+
Sbjct: 8   QLHPSWQAVIGEEFDKPYMQSLRAFLKQEKEAGKAIFPPSPLIFNAFNHTPFDKVRVVII 67

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSVP G+ +PPSL+N+YKE++ D+       G L  W ++GVLLL
Sbjct: 68  GQDPYHGIGQAHGLSFSVPEGVALPPSLMNIYKEIEADLGIKMSRKGDLTSWANQGVLLL 127

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NA LTV    A SH+ RGWE FTD+ I  ++   + +VF+LWG+ AQKK +++D+K+HLV
Sbjct: 128 NATLTVAMANAGSHQKRGWETFTDAAIAALNTQREGLVFVLWGSYAQKKGEMIDYKKHLV 187

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK+ HPSPLSA  GFFG   FSK N YL +HG+T + WQI
Sbjct: 188 LKSTHPSPLSAHRGFFGNHQFSKINEYLIKHGQTPIEWQI 227


>gi|255691394|ref|ZP_05415069.1| uracil-DNA glycosylase [Bacteroides finegoldii DSM 17565]
 gi|260623040|gb|EEX45911.1| uracil-DNA glycosylase [Bacteroides finegoldii DSM 17565]
          Length = 220

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L   F  ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKVHLAPEFDKDYFRTLTDFVRSEYSQ-YQIFPPGRLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADLGTDAPVTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++ N +NIVF+LWG+ AQKK   +D  RHL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWEVFTDAAIRTLAENRENIVFILWGSYAQKKGAFIDRNRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+AN YL+ HGKT + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRANDYLKAHGKTEIIW 220


>gi|237714799|ref|ZP_04545280.1| uracil-DNA glycosylase [Bacteroides sp. D1]
 gi|262406926|ref|ZP_06083475.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_22]
 gi|294644127|ref|ZP_06721903.1| uracil-DNA glycosylase [Bacteroides ovatus SD CC 2a]
 gi|294805677|ref|ZP_06764557.1| uracil-DNA glycosylase [Bacteroides xylanisolvens SD CC 1b]
 gi|229445124|gb|EEO50915.1| uracil-DNA glycosylase [Bacteroides sp. D1]
 gi|262355629|gb|EEZ04720.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_22]
 gi|292640546|gb|EFF58788.1| uracil-DNA glycosylase [Bacteroides ovatus SD CC 2a]
 gi|294447093|gb|EFG15680.1| uracil-DNA glycosylase [Bacteroides xylanisolvens SD CC 1b]
          Length = 220

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F  ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLKPEFDKDYFRTLTDFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D++   PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADISSDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALAEEKENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HGKT + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKTHGKTEIAW 220


>gi|237720023|ref|ZP_04550504.1| uracil-DNA glycosylase [Bacteroides sp. 2_2_4]
 gi|229450575|gb|EEO56366.1| uracil-DNA glycosylase [Bacteroides sp. 2_2_4]
 gi|295084782|emb|CBK66305.1| Uracil-DNA glycosylase [Bacteroides xylanisolvens XB1A]
          Length = 220

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F  ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLKPEFDKDYFRTLTDFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGSDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALTEEKENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HGKT + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKTHGKTEIAW 220


>gi|160885226|ref|ZP_02066229.1| hypothetical protein BACOVA_03224 [Bacteroides ovatus ATCC 8483]
 gi|298479830|ref|ZP_06998030.1| uracil-DNA glycosylase [Bacteroides sp. D22]
 gi|156109576|gb|EDO11321.1| hypothetical protein BACOVA_03224 [Bacteroides ovatus ATCC 8483]
 gi|298274220|gb|EFI15781.1| uracil-DNA glycosylase [Bacteroides sp. D22]
          Length = 220

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F  ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLKPEFDKDYFRTLTDFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGSDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALAEEKENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HGKT + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKTHGKTEIAW 220


>gi|268678651|ref|YP_003303082.1| uracil-DNA glycosylase [Sulfurospirillum deleyianum DSM 6946]
 gi|268616682|gb|ACZ11047.1| uracil-DNA glycosylase [Sulfurospirillum deleyianum DSM 6946]
          Length = 224

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/220 (54%), Positives = 155/220 (70%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI ESWK +L + FQ  +   LK FL+ EK K   I+P G++ F AF+ TPF +VKVVIL
Sbjct: 5   KIEESWKKVLFDEFQKPYFEALKTFLMEEK-KHHTIYPSGANIFAAFNHTPFERVKVVIL 63

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  G+  PPSL N++KEL++D+    P +G L  W  +GV L+
Sbjct: 64  GQDPYHGAGQAHGLSFSVQEGVPHPPSLQNIFKELRDDIGCDIPKNGTLTSWADQGVFLI 123

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV    A SH+GRGWE FTD+VI  +S+  +++VF+LWGA A  K  ++D K+HL+
Sbjct: 124 NAVLTVRSSEANSHKGRGWETFTDTVIKTLSDEKEHVVFILWGAPAGAKASLIDSKKHLI 183

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LKA HPSPLS+  GFFG + FSK+N YL EHGKT + W +
Sbjct: 184 LKAPHPSPLSSYRGFFGSKPFSKSNAYLIEHGKTPIKWAL 223


>gi|260174134|ref|ZP_05760546.1| uracil-DNA glycosylase [Bacteroides sp. D2]
 gi|315922399|ref|ZP_07918639.1| uracil-DNA glycosylase [Bacteroides sp. D2]
 gi|313696274|gb|EFS33109.1| uracil-DNA glycosylase [Bacteroides sp. D2]
          Length = 220

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ LE  F+ ++ R L +F+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLEPEFEKDYFRTLTDFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGTDAPATGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +N+VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRALAEEKENLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YL+ HG+T + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRTNDYLKAHGETEIAW 220


>gi|212691168|ref|ZP_03299296.1| hypothetical protein BACDOR_00658 [Bacteroides dorei DSM 17855]
 gi|212666400|gb|EEB26972.1| hypothetical protein BACDOR_00658 [Bacteroides dorei DSM 17855]
          Length = 220

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L   F+ ++   L EF+ SE +    I+P G   F AF++ PFNKVKVVI
Sbjct: 3   VQIEESWKQHLAPEFEKDYFIKLTEFVRSEYQT-TTIYPPGRFIFNAFNLCPFNKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+Q D+    PT G L  W ++GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIQSDLGAPIPTSGNLTRWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +NIVF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRILAEQRENIVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YLQ HG+T + W
Sbjct: 182 VLASAHPSPLSAYNGFFGNKHFSRTNEYLQAHGQTPIEW 220


>gi|260072587|gb|ACX30486.1| uracil DNA glycosylase [uncultured SUP05 cluster bacterium]
          Length = 222

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 149/222 (67%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M G  + + W   L+  F+  + R+L EFL  E    K I+P     F AF+++ F   K
Sbjct: 1   MVGWALTKDWSEQLDFIFKQGYYRHLLEFLEYESTHNKTIYPPKDQIFTAFNLSSFKNTK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           V+ILGQDPYHN GQAHGL FSVP G+R+PPSL N+Y+EL  D++  P   G L HW  +G
Sbjct: 61  VIILGQDPYHNEGQAHGLSFSVPDGVRVPPSLRNIYQELSSDLSITPSQSGNLTHWATQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTVE+    SH   GW  FTD+VID+++   QN+VF+LWGA AQKK +++D  
Sbjct: 121 VLLLNSALTVEKNLPGSHAKSGWVDFTDTVIDILNEKKQNLVFLLWGAYAQKKTELIDQD 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HLVL AAHPSP SA  GFFGC+HFSK N YL+ H   T+NW
Sbjct: 181 KHLVLTAAHPSPFSAHKGFFGCKHFSKTNDYLKIHKLKTINW 222


>gi|253996120|ref|YP_003048184.1| uracil-DNA glycosylase [Methylotenera mobilis JLW8]
 gi|253982799|gb|ACT47657.1| uracil-DNA glycosylase [Methylotenera mobilis JLW8]
          Length = 227

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 156/220 (70%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           ++H SW++++       +M++L+ FLL EK  GK IFP     F AF+ TPF+KV+VVI+
Sbjct: 8   QLHPSWQAVIGGELDKPYMQSLRAFLLQEKAAGKTIFPPSPLIFNAFNHTPFDKVRVVII 67

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSVP GI +PPSL+N++KE++ D+       G L  W ++GVLLL
Sbjct: 68  GQDPYHGAGQAHGLSFSVPDGIALPPSLLNIFKEIESDLGIKVRGKGDLTAWANQGVLLL 127

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NA LTVE G A SH+ RGWE FTD+ I  ++   + +VF+LWG+ AQKK +V+D K+HLV
Sbjct: 128 NATLTVEMGNAGSHQKRGWETFTDAAIAALNLRREGLVFVLWGSYAQKKGEVIDPKKHLV 187

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK+ HPSPLSA  GFFG   FS+ N YLQ+ G+  ++WQI
Sbjct: 188 LKSVHPSPLSAHRGFFGNHQFSRINEYLQKRGEAPIDWQI 227


>gi|315149585|gb|EFT93601.1| uracil-DNA glycosylase [Enterococcus faecalis TX0012]
          Length = 226

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 156/220 (70%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+++L   F+  + + L+EFL  E  + + I+P   H F A ++TPF +VKVVILG
Sbjct: 5   IHNSWQTVLSAEFEKPYYQELREFLKKE-YQTQTIYPDMYHLFSALELTPFEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ + P  HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVKVPPSLANIYKELQADLGYQPVNHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQ TD +I+ ++   + +VF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVRAGQAYSHRGKGWEQLTDVIIEKLNEREKPVVFILWGRPAQEKIKMIDTTRHVII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSPLSA  GFF  R FS+AN  L+  G+T ++WQ+P
Sbjct: 184 KSPHPSPLSAHRGFFCSRPFSQANAALERLGETPIDWQLP 223


>gi|126667157|ref|ZP_01738131.1| uracil-DNA glycosylase [Marinobacter sp. ELB17]
 gi|126628313|gb|EAZ98936.1| uracil-DNA glycosylase [Marinobacter sp. ELB17]
          Length = 235

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 152/216 (70%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W   L   F+  +M +L +FL +E+  GK I+P     F A + TP  +VKVVILGQDPY
Sbjct: 17  WSERLTEEFRQPYMVSLVQFLAAEEAAGKNIYPPARQVFNALNSTPLEQVKVVILGQDPY 76

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H   QAHGL FSV  G R PPSLVN++KE++ D+   P  HG L+ W  +GVLLLN+VLT
Sbjct: 77  HGPCQAHGLSFSVLPGTRTPPSLVNMFKEIRSDLGIEPSAHGCLQAWADQGVLLLNSVLT 136

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           VE+GRA++H+  GWE+FT+SVI  ++   Q +VFMLWG+ A KK   +DH++HLVL+A H
Sbjct: 137 VEQGRASAHQSMGWEEFTNSVIAAVNEQDQGVVFMLWGSYAHKKGRGIDHQKHLVLEAPH 196

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           PSPLSA  GFFGC+HFS+AN++L E G   ++W +P
Sbjct: 197 PSPLSAYRGFFGCQHFSRANQWLGERGLGAIDWALP 232


>gi|83644618|ref|YP_433053.1| uracil-DNA glycosylase [Hahella chejuensis KCTC 2396]
 gi|83632661|gb|ABC28628.1| uracil-DNA glycosylase [Hahella chejuensis KCTC 2396]
          Length = 253

 Score =  247 bits (631), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 153/216 (70%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           WK  L+  F   +M  L++FL ++  +GK I+P   + F A + TPF  V VVILGQDPY
Sbjct: 18  WKDALKEEFSKPYMVQLEQFLGAQDGQGKVIYPSLDNCFNALNSTPFENVSVVILGQDPY 77

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H  GQAHGL FSV  GI  PPSLVN++KE+  ++    P HG L +W  +GVLLLN+VLT
Sbjct: 78  HGPGQAHGLSFSVLPGIAPPPSLVNIFKEINNELGLGVPEHGCLAYWAQQGVLLLNSVLT 137

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           VE+ +AASH+G+GWEQFTD VI LI++  +N+VF+LWG+ AQ+K   +D +RH VL++ H
Sbjct: 138 VEQSKAASHQGKGWEQFTDRVIQLINSERENVVFLLWGSYAQRKGAFIDRQRHCVLESVH 197

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           PSPLSA  GF GC HF+ AN YL+ H K  ++W++P
Sbjct: 198 PSPLSAHRGFMGCGHFASANDYLRAHQKKPIDWRLP 233


>gi|326796644|ref|YP_004314464.1| uracil-DNA glycosylase [Marinomonas mediterranea MMB-1]
 gi|326547408|gb|ADZ92628.1| Uracil-DNA glycosylase [Marinomonas mediterranea MMB-1]
          Length = 224

 Score =  247 bits (631), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 153/219 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +   W   L    + ++M +L +FL SE +KGK I+P     + A + T F+ VKVVI
Sbjct: 2   LNLTSDWLEKLAPEIEKDYMLSLTDFLDSESQKGKVIYPEAEERYTALNCTSFDNVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV  GI++PPSLVN+YKEL+ D+      HG+LE W ++GVLL
Sbjct: 62  LGQDPYHGPDQAHGLSFSVKPGIKVPPSLVNIYKELESDLGIPVAQHGYLESWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVE  +A +H+ +GWE FTD ++ L++   + IVF+LWG+ AQKK  ++D  +HL
Sbjct: 122 LNSVLTVEASKAGAHQKKGWETFTDRIVTLLNGEREGIVFLLWGSYAQKKGKMIDRSKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL++ HPSPLSA  GFFGCRHFS+ N YL++ G+  ++W
Sbjct: 182 VLESVHPSPLSAYRGFFGCRHFSETNTYLKQTGQAPIDW 220


>gi|160889293|ref|ZP_02070296.1| hypothetical protein BACUNI_01716 [Bacteroides uniformis ATCC 8492]
 gi|270295922|ref|ZP_06202122.1| uracil-DNA glycosylase [Bacteroides sp. D20]
 gi|317479638|ref|ZP_07938763.1| uracil-DNA glycosylase [Bacteroides sp. 4_1_36]
 gi|156861300|gb|EDO54731.1| hypothetical protein BACUNI_01716 [Bacteroides uniformis ATCC 8492]
 gi|270273326|gb|EFA19188.1| uracil-DNA glycosylase [Bacteroides sp. D20]
 gi|316904203|gb|EFV26032.1| uracil-DNA glycosylase [Bacteroides sp. 4_1_36]
          Length = 220

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/219 (52%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F+ ++ R L +F+  E  K   I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLQPEFEKDYFRTLTDFVRDEYGK-YAIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL+N++KE++ D+    PT G L  W  +G+LL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLLNIFKEIKNDIGTDAPTTGNLTRWAEQGILL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I +++   +++VF+LWGA AQ+K   +D  RHL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRILAEEKEHLVFILWGAYAQRKGAFIDRSRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+EHG+T + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSKTNEYLREHGETEIIW 220


>gi|327479779|gb|AEA83089.1| uracil-DNA glycosylase [Pseudomonas stutzeri DSM 4166]
          Length = 231

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/222 (50%), Positives = 148/222 (66%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++   WK  L   F   +M  L  FL  EK  GK I+P G   F A + TP  +VKVVI
Sbjct: 7   IRLEAGWKDALREEFDKPYMVELGAFLRREKAAGKTIYPPGPMIFNALNSTPLEQVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL N++KEL+ D+N   P HG+L+ W  +GVL+
Sbjct: 67  LGQDPYHGPGQAHGLCFSVQPGVAPPPSLQNIFKELKRDLNLDIPQHGYLQRWAEQGVLM 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE G A SH   GW+QFTD +I+++     ++VFMLWGA AQ K  ++D  RHL
Sbjct: 127 LNTSLTVERGLAGSHAKAGWQQFTDRIIEVVGERRPHLVFMLWGAHAQSKAKLIDATRHL 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +LK+ HPSPLSA  GF G  HFS+AN++L++ G   ++WQ+P
Sbjct: 187 MLKSVHPSPLSAHRGFIGNGHFSRANQFLRQQGMQPIDWQLP 228


>gi|237712382|ref|ZP_04542863.1| uracil-DNA glycosylase [Bacteroides sp. 9_1_42FAA]
 gi|237726570|ref|ZP_04557051.1| uracil-DNA glycosylase [Bacteroides sp. D4]
 gi|265752091|ref|ZP_06087884.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_33FAA]
 gi|229435096|gb|EEO45173.1| uracil-DNA glycosylase [Bacteroides dorei 5_1_36/D4]
 gi|229453703|gb|EEO59424.1| uracil-DNA glycosylase [Bacteroides sp. 9_1_42FAA]
 gi|263236883|gb|EEZ22353.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_33FAA]
          Length = 220

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L   F+ ++   L EF+ SE +    I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKQHLAPEFEKDYFIKLTEFVRSEYQT-TTIYPPGRFIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+Q D+    PT G L  W ++GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIQSDLGAPIPTSGNLTRWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +NIVF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRILAEQRENIVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YLQ HG+T + W
Sbjct: 182 VLASAHPSPLSAYNGFFGNKHFSRTNEYLQAHGQTPIEW 220


>gi|150006627|ref|YP_001301371.1| uracil-DNA glycosylase [Bacteroides vulgatus ATCC 8482]
 gi|254881471|ref|ZP_05254181.1| uracil-DNA glycosylase [Bacteroides sp. 4_3_47FAA]
 gi|294775748|ref|ZP_06741251.1| uracil-DNA glycosylase [Bacteroides vulgatus PC510]
 gi|319642856|ref|ZP_07997493.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_40A]
 gi|166201510|sp|A6L7T5|UNG_BACV8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|149935051|gb|ABR41749.1| uracil-DNA glycosylase [Bacteroides vulgatus ATCC 8482]
 gi|254834264|gb|EET14573.1| uracil-DNA glycosylase [Bacteroides sp. 4_3_47FAA]
 gi|294450409|gb|EFG18906.1| uracil-DNA glycosylase [Bacteroides vulgatus PC510]
 gi|317385531|gb|EFV66473.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_40A]
          Length = 220

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L   F+ ++   L EF+ SE +    I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKQHLAPEFEKDYFIRLTEFVRSEYQTAT-IYPPGRFIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+Q D+    PT G L  W ++GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIQSDLGAPIPTSGNLTRWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +NIVF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRVLAEQRENIVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+ N YLQ HG+T + W
Sbjct: 182 VLASAHPSPLSAYNGFFGNKHFSRTNEYLQAHGQTPIEW 220


>gi|237752987|ref|ZP_04583467.1| uracil-DNA glycosylase [Helicobacter winghamensis ATCC BAA-430]
 gi|229375254|gb|EEO25345.1| uracil-DNA glycosylase [Helicobacter winghamensis ATCC BAA-430]
          Length = 228

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI ESWK  LE  F S +   +K+  +  K KG  I+P  +  F AF+ TPF KVK
Sbjct: 4   LDSIKIEESWKKALEKEFLSPYFLEIKKHYVEAKSKGAVIYPPANLTFNAFNSTPFEKVK 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VV+LGQDPYHN  +A GL FSVP G+RIPPSL N+Y+EL+ D+       G L  W  EG
Sbjct: 64  VVLLGQDPYHNPNEAMGLSFSVPQGVRIPPSLRNIYRELEADLGIPQSKSGDLSAWAREG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  + ASH+  GW+QFTDSVI  +S     IVF+LWG  A+ K+ ++D K
Sbjct: 124 VLLLNSILSVEAHKPASHQHFGWQQFTDSVIATLSKQKDGIVFLLWGNYAKSKKTLIDTK 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RH VL+AAHPSPL+ S GF GC+HFSK N YLQ  GKT +NW +
Sbjct: 184 RHCVLEAAHPSPLARS-GFMGCKHFSKTNTYLQSIGKTPINWNL 226


>gi|110638972|ref|YP_679181.1| uracil-DNA glycosylase [Cytophaga hutchinsonii ATCC 33406]
 gi|110281653|gb|ABG59839.1| Uracil-DNA glycosylase [Cytophaga hutchinsonii ATCC 33406]
          Length = 222

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 158/221 (71%), Gaps = 1/221 (0%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           E +KI  SWK  +++ F   + +NL +F+  E+ K + I+P G + F+AFD  PF+ V+V
Sbjct: 3   EDIKIETSWKHRIQDEFNKTYFKNLIQFV-KEQYKTRVIYPAGKNIFKAFDACPFDAVEV 61

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           VI+GQDPYH  GQA+GLCFSV  GI  PPSL N++KE++ D+    P  G LE W ++GV
Sbjct: 62  VIIGQDPYHGPGQANGLCFSVNDGIVQPPSLKNIFKEIESDLGKSAPVSGNLERWANQGV 121

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLNA LTVE     SH+ +GWE FTD+VI  +S+  +++VF+LWGA AQKK +++D ++
Sbjct: 122 LLLNATLTVEANTPGSHQKKGWETFTDAVIKKVSDEKEHVVFILWGAYAQKKGEIIDREK 181

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           HLVLK+AHPSP SA +GFFG +HFSK N YL+  GK  ++W
Sbjct: 182 HLVLKSAHPSPFSAYNGFFGNKHFSKTNAYLKSVGKKEIDW 222


>gi|157165679|ref|YP_001465952.1| uracil-DNA glycosylase [Campylobacter concisus 13826]
 gi|166201511|sp|A7ZAZ4|UNG_CAMC1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|112801734|gb|EAT99078.1| uracil-DNA glycosylase [Campylobacter concisus 13826]
          Length = 230

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/224 (53%), Positives = 151/224 (67%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  VKI  SWK +L++ F SE+   +KE  L  K  G  ++P     F AF++TPF+ VK
Sbjct: 5   LNDVKIEPSWKEVLKDEFLSENFARIKENFLKAKSAG-VVYPPSGLIFNAFNLTPFHDVK 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA GL FSVP G+R+PPSLVN+YKE+  D+    P  G L  W  +G
Sbjct: 64  VVILGQDPYHGANQAMGLSFSVPSGVRVPPSLVNIYKEIYADLGIKEPNSGDLTKWAKQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ L+V  G A SH   GW+ FTD+VI  IS N QN+VFMLWG  A+ K  ++D  
Sbjct: 124 VLLLNSTLSVSAGAANSHASFGWQGFTDAVIRKISENLQNVVFMLWGNPAKAKAPLIDAS 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+L+AAHPSPL A   FFGCRHFSKAN YL +HGKT + W +
Sbjct: 184 KHLILEAAHPSPL-ARGAFFGCRHFSKANIYLAKHGKTPIEWDL 226


>gi|150010287|ref|YP_001305030.1| uracil-DNA glycosylase [Parabacteroides distasonis ATCC 8503]
 gi|255012447|ref|ZP_05284573.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_7]
 gi|256839118|ref|ZP_05544628.1| uracil-DNA glycosylase [Parabacteroides sp. D13]
 gi|262382430|ref|ZP_06075567.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_33B]
 gi|298374666|ref|ZP_06984624.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_19]
 gi|149938711|gb|ABR45408.1| uracil-DNA glycosylase [Parabacteroides distasonis ATCC 8503]
 gi|256740037|gb|EEU53361.1| uracil-DNA glycosylase [Parabacteroides sp. D13]
 gi|262295308|gb|EEY83239.1| uracil-DNA glycosylase [Bacteroides sp. 2_1_33B]
 gi|298269034|gb|EFI10689.1| uracil-DNA glycosylase [Bacteroides sp. 3_1_19]
          Length = 220

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK  L + F+ ++ + L +F+  E R+G  ++P G + F AF+  PF+KVKVVI
Sbjct: 3   VKIEESWKKRLADEFEKDYFKQLTDFVKQEYRQGT-VYPPGPYMFNAFEHCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL+N++KE+Q+D+    PT G L  W  +GVLL
Sbjct: 62  LGQDPYHEPGQAHGLCFSVQDGVPFPPSLINIFKEIQDDLGHPVPTTGNLIRWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+VI  ++    +IV++LWG+ AQKK   +D  R+L
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAVIHRLAAERSHIVYILWGSYAQKKGAFIDSSRNL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+AHPSPLSA  GFFG +HFSKAN YL   G+T + W
Sbjct: 182 VLKSAHPSPLSAYRGFFGNKHFSKANDYLIATGQTPIEW 220


>gi|260775351|ref|ZP_05884248.1| uracil-DNA glycosylase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608532|gb|EEX34697.1| uracil-DNA glycosylase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 228

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/218 (53%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ ++    Q ++ +    F+ SE+  GK IFP     F AF  T FN VKVVILGQDP
Sbjct: 6   TWQDVIGAEKQQDYFQQTLNFVESERASGKAIFPPAKDVFNAFRATEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D++ F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPRQAHGLCFSVLPGIKTPPSLVNMYKELAQDIDGFQIPAHGYLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ ++ +   +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDKVIEAVNQHQSGVVFLLWGSHAQKKGRFIDRNKHHVLAA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            HPSPLSA  GFFGCRHFS+AN+ L   GK T++W +P
Sbjct: 186 PHPSPLSAHRGFFGCRHFSQANQILNAQGKPTIDWHLP 223


>gi|29347540|ref|NP_811043.1| uracil-DNA glycosylase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570884|ref|ZP_04848292.1| uracil-DNA glycosylase [Bacteroides sp. 1_1_6]
 gi|298383763|ref|ZP_06993324.1| uracil-DNA glycosylase [Bacteroides sp. 1_1_14]
 gi|32171741|sp|Q8A5V6|UNG_BACTN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|29339440|gb|AAO77237.1| uracil-DNA glycosylase [Bacteroides thetaiotaomicron VPI-5482]
 gi|251839833|gb|EES67916.1| uracil-DNA glycosylase [Bacteroides sp. 1_1_6]
 gi|298263367|gb|EFI06230.1| uracil-DNA glycosylase [Bacteroides sp. 1_1_14]
          Length = 220

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 157/219 (71%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F+ ++ R L EF+ SE  +  +IFP G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKTHLQPEFEKDYFRTLTEFVKSEYSQ-YQIFPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGTDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +++VF+LWGA AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWEAFTDAAIRALAEEREHLVFILWGAYAQRKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+AN YL+ +G+T + W
Sbjct: 182 VLSSAHPSPLSAYNGFFGNKHFSRANDYLKANGETEIIW 220


>gi|255323648|ref|ZP_05364778.1| uracil-DNA glycosylase [Campylobacter showae RM3277]
 gi|255299362|gb|EET78649.1| uracil-DNA glycosylase [Campylobacter showae RM3277]
          Length = 228

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 116/224 (51%), Positives = 154/224 (68%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ ++I   WK  L+  F SE+   +KE  L  K  G+ ++P  +  F AF++TPFN VK
Sbjct: 3   IDKIQIEAGWKEALKEEFLSENFARVKENFLRAKAAGE-VYPPNALIFNAFNLTPFNAVK 61

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL F+VP G++IPPSL N+YKE+++D+    P  G L +W  +G
Sbjct: 62  VVILGQDPYHGPGQAMGLSFAVPHGVKIPPSLANIYKEIRDDLGITEPNSGDLSYWAKQG 121

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V  G+A SH   GW++FTD+ I  +S+  QN+VFMLWG  A+ K  ++D  
Sbjct: 122 VLLLNATLSVSAGQANSHSNFGWQEFTDAAIRKLSDCAQNVVFMLWGNPAKAKIPLIDAN 181

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL A   FFGCRHFSKAN YL EHGK  ++W +
Sbjct: 182 KHLVLTAAHPSPL-ARGAFFGCRHFSKANLYLAEHGKAPIDWDL 224


>gi|88703564|ref|ZP_01101280.1| Uracil-DNA glycosylase [Congregibacter litoralis KT71]
 gi|88702278|gb|EAQ99381.1| Uracil-DNA glycosylase [Congregibacter litoralis KT71]
          Length = 226

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 150/224 (66%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M    + ++W+ LL +   +++M  L +F+ + +  G  +FP     F AF  TP   ++
Sbjct: 1   MPDYTVPDAWRDLLRSELDADYMLGLSDFIAARRDSGAAVFPPREQVFNAFVHTPPEDLR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSV  G+ +PPSL N+++EL+ED+    P HG LE W  +G
Sbjct: 61  VVILGQDPYHQPGQAHGLSFSVNRGVPVPPSLRNIFRELEEDLGISAPRHGCLEAWAKQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTVEEG   SHRG+GWE FTD+VI L++   + +VF LWG+ AQ+K   +D +
Sbjct: 121 VLLLNTVLTVEEGNPGSHRGKGWELFTDAVIALLAKRSEPLVFFLWGSQAQRKAGFIDGQ 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H VLKA HPSPLSA  GFFGC HF KAN +L+  G+  +NW I
Sbjct: 181 KHCVLKAPHPSPLSAYRGFFGCGHFGKANAFLRARGREPINWSI 224


>gi|197335957|ref|YP_002156913.1| uracil-DNA glycosylase [Vibrio fischeri MJ11]
 gi|254790593|sp|B5FAJ7|UNG_VIBFM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|197317447|gb|ACH66894.1| uracil-DNA glycosylase [Vibrio fischeri MJ11]
          Length = 224

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 152/215 (70%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W S++       + +++ E + +++  GK IFP+  H F AFD+TPFN VKVVILGQDP
Sbjct: 4   TWNSIISAEKNKAYYQSMSEKIDAQRSLGKSIFPKEDHIFTAFDLTPFNDVKVVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G++IPPSL N+YKEL ED+  F  P HG+L+ W  +GVLLLN V
Sbjct: 64  YHGEGQAHGLSFSVLPGVKIPPSLRNMYKELAEDIPGFTIPEHGYLKTWAEQGVLLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVEE +A SH   GWE FTD++I  I+++ + ++F+LWGA AQKK   +D  RH +L+A
Sbjct: 124 LTVEEAKAHSHAKFGWETFTDAIIKKINDDMEGVIFLLWGAHAQKKGANIDTSRHFILQA 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC+HFS+ N  L++   + +NW
Sbjct: 184 PHPSPLSAHRGFFGCKHFSQTNELLRQQNLSEINW 218


>gi|189463947|ref|ZP_03012732.1| hypothetical protein BACINT_00282 [Bacteroides intestinalis DSM
           17393]
 gi|189438520|gb|EDV07505.1| hypothetical protein BACINT_00282 [Bacteroides intestinalis DSM
           17393]
          Length = 220

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ LE  F+ ++ R L  F+  E  +   I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKARLEPEFEKDYFRTLTNFVREEYSQ-YPIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+R PPSL+N++KE+++D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVRFPPSLINIFKEIKDDIGTDAPNTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I +++   +++VF+LWG+ AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRVLAEQREHLVFILWGSYAQRKGAFIDRSKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+AN YL+EHG+  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRANAYLKEHGEQEIAW 220


>gi|148244777|ref|YP_001219471.1| uracil-DNA glycosylase [Candidatus Vesicomyosocius okutanii HA]
 gi|146326604|dbj|BAF61747.1| uracil-DNA glycosylase [Candidatus Vesicomyosocius okutanii HA]
          Length = 224

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 155/216 (71%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   ++   +++ + NLK FL+ +++  K I P  +++F+AF++T F+KVKVVILGQD
Sbjct: 9   QNWHPSIKTLLKTQSIINLKLFLIRQRKAKKVILPNSNNWFKAFELTAFDKVKVVILGQD 68

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH  GQAHGL FSV  G++ PPSL N++KEL  D+N  P  +  L  W  +GVLLLN+V
Sbjct: 69  PYHGLGQAHGLSFSVVHGVKKPPSLNNIFKELHNDLNIEPKQNSNLTRWAIQGVLLLNSV 128

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +AASH  +GWE FTDSVI  +S   Q++VFMLWGA A++K  ++D  +HL+L +
Sbjct: 129 LTVEVNKAASHSNQGWEVFTDSVIRTLSKEQQHLVFMLWGAHAKRKSILIDRNKHLILTS 188

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFSKAN YL+ H +  +NWQ
Sbjct: 189 THPSPLSAHRGFLGCRHFSKANNYLKIHNQQVINWQ 224


>gi|27364002|ref|NP_759530.1| uracil-DNA glycosylase [Vibrio vulnificus CMCP6]
 gi|320157383|ref|YP_004189762.1| uracil-DNA glycosylase family 1 [Vibrio vulnificus MO6-24/O]
 gi|31077041|sp|Q8DEP7|UNG_VIBVU RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|45477225|sp|Q7MNR0|UNG_VIBVY RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|27360119|gb|AAO09057.1| uracil-DNA glycosylase [Vibrio vulnificus CMCP6]
 gi|319932695|gb|ADV87559.1| uracil-DNA glycosylase family 1 [Vibrio vulnificus MO6-24/O]
          Length = 226

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + +    F+ +E++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGAEKEQSYFQQTLNFVEAERQAGKVIYPPAKDVFNAFRYTEFQDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIQGFQIPAHGYLEAWAKQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + Q +VF+LWG+ AQKK   +D  +H+VL A
Sbjct: 126 LTVEQGKAHSHASLGWETFTDKVIEAINQHQQGVVFLLWGSHAQKKGRFIDRHKHVVLTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC+HFS+AN++L + GK  ++WQ+PLS
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQHLLDQGKQAIDWQLPLS 225


>gi|288575920|ref|ZP_05977860.2| uracil-DNA glycosylase [Neisseria mucosa ATCC 25996]
 gi|288566777|gb|EFC88337.1| uracil-DNA glycosylase [Neisseria mucosa ATCC 25996]
          Length = 230

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/218 (53%), Positives = 153/218 (70%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   + +     + +++ E +  E+  G+ I+P     F AF  T F  VKVVILGQD
Sbjct: 13  QTWHEAIGSEKSEPYFQHIIETVKKERGMGRIIYPPAEDVFNAFRATEFGNVKVVILGQD 72

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GI +PPSLVN+YKEL +D+  F  P HG+L+HW  +GVLLLN 
Sbjct: 73  PYHGAGQAHGLAFSVREGIAVPPSLVNIYKELADDIEGFHIPQHGYLQHWAEQGVLLLNT 132

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD V++ I+ N +++VFMLWG+ AQKK   +D  RHLVL+
Sbjct: 133 VLTVRAGQAHSHATLGWERFTDEVVNQINQNREHVVFMLWGSHAQKKGAFIDRSRHLVLR 192

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YLQE+G T ++WQ+
Sbjct: 193 APHPSPLSAYRGFFGCKHFSRANAYLQENGITPIDWQV 230


>gi|317056359|ref|YP_004104826.1| uracil-DNA glycosylase [Ruminococcus albus 7]
 gi|315448628|gb|ADU22192.1| uracil-DNA glycosylase [Ruminococcus albus 7]
          Length = 226

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 153/221 (69%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I  SW ++L   F+S++   L+EFL  E  + + I+P     F A   T +  VKVVI
Sbjct: 2   VNIGNSWDNILAEEFKSDYYLQLREFLKREYAQ-QTIYPNMYDIFNALKYTAYEDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  GI  PPSL N++KELQ DV F  P +G L  W  +GVLL
Sbjct: 61  IGQDPYHGEGQAHGLCFSVKRGIMPPPSLQNIFKELQNDVGFRMPDNGELTDWTKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV  G+A SHRG GWE+ TD+VI  ++   + IVFMLWG +A++KQ ++ +K HL
Sbjct: 121 LNAVLTVRAGQANSHRGMGWEKLTDAVISKLNEREKPIVFMLWGRNAKEKQKLITNKNHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL AAHPSPLSA +GFFGCRHFS+AN +L + G+  ++W I
Sbjct: 181 VLTAAHPSPLSAYNGFFGCRHFSRANEFLTQTGQEPIDWSI 221


>gi|50085443|ref|YP_046953.1| uracil-DNA glycosylase [Acinetobacter sp. ADP1]
 gi|73920164|sp|Q6F9Y2|UNG_ACIAD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|49531419|emb|CAG69131.1| uracil-DNA glycosylase [Acinetobacter sp. ADP1]
          Length = 237

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 116/225 (51%), Positives = 156/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M  L++FL+ +K + K I+P     F A + TP + VK
Sbjct: 11  LSKVQLDESWKHSLAEFLVSSRMDELRQFLIEQKNQDKVIYPPSKQIFNALNTTPLSAVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  GI +PPSL N++ EL  D+    P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQKGIVLPPSLRNIFHELNTDLGIPVPKHGDLTKWADQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ RGWEQFTDS+ID+++   +++VF+LWGA AQ+K   +D +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKRGWEQFTDSIIDVLNEQREHVVFILWGAYAQRKGQRIDRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVLKAAHPSPL+A+  GFFGC+ FSK N YL++HG   ++WQ+
Sbjct: 191 KHLVLKAAHPSPLAANRGGFFGCKVFSKTNNYLKQHGIEPIDWQL 235


>gi|119476434|ref|ZP_01616785.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2143]
 gi|119450298|gb|EAW31533.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2143]
          Length = 236

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 153/221 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +  SW  +L   FQ  +M++L+ FL  E    K I P    +F AF+ TPF+KVKVVI
Sbjct: 15  LTLAPSWFKVLSEEFQQPYMQSLQAFLECELDDKKIILPPPELWFNAFNSTPFDKVKVVI 74

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV   + IPPSL N++KEL  ++     +HG L+ W  +GVL+
Sbjct: 75  LGQDPYHGSDQAHGLCFSVRPEMPIPPSLRNIFKELHRELGAPKASHGCLQRWADQGVLM 134

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA+LTVE+G+A SH+G+GWEQFTD VI  +S   + +VF+LWG+ AQKK  ++D K+H 
Sbjct: 135 LNAILTVEKGQAGSHQGKGWEQFTDRVIQQLSEEKKGVVFLLWGSYAQKKGRLIDEKKHW 194

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VLK +HPSPLSA  GF GC HF++AN YL+  G T V+W +
Sbjct: 195 VLKTSHPSPLSAHRGFLGCDHFTQANDYLRRQGNTAVDWSL 235


>gi|301308371|ref|ZP_07214325.1| uracil-DNA glycosylase [Bacteroides sp. 20_3]
 gi|300833841|gb|EFK64457.1| uracil-DNA glycosylase [Bacteroides sp. 20_3]
          Length = 223

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK  L + F+ ++ + L +F+  E R+G  ++P G + F AF+  PF+KVKVVI
Sbjct: 3   VKIEESWKKRLADEFEKDYFKQLTDFVKQEYRQGT-VYPPGPYMFNAFEHCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL+N++KE+Q+D+    PT G L  W  +GVLL
Sbjct: 62  LGQDPYHEPGQAHGLCFSVQDGVPFPPSLINIFKEIQDDLGHPVPTTGNLIRWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+VI  ++    +IV++LWG+ AQ+K   +D  R+L
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAVIHRLAAERSHIVYILWGSYAQRKGAFIDSSRNL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+AHPSPLSA  GFFG +HFSKAN YL   G+T + W
Sbjct: 182 VLKSAHPSPLSAYRGFFGNKHFSKANDYLIATGQTPIKW 220


>gi|37678839|ref|NP_933448.1| uracil-DNA glycosylase [Vibrio vulnificus YJ016]
 gi|37197580|dbj|BAC93419.1| uracil DNA glycosylase [Vibrio vulnificus YJ016]
          Length = 234

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + +    F+ +E++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 14  TWHDVIGAEKEQSYFQQTLNFVEAERQAGKVIYPPAKDVFNAFRYTEFQDVKVVILGQDP 73

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HG+LE W  +GVLLLN V
Sbjct: 74  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIQGFQIPAHGYLEAWAKQGVLLLNTV 133

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + Q +VF+LWG+ AQKK   +D  +H+VL A
Sbjct: 134 LTVEQGKAHSHASLGWETFTDKVIEAINQHQQGVVFLLWGSHAQKKGRFIDRHKHVVLTA 193

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC+HFS+AN++L + GK  ++WQ+PLS
Sbjct: 194 PHPSPLSAHRGFLGCKHFSQANQHLLDQGKQAIDWQLPLS 233


>gi|223038342|ref|ZP_03608636.1| uracil-DNA glycosylase [Campylobacter rectus RM3267]
 gi|222880199|gb|EEF15286.1| uracil-DNA glycosylase [Campylobacter rectus RM3267]
          Length = 228

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 153/224 (68%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ ++I   WK  L+  F SE+   +KE  L  K  G+ ++P  +  F AF++TPF+ VK
Sbjct: 3   IDKIQIEAGWKEALKEEFLSENFARVKENFLRAKAAGE-VYPPNALIFNAFNLTPFSAVK 61

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP G++IPPSL N+YKE+++D+    P  G L +W  +G
Sbjct: 62  VVILGQDPYHGAGQAMGLSFSVPRGVKIPPSLANIYKEIRDDLGIAEPNSGDLSYWARQG 121

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V  G+A SH   GW++FTD+ I  +S   +N+VFMLWG  A+ K  ++D  
Sbjct: 122 VLLLNATLSVSAGQANSHSNFGWQEFTDAAIRRLSECAENVVFMLWGNPAKAKIPLIDAN 181

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL A   FFGCRHFSKAN YL EHGK  ++W +
Sbjct: 182 KHLVLTAAHPSPL-ARGAFFGCRHFSKANLYLAEHGKAPIDWDL 224


>gi|154174163|ref|YP_001407363.1| uracil-DNA glycosylase [Campylobacter curvus 525.92]
 gi|166201512|sp|A7GVX1|UNG_CAMC5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|112802439|gb|EAT99783.1| uracil-DNA glycosylase [Campylobacter curvus 525.92]
          Length = 231

 Score =  244 bits (623), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 120/224 (53%), Positives = 153/224 (68%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E VKI  SWK  L+  F S +  ++KE L+  KR G  ++P  +  F AF++TPF+ VK
Sbjct: 5   LEDVKIEPSWKEALKGEFLSLYFGDIKEKLICAKRAG-IVYPPSNLIFNAFNLTPFDTVK 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA GL FSVP G+RIPPSLVN+YKE+ +D+    P  G L +W  +G
Sbjct: 64  VVILGQDPYHGPNQAMGLSFSVPNGVRIPPSLVNIYKEIYDDLGIREPNSGDLTYWAKQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTV    A SH G GW+ FTD+VI ++S   +NIVF+LWG  A+ K  ++D  
Sbjct: 124 VLLLNASLTVGANMANSHSGFGWQIFTDAVIKILSRERENIVFLLWGNPAKAKIPLIDTN 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL A   FFGCRHFSK N YL +H KT ++W +
Sbjct: 184 KHLVLTAAHPSPL-ARGAFFGCRHFSKTNFYLTQHAKTPIDWDL 226


>gi|91794279|ref|YP_563930.1| uracil-DNA glycosylase [Shewanella denitrificans OS217]
 gi|91716281|gb|ABE56207.1| Uracil-DNA glycosylase [Shewanella denitrificans OS217]
          Length = 219

 Score =  244 bits (623), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +SW++L+E      + + L+  + +E+ +G+RIFP     F AF +TP  +VKVVILGQD
Sbjct: 2   KSWQALIEQEQNKAYFQALQAKVATERAQGRRIFPADDSVFAAFAVTPLEQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGLCFSVP GI+IPPSLVN+YKEL  D+  F PP HG L  W  +GVLLLN 
Sbjct: 62  PYHGLGQAHGLCFSVPEGIKIPPSLVNIYKELATDIEGFNPPKHGDLRSWAQQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEEG+A SH   GWE FTD V+  ++     I+F+LWGA A KK  V+   +H +L+
Sbjct: 122 VLTVEEGKAHSHAKWGWECFTDEVLLALNQCSSPIIFVLWGAHAIKKGKVITASQHTILQ 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSA  GFFGC+HFS  N  L + G   ++WQ+
Sbjct: 182 GPHPSPLSAYRGFFGCKHFSTINGILLKQGDKAIDWQV 219


>gi|255065921|ref|ZP_05317776.1| uracil-DNA glycosylase [Neisseria sicca ATCC 29256]
 gi|255049832|gb|EET45296.1| uracil-DNA glycosylase [Neisseria sicca ATCC 29256]
          Length = 219

 Score =  244 bits (623), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   + +     + +++ E +  E+  G+ I+P     F AF  T F  VKVVILGQD
Sbjct: 2   QTWHEAIGSEKSESYFQHIIETVKKERGMGRIIYPPAEDVFNAFKATEFGNVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+ +PPSL N+YKEL +D+  F  P HG+L+HW  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVREGVAVPPSLANIYKELADDIEGFRIPQHGYLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD V++ I+ N +++VFMLWG+ AQKK   +D  RHLVL 
Sbjct: 122 VLTVRAGQAHSHATLGWERFTDEVVNQINQNREHVVFMLWGSHAQKKGAFIDRSRHLVLS 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YLQE+G T ++WQ+
Sbjct: 182 APHPSPLSAYRGFFGCKHFSRANAYLQENGITPIDWQV 219


>gi|330722515|gb|EGH00337.1| Uracil-DNA glycosylase2C family 1 [gamma proteobacterium IMCC2047]
          Length = 212

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 146/205 (71%)

Query: 18  FQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHG 77
           F+ ++MR L+ FL+SEK+ GK ++P     F AF+ TPF++VKVVILGQDPYH  GQAHG
Sbjct: 5   FEKDYMRELRAFLVSEKQAGKTLYPPMPDIFNAFEFTPFDQVKVVILGQDPYHGPGQAHG 64

Query: 78  LCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAAS 137
           LCFSV  G+R PPSL N++KE+  ++      +G L  W  +GVLLLN+VLTV++  A S
Sbjct: 65  LCFSVQAGVRPPPSLKNIFKEINSELGIEFSENGCLTPWAEQGVLLLNSVLTVQQNNAGS 124

Query: 138 HRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASH 197
           H+G+GWEQFTD  I +++  HQ +VF+LWG  AQ K  V+D  RHLVL + HPSP SA  
Sbjct: 125 HQGKGWEQFTDRAIQVLNEQHQGLVFLLWGKYAQDKAAVIDRSRHLVLASPHPSPFSAHR 184

Query: 198 GFFGCRHFSKANRYLQEHGKTTVNW 222
           GF G  HF++AN YLQ  GKT +NW
Sbjct: 185 GFLGNGHFAQANDYLQAQGKTPINW 209


>gi|262375361|ref|ZP_06068594.1| uracil-DNA glycosylase [Acinetobacter lwoffii SH145]
 gi|262309615|gb|EEY90745.1| uracil-DNA glycosylase [Acinetobacter lwoffii SH145]
          Length = 237

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 119/225 (52%), Positives = 156/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M  LK FL+ EK+  K I+P     F A + TP ++VK
Sbjct: 11  LNKVQLDESWKYGLSEFLLSPKMDELKAFLVEEKKADKIIYPPNHLIFNALNTTPLDRVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QAHGL FSV  G+ +PPSL N++ EL  D+    P HG L HW  +G
Sbjct: 71  VVILGQDPYHGPNQAHGLSFSVQKGVALPPSLRNIFHELHVDLGVERPKHGDLTHWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNAVLTVE G+  SH+ RGWE+FTD VID+++   ++IVF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNAVLTVEAGQPTSHQKRGWEEFTDHVIDVLNEQREHIVFILWGAYAQRKGQRINQD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVLKAAHPSPL+A+  GFFGC+ FSK+N YL++HG   ++WQ+
Sbjct: 191 KHLVLKAAHPSPLAANRGGFFGCKVFSKSNNYLKQHGIEPIDWQL 235


>gi|262395219|ref|YP_003287073.1| uracil-DNA glycosylase [Vibrio sp. Ex25]
 gi|262338813|gb|ACY52608.1| uracil-DNA glycosylase [Vibrio sp. Ex25]
          Length = 226

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 149/220 (67%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E+  GK IFP     F AF  T FN VKVVILGQDP
Sbjct: 6   TWHDVIGEEKKQSYFVDTLNFVEAERAAGKAIFPPAKDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + + +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGSHAQKKGRFIDRNKHHVLAA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFGC+HFS+AN+ L   GK  +NW +PL+
Sbjct: 186 PHPSPLSAHRGFFGCKHFSQANQLLASQGKAPINWHLPLT 225


>gi|315181089|gb|ADT88003.1| uracil-DNA glycosylase [Vibrio furnissii NCTC 11218]
          Length = 225

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 150/216 (69%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q ++ ++   F+ +E+  GK IFP     F AF  T F++VKVVILGQDP
Sbjct: 6   TWHDVIGTEKQQDYFQHTLAFVEAERHAGKVIFPPAKDVFNAFRYTEFDQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVQPGIKTPPSLVNMYKELAQDIPGFQIPNHGYLKSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VID ++ N + IVF+LWGA AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGKAHSHANTGWETFTDRVIDALNQNGEGIVFLLWGAHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFS+ N+ L+  GK  ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSQTNQLLEAQGKAPIDWQ 221


>gi|319903123|ref|YP_004162851.1| Uracil-DNA glycosylase [Bacteroides helcogenes P 36-108]
 gi|319418154|gb|ADV45265.1| Uracil-DNA glycosylase [Bacteroides helcogenes P 36-108]
          Length = 220

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 153/219 (69%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F+ E+   L EF+  E + G  ++P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKAHLQPEFEKEYFSTLTEFVREEYKHGP-VYPPGRLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVSFPPSLVNIFKEIKNDIGTDAPNTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I  ++   +++VF+LWGA AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWEAFTDAAIRTLAEEKEHLVFILWGAYAQRKGAFIDRSKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+EHG+  + W
Sbjct: 182 VLASAHPSPLSAYNGFFGNKHFSKTNEYLKEHGEKEIVW 220


>gi|59712720|ref|YP_205496.1| uracil-DNA glycosylase [Vibrio fischeri ES114]
 gi|75506941|sp|Q5E2Y8|UNG_VIBF1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|59480821|gb|AAW86608.1| uracil-DNA-glycosylase [Vibrio fischeri ES114]
          Length = 224

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 153/215 (71%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W S++    +  + +++ E + +++  GK IFP+  H F AFD+TPF+ VKVVILGQDP
Sbjct: 4   TWNSIISAEKKKAYYQSMSEKIDAQRSLGKSIFPKEEHIFTAFDLTPFHDVKVVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G++IPPSL N+YKEL ED+  F  P HG+L+ W  +GVLLLN V
Sbjct: 64  YHGEGQAHGLSFSVLPGVKIPPSLRNMYKELAEDIPGFTIPEHGYLKTWAEQGVLLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVEE +A SH   GWE FTD++I  I+++ + ++F+LWGA AQKK   +D  RH +L+A
Sbjct: 124 LTVEEAKAHSHAKFGWETFTDAIIKKINDDMEGVIFLLWGAHAQKKGANIDTSRHFILQA 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC+HFS+ N  L++   + +NW
Sbjct: 184 PHPSPLSAHRGFFGCKHFSQTNELLRKQNLSEINW 218


>gi|326388613|ref|ZP_08210206.1| uracil-DNA glycosylase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206864|gb|EGD57688.1| uracil-DNA glycosylase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 229

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 120/228 (52%), Positives = 151/228 (66%), Gaps = 3/228 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M    I ESW+  L    QS  ++ L  FL SE+  GK I+P       A ++TP + V+
Sbjct: 1   MTATAIPESWRPALGPVLQSPPLKALGSFLSSEEASGKAIYPPRGTRLAALELTPLDSVR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSV  G+R+PPSLVN+YKELQ D+   P  HG L+ W  +G
Sbjct: 61  VVILGQDPYHGAGQAHGLAFSVQPGVRVPPSLVNIYKELQSDLGIPPARHGHLDAWARQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQ---DVL 177
           VLLLN  LTVE+G+  SH+ RGWE  TD+ +  ++   +  VF+LWG+ AQKK      L
Sbjct: 121 VLLLNNALTVEQGQPGSHQNRGWELLTDAAVAAVAAKSEPCVFLLWGSHAQKKAARVPGL 180

Query: 178 DHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            +  HLVLKA HPSPLSA  GFFGCRHFSKAN +L EHG+  V+W++P
Sbjct: 181 MNGPHLVLKAPHPSPLSAHSGFFGCRHFSKANAFLTEHGRGEVDWRLP 228


>gi|212550731|ref|YP_002309048.1| uracil-DNA glycosylase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|229557919|sp|B6YR15|UNG_AZOPC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|212548969|dbj|BAG83637.1| uracil-DNA glycosylase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 220

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SW+  L   F+  + + L EF+ +E    K I+P+G+  F AFD TP ++VKVVI
Sbjct: 3   VKIEQSWRKYLVPEFEKPYFKQLVEFIKNE-YASKIIYPKGNKIFSAFDKTPLDRVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCFSV  GI +PPSL N+YKE+++D+  +  T G LE W  +GVLL
Sbjct: 62  LGQDPYHEPGQANGLCFSVNEGIPLPPSLQNIYKEVKDDIGIVSSTSGNLERWSEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV+  +A SH+ +GWE+FTD++I +I    Q+IVF+LWG  AQKK   +   +HL
Sbjct: 122 LNATLTVQAHKAGSHQKKGWEKFTDAIIHIILKEKQHIVFILWGTYAQKKGAFIPSDKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LK+AHPSP SA+ GFFG + FSK N YL++ G+T + W
Sbjct: 182 ILKSAHPSPFSANKGFFGSKPFSKTNDYLKKTGQTVITW 220


>gi|224536066|ref|ZP_03676605.1| hypothetical protein BACCELL_00930 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522325|gb|EEF91430.1| hypothetical protein BACCELL_00930 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 220

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 157/219 (71%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK+ L+  F+ ++   L +F+  E+     I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEESWKARLKPEFEKDYFHTLTDFV-REEYSHYPIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+R PPSL+N++KE+++D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVRFPPSLINIFKEIKDDIGTDAPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I +++   +++VF+LWG+ AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRVLAEQREHLVFILWGSYAQRKGAFIDRSKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFS+AN YL+EHG+  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSRANAYLKEHGEQEIAW 220


>gi|309775881|ref|ZP_07670875.1| uracil-DNA glycosylase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916419|gb|EFP62165.1| uracil-DNA glycosylase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 222

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 151/221 (68%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I   W  LL++ FQ E+ + L+ FL  E  K + I+P     F A   T +  VKVVI
Sbjct: 2   VQIGNDWDELLKDEFQKEYYQKLRIFLARE-YKTQTIYPDMYDIFNALRYTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL+N+YKELQ+D+    P HG L  W  EGVLL
Sbjct: 61  LGQDPYHGPGQAHGLCFSVKKGVNPPPSLINIYKELQDDLGCSIPVHGELTKWTREGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  TD +I  ++   + IVF+LWG +A++K +++ +  HL
Sbjct: 121 LNTVLTVRRGQANSHRGKGWEILTDEIIRKLNERKEPIVFLLWGRNAKEKMELITNPAHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L  AHPSP SA +GFFGC HFSKAN +L+EHG+  ++WQI
Sbjct: 181 ILSCAHPSPFSADYGFFGCHHFSKANAFLKEHGQQPIDWQI 221


>gi|332142485|ref|YP_004428223.1| uracil-DNA glycosylase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327552507|gb|AEA99225.1| uracil-DNA glycosylase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 221

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/217 (53%), Positives = 147/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+S L N  Q E+   L E +   +  G  I+P     F A   TP +KV VVILGQDP
Sbjct: 5   TWQSALGNEKQKEYFVELLERVKQAREAGSVIYPPQPDVFNALKYTPLDKVNVVILGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSL N+YKEL  D++ F+ P HG L  W  +GVLLLN V
Sbjct: 65  YHGPNQAHGLCFSVQAGVKTPPSLKNMYKELLTDIDGFVEPNHGTLTPWAEQGVLLLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VID+++ N +N+VF+LWG+ AQKK   +D ++H VL A
Sbjct: 125 LTVEQGKAHSHAKWGWETFTDKVIDVVNANCENVVFLLWGSHAQKKGKHIDREKHKVLHA 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC+HFS+ N YL E GKT +NWQ+
Sbjct: 185 PHPSPLSAHRGFLGCKHFSQTNEYLVEKGKTPINWQV 221


>gi|103487859|ref|YP_617420.1| uracil-DNA glycosylase [Sphingopyxis alaskensis RB2256]
 gi|98977936|gb|ABF54087.1| Uracil-DNA glycosylase [Sphingopyxis alaskensis RB2256]
          Length = 234

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/229 (51%), Positives = 157/229 (68%), Gaps = 4/229 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  VK+H  W + +   F   +M  LK+FL  E+ KGK I+PR   +F A D TP + V+
Sbjct: 1   MAEVKLHPDWLARIGGEFAQPYMAALKQFLADERAKGKTIYPRPRDWFAALDATPPDAVR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGLCFSV  G+R+PPSLVN+YKEL+ D+   P  HG L HW  +G
Sbjct: 61  VVILGQDPYHGPGQAHGLCFSVQPGVRLPPSLVNIYKELRSDLGIAPAPHGHLAHWARQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLD-- 178
           VLLLN  LTVE G+AASH+G+GWE+FTD+ +  ++ +    VF+LWG+ AQKK   +   
Sbjct: 121 VLLLNNCLTVEAGQAASHQGKGWEKFTDAAVAAVAADPAPKVFILWGSHAQKKAANVPGL 180

Query: 179 --HKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
                HL+L+A HPSPLSA +GFFG R FS+AN +L+  G+  ++W++P
Sbjct: 181 GAGSPHLILRAPHPSPLSAHNGFFGSRPFSQANAFLEAQGRGAIDWRLP 229


>gi|260767358|ref|ZP_05876297.1| uracil-DNA glycosylase [Vibrio furnissii CIP 102972]
 gi|260617681|gb|EEX42861.1| uracil-DNA glycosylase [Vibrio furnissii CIP 102972]
          Length = 225

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/216 (53%), Positives = 150/216 (69%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q ++ ++   F+ +E+  GK IFP     F AF  T F++VKVVILGQDP
Sbjct: 6   TWHDVIGTEKQQDYFQHTLAFVEAERHAGKVIFPPAKDVFNAFRYTEFDQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHG+CFSV  GI+ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGMCFSVQPGIKTPPSLVNMYKELAQDIPGFQIPNHGYLKSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VID ++ N + IVF+LWGA AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGKAHSHANTGWETFTDRVIDALNQNGEGIVFLLWGAHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFS+ N+ L+  GK  ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSQTNQLLEAQGKAPIDWQ 221


>gi|86141581|ref|ZP_01060127.1| uracil-DNA glycosylase [Leeuwenhoekiella blandensis MED217]
 gi|85832140|gb|EAQ50595.1| uracil-DNA glycosylase [Leeuwenhoekiella blandensis MED217]
          Length = 221

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 157/220 (71%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V IH SWK++L   F+  + ++L  F+ +E  +    +P+G+  F+AFD+  F++VKVVI
Sbjct: 3   VDIHPSWKAVLAEEFEKAYFKDLVRFVKTEYTQ-HTCYPKGADIFKAFDLCSFDEVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSVP G+  PPSL+N++KE++ D+N   P +G LE W  +GVLL
Sbjct: 62  LGQDPYHGPGQAHGLCFSVPQGVAAPPSLINIFKEIESDLNIAAPNNGNLERWASQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV  G+A SH+G+GWEQFTD VI+LIS + +N+VF+LWG  A+KK   +D  +H 
Sbjct: 122 LNATLTVRAGQAGSHQGKGWEQFTDRVIELISQHKENVVFLLWGGFAKKKASKVDGTKHH 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG RHFSK N  +++  +  + W
Sbjct: 182 ILTSGHPSPLSANRGYWFGNRHFSKTNALIEKSNQRPIIW 221


>gi|301167537|emb|CBW27120.1| uracil-DNA glycosylase (UDG) [Bacteriovorax marinus SJ]
          Length = 226

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/224 (50%), Positives = 156/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  + +H SWKSLL++ F  ++ ++L+EFL++E  + + I+P     F A + TP  KV+
Sbjct: 3   LTDIPLHSSWKSLLKDEFSKDYFKDLEEFLVNE-FENQTIYPPREMIFHALNQTPLEKVR 61

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VV++GQDPYH  GQAHGL FSV  GI+IPPSL N+YKEL +D+    P HG L  W  EG
Sbjct: 62  VVLIGQDPYHGEGQAHGLSFSVEKGIKIPPSLRNIYKELNDDLGVEIPEHGDLSKWAQEG 121

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV+   A SH+ +GWE+FTD +I+LI    +N+VF LWG+SAQKK   +D K
Sbjct: 122 VLLLNDVLTVQAKSAGSHQKKGWEKFTDRIIELIDQECENVVFFLWGSSAQKKARKVDTK 181

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LK+ HPSPLS+  GFFG + FSK N YL+E     ++W +
Sbjct: 182 KHLILKSVHPSPLSSYRGFFGSKPFSKTNHYLKEKRVQEIDWNL 225


>gi|227539034|ref|ZP_03969083.1| uracil-DNA glycosylase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241090|gb|EEI91105.1| uracil-DNA glycosylase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 226

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 154/221 (69%), Gaps = 2/221 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ESW  +L+  F+  +MR+L +F+  E+++   IFP       AF +TP ++VKVVILGQD
Sbjct: 7   ESWDVILKPLFKEPYMRSLSQFVQQERQRC-LIFPPEDLVLNAFKLTPLDEVKVVILGQD 65

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYHN GQAHGL FSVP G+ +PPSL N+Y ELQ D+  F  P  G L  W  +GVLLLNA
Sbjct: 66  PYHNDGQAHGLSFSVPDGVALPPSLRNIYSELQTDIPGFTYPATGNLTKWARQGVLLLNA 125

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTV    A SH+ RGWE FTD +I  IS + +++VF+LWG+ AQKK  ++D  +HL+L 
Sbjct: 126 TLTVRAHEAGSHQKRGWELFTDQIIQKISEHCKHVVFILWGSYAQKKAVLIDKSKHLILT 185

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           A HPSPLS   GFFGC+HFSKAN YL++HG+  ++W+I + 
Sbjct: 186 AVHPSPLSVYRGFFGCKHFSKANEYLKDHGRLPIDWRIAID 226


>gi|294464349|gb|ADE77687.1| unknown [Picea sitchensis]
          Length = 378

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/224 (51%), Positives = 151/224 (67%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E + +  +W   L    Q  +M  L +F+  E R    I+P  +  F A +I PF+KVK
Sbjct: 155 LEDLLVERTWLDALPGELQKPYMEKLSQFVTQEARGTIHIYPPPALVFNALNICPFDKVK 214

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVI+GQDPYH  GQA GLCFSVP GI++P SLVN++KE+Q+DV +  PTHG LE W  +G
Sbjct: 215 VVIIGQDPYHGPGQAMGLCFSVPKGIKMPSSLVNIFKEIQQDVGYPLPTHGNLERWAIQG 274

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV E +A SH  RGWE FTD+VI  +S     I+F+LWG SAQ+K  ++D  
Sbjct: 275 VLLLNTVLTVREHQANSHAKRGWEVFTDAVIRALSLKKSGIIFILWGNSAQEKIRIIDTN 334

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H +LKAAHPS LSA   FF CRHFS+AN+ L+  G   ++WQI
Sbjct: 335 KHHILKAAHPSGLSAHRRFFQCRHFSQANKILERLGSMPIDWQI 378


>gi|167625300|ref|YP_001675594.1| uracil-DNA glycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167355322|gb|ABZ77935.1| uracil-DNA glycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 222

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 7   HESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQ 66
           H SW S +E+  Q  + +++++F+ +E+  GK I+P  S  F AFD TP NKV+VV++GQ
Sbjct: 4   HSSWLSFIEDQQQQSYFQSVQQFVKAERAAGKAIYPPESEVFAAFDSTPLNKVRVVLIGQ 63

Query: 67  DPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLN 125
           DPYH   QAHGLCFSV  G++ PPSLVN+YKEL  D++ F  P HG L HW  +GVL+LN
Sbjct: 64  DPYHGPNQAHGLCFSVKHGVKTPPSLVNMYKELASDIDGFTIPEHGNLSHWAEQGVLMLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE+G+A SH   GWE FT + + L++   Q I+F+LWGA A KK   ++  +H V+
Sbjct: 124 TVLTVEQGKAHSHAKSGWESFTANALALLNEQSQPIIFVLWGAHAIKKGKGINAPQHQVI 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
              HPSPLSA  GFFGC+HFSK N  LQ  G+  ++WQ+
Sbjct: 184 SGPHPSPLSAYRGFFGCKHFSKINELLQARGERAIDWQV 222


>gi|237744233|ref|ZP_04574714.1| uracil-DNA glycosylase [Fusobacterium sp. 7_1]
 gi|229431462|gb|EEO41674.1| uracil-DNA glycosylase [Fusobacterium sp. 7_1]
          Length = 226

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  FQ ++   LK  +L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFQKDYFVKLKA-ILEEEYKNYTVYPPKKDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV + +A SH G GW+ FTD+VI  ++   + I+F+LWG++A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSQANSHSGIGWQTFTDNVIKSLNEREKPIIFILWGSNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANKGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|332884690|gb|EGK04947.1| uracil-DNA glycosylase [Dysgonomonas mossii DSM 22836]
          Length = 220

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SWK  L++ F+ ++   L +F+  E  K K+IFP     F AF+ TPF+KVKVVI
Sbjct: 3   VKIEQSWKDQLKDEFEKDYFEKLTDFVRVE-YKTKQIFPPARLIFNAFEHTPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYHN GQAHGL FSVP GI  PPSLVN++KE+  D+    P  G L  W ++GVLL
Sbjct: 62  LGQDPYHNDGQAHGLSFSVPDGIPAPPSLVNIFKEINRDLGIPVPRSGNLTRWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV+   A SH+ +GWE FTD+ I  ++   +N+VF+LWGA AQKK   +D  +HL
Sbjct: 122 LNATLTVQAHMAGSHQKKGWEAFTDAAIHRLAEKRENLVFILWGAYAQKKASFIDPNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL++ HPSPLSA +GFFG  HFS AN+YLQ  G   + W
Sbjct: 182 VLRSVHPSPLSAYNGFFGNSHFSMANKYLQSKGIAPIEW 220


>gi|262370388|ref|ZP_06063714.1| uracil-DNA glycosylase [Acinetobacter johnsonii SH046]
 gi|262314730|gb|EEY95771.1| uracil-DNA glycosylase [Acinetobacter johnsonii SH046]
          Length = 237

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 158/225 (70%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +++  SWK  L +   S  M  LK+FL++E +  K I+P  +  F AF+ TP   VK
Sbjct: 11  LDKIQLDASWKHGLSDFLLSTKMDALKQFLVTEIKANKVIYPPNALIFNAFNTTPLANVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QAHGL FSV  G+ +PPSL N++ EL +D+    P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQAHGLSFSVQKGLALPPSLRNIFHELNKDLGIDIPKHGDLTRWAQQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   ++IVF+LWGA AQ+K   +D +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEDFTDHVIDVLNEQREHIVFILWGAYAQRKGQRIDQE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVLKAAHPSPL+A+  GFFGC+ FSK+N YL++HG   ++WQ+
Sbjct: 191 KHLVLKAAHPSPLAANRGGFFGCKVFSKSNNYLKQHGIEPIDWQL 235


>gi|261253792|ref|ZP_05946365.1| uracil-DNA glycosylase [Vibrio orientalis CIP 102891]
 gi|260937183|gb|EEX93172.1| uracil-DNA glycosylase [Vibrio orientalis CIP 102891]
          Length = 228

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q E+ +    F+ +E+  GK +FP  S  F AF  T F  VKVVI+GQDP
Sbjct: 6   TWHDVIGVEKQQEYFQQTLSFVEAERAAGKVVFPPASDVFNAFKATEFADVKVVIIGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNMYKELAQDIEGFEIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ +   +VF+LWGA AQKK   +D  +H VL  
Sbjct: 126 LTVEQGKAHSHAKSGWETFTDKVIEAINQHQSGVVFLLWGAHAQKKGRFIDRAKHHVLSG 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGCRHFS+ N  L   G++T+ WQ+P+
Sbjct: 186 PHPSPLSAHRGFFGCRHFSQTNAILASQGQSTIQWQLPM 224


>gi|323497911|ref|ZP_08102920.1| uracil-DNA glycosylase [Vibrio sinaloensis DSM 21326]
 gi|323316956|gb|EGA69958.1| uracil-DNA glycosylase [Vibrio sinaloensis DSM 21326]
          Length = 226

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q  + +   EF+ +E+  GK IFP     F AF  T FN VKVVI+GQDP
Sbjct: 6   TWHDVIGVEKQQAYFQQTLEFVEAERASGKVIFPPAKDVFNAFRATEFNDVKVVIIGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSL N+YKEL +D+  F  P+HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLANMYKELAQDIEGFQIPSHGYLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ ++ +   +VF+LWGA AQKK   +D  +H VL  
Sbjct: 126 LTVEQGKAHSHAKSGWETFTDKVIEAVNQHQSGVVFLLWGAHAQKKGRFIDRDKHHVLAG 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGCRHFS+AN+ L E G++ ++W +PL
Sbjct: 186 PHPSPLSAHRGFFGCRHFSQANQILAEQGESPIDWHLPL 224


>gi|298368648|ref|ZP_06979966.1| uracil-DNA glycosylase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282651|gb|EFI24138.1| uracil-DNA glycosylase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 219

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/218 (53%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    +  + R++ + +  E+  G+ I+P  +  F AF  T FN+VKVVILGQD
Sbjct: 2   QTWHEALGAEKEQPYFRHIIQSVRQEREAGRIIYPPAADVFNAFKATEFNQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV   I IPPSLVN+YKEL +D+  F  P HG L+HW  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRPEIDIPPSLVNIYKELADDIPGFRIPRHGCLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWEQFTD VI  ++   ++IVFMLWG+ AQKK   +D +RHLVL 
Sbjct: 122 VLTVRAGQAHSHAALGWEQFTDRVIAQLNEYREHIVFMLWGSHAQKKGAFIDRRRHLVLS 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFGC+HFS+AN YL  HG   ++WQ+
Sbjct: 182 SPHPSPLSAYRGFFGCKHFSQANAYLAAHGTAVIDWQV 219


>gi|94498211|ref|ZP_01304772.1| uracil-DNA glycosylase [Sphingomonas sp. SKA58]
 gi|94422341|gb|EAT07381.1| uracil-DNA glycosylase [Sphingomonas sp. SKA58]
          Length = 236

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 145/217 (66%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W + L        +  + +F+  E   GKR+FP     FRA  +TP   VKVVILGQDP
Sbjct: 10  AWATALSGRIDDTDLTAIAQFVEDEMAAGKRVFPARDDIFRALALTPPEAVKVVILGQDP 69

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV  G+R PPSL N+YKEL  D+   P  HG L+HW  +GVLLLN+VL
Sbjct: 70  YHGEGQAHGLSFSVQPGVRTPPSLRNIYKELHADLGIAPAGHGHLDHWARQGVLLLNSVL 129

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE G+AASH+G+GWE+ TD+++  ++      VF+LWGA AQ+K   +D  RHLV+++A
Sbjct: 130 TVEMGKAASHQGKGWEKLTDAIVAQVAERVVPSVFLLWGAHAQRKAGAIDEARHLVIRSA 189

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA  GF G R FS+AN +L+  G+  ++W +P
Sbjct: 190 HPSPLSAHGGFLGSRPFSQANAFLEAQGRGGIDWALP 226


>gi|256421753|ref|YP_003122406.1| uracil-DNA glycosylase [Chitinophaga pinensis DSM 2588]
 gi|256036661|gb|ACU60205.1| uracil-DNA glycosylase [Chitinophaga pinensis DSM 2588]
          Length = 223

 Score =  241 bits (616), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 149/221 (67%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI  SWK +L++ F   +   +   L  EK  G  ++P G+  F AF+ TPF+KVKVV+
Sbjct: 3   VKIEPSWKEVLKDEFHKAYFEQIVMALKHEKAVGNTVYPPGNLIFNAFEHTPFDKVKVVL 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGLCFSV  GI+ PPSLVN+YKE++ED+    P  G L  W   GVLL
Sbjct: 63  LGQDPYHGPNQAHGLCFSVQDGIKPPPSLVNIYKEMKEDLGLPIPQGGNLTKWADNGVLL 122

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA+LTV    AASH   GWE FTDSVI  +S+  +N+VF+LWG  AQ KQ ++D  +H 
Sbjct: 123 LNAMLTVRANEAASHSKIGWESFTDSVIRKVSDLKENVVFILWGRFAQDKQVLIDATKHH 182

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +LKAAHPSP SA  GFFGC+HFSK N  L + G   V+W++
Sbjct: 183 ILKAAHPSPFSADKGFFGCKHFSKTNELLSKAGIEPVDWRL 223


>gi|262372475|ref|ZP_06065754.1| uracil-DNA glycosylase [Acinetobacter junii SH205]
 gi|262312500|gb|EEY93585.1| uracil-DNA glycosylase [Acinetobacter junii SH205]
          Length = 237

 Score =  241 bits (616), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 153/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  ++I ESWK  L      + M NL+EFL  EK   K I+P     F AF+ TP N VK
Sbjct: 11  LNKIQIDESWKYSLSEFLLGQKMDNLREFLQQEKLAQKTIYPPSKQIFNAFNTTPLNHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELNTDLGIPVSRHGDLSKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD+VID+++ + + IVF+LWGA AQ+K   +D  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEDFTDNVIDVLNEHRERIVFILWGAYAQRKGQRIDRN 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPLSA+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLSAAHPSPLSANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|221132171|ref|XP_002166406.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 322

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/220 (53%), Positives = 155/220 (70%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI E W+ ++   FQ  + +NL++F+ +E+RK K I+P  +  +        N+ KVVI
Sbjct: 98  VKISEGWQDVINIEFQKTYFKNLQQFV-AEQRKTKVIYPPENEVYSWTQHFNINETKVVI 156

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+YKEL  D+  F  P HGFL  W  +GVL
Sbjct: 157 LGQDPYHGPGQAHGLCFSVKPGVPPPPSLVNMYKELSNDIPGFKTPNHGFLLGWAKQGVL 216

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNAVLTVE+G A SH+ +GWE+FTD++I  I++N + +VF+LWG  AQKK   ++   H
Sbjct: 217 LLNAVLTVEKGLANSHKDKGWEKFTDAIIHWINDNLKGVVFILWGGYAQKKGSFINKSSH 276

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           LVL   HPSPLSA  GFFGC+HFSKAN+YL+E+ K  ++W
Sbjct: 277 LVLSGMHPSPLSAHRGFFGCKHFSKANQYLRENNKQEIDW 316


>gi|256027897|ref|ZP_05441731.1| uracil-DNA glycosylase [Fusobacterium sp. D11]
 gi|260494183|ref|ZP_05814314.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_33]
 gi|289765846|ref|ZP_06525224.1| uracil-DNA glycosylase [Fusobacterium sp. D11]
 gi|260198329|gb|EEW95845.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_33]
 gi|289717401|gb|EFD81413.1| uracil-DNA glycosylase [Fusobacterium sp. D11]
          Length = 226

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  FQ ++   LK  +L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFQKDYFVKLKA-ILEEEYKNYTVYPPKKDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV + +A SH G GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSQANSHSGIGWQTFTDNVIKSLNEREKPIIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANKGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|300770542|ref|ZP_07080421.1| uracil-DNA glycosylase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300763018|gb|EFK59835.1| uracil-DNA glycosylase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 226

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 153/218 (70%), Gaps = 2/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ESW  +L+  F+  +MR+L +F+  E+++   IFP       AF +TP ++VKVVILGQD
Sbjct: 7   ESWDVILKPLFKEPYMRSLSQFVQQERQRC-LIFPPEDLVLNAFKLTPLDQVKVVILGQD 65

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYHN GQAHGL FSVP G+ +PPSL N+Y ELQ D+  F  P  G L  W  +GVLLLNA
Sbjct: 66  PYHNDGQAHGLSFSVPDGVALPPSLRNIYSELQTDIPGFTYPATGNLTKWATQGVLLLNA 125

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTV    A SH+ RGWE FTD +I  IS + +++VF+LWG+ AQKK  ++D  +HL+L 
Sbjct: 126 TLTVRAHEAGSHQKRGWELFTDQIIQKISEHCEHVVFILWGSYAQKKAVLIDKSKHLILT 185

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLS   GFFGC+HFSKAN YL++HG+  ++W+I
Sbjct: 186 SVHPSPLSVYRGFFGCKHFSKANEYLKDHGRLPIDWRI 223


>gi|332827023|gb|EGJ99812.1| uracil-DNA glycosylase [Dysgonomonas gadei ATCC BAA-286]
          Length = 220

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK  L + F  ++   L +F+ +E R  K+IFP     F AF+ TPF+KVKVVI
Sbjct: 3   VKIEESWKEQLIDEFDKDYFVKLTDFVRNEYRT-KQIFPPAKLIFNAFEHTPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYHN GQAHGL FSVP G+  PPSLVN++KE+  D+    P  G L  W ++GVLL
Sbjct: 62  LGQDPYHNDGQAHGLSFSVPDGMPAPPSLVNIFKEINRDMGIPVPRSGNLTRWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV+   A SH+ +GWE FTD+ I  ++   +NIVF+LWGA AQKK   +D  +HL
Sbjct: 122 LNATLTVQAHMAGSHQKKGWEAFTDAAIHKLAEGRENIVFILWGAYAQKKAAFIDANKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+ HPSPLSA +GFFG  HFS+AN+YL+  G   + W
Sbjct: 182 VLKSVHPSPLSAHNGFFGNNHFSEANKYLKSKGIEPIEW 220


>gi|323340214|ref|ZP_08080478.1| uracil-DNA glycosylase [Lactobacillus ruminis ATCC 25644]
 gi|323092405|gb|EFZ35013.1| uracil-DNA glycosylase [Lactobacillus ruminis ATCC 25644]
          Length = 232

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 156/220 (70%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +LE+ F+S++   L  FL +E    + I+P   H F AF++TPF+ VKVVILG
Sbjct: 8   IHNEWQEVLESEFESDYYAKLHAFLKNEYL-SQTIYPDMYHIFEAFELTPFSDVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+YKEL+ D+   P  HG+L+ W  +GVLLLN
Sbjct: 67  QDPYHGPNQAHGLSFSVLPGVDIPPSLRNIYKELESDLGIKPVNHGYLKKWAEQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWE+ TD+ I+ +S+    +VF+LWG +AQ K  ++D  +++VL
Sbjct: 127 SVLTVRNGQAFSHKGKGWERLTDAAIEKLSSRPGPVVFILWGRAAQDKISLIDTTKNIVL 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSPLSAS GFFG R FSK N+ L   G+  ++WQ+P
Sbjct: 187 KSAHPSPLSASRGFFGSRPFSKTNQALIAMGEEPIDWQLP 226


>gi|329960266|ref|ZP_08298708.1| uracil-DNA glycosylase [Bacteroides fluxus YIT 12057]
 gi|328532939|gb|EGF59716.1| uracil-DNA glycosylase [Bacteroides fluxus YIT 12057]
          Length = 220

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 116/219 (52%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L+  F+ ++   L  F+  E + G  I+P GS  F AF++ PFNKVKVVI
Sbjct: 3   VQIEESWKVHLQPEFEKDYFSILTTFVREEYKHGP-IYPPGSLIFNAFNLCPFNKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKNDIGTDAPATGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I +++   +++VF+LWGA AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRILAEEKEHLVFILWGAYAQRKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG RHFSK N YL+ HG+  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNRHFSKTNEYLRAHGEKEIIW 220


>gi|154503116|ref|ZP_02040176.1| hypothetical protein RUMGNA_00940 [Ruminococcus gnavus ATCC 29149]
 gi|153796110|gb|EDN78530.1| hypothetical protein RUMGNA_00940 [Ruminococcus gnavus ATCC 29149]
          Length = 222

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L+  F+  + + L    ++E+ + ++IFP  +  F AF +TP   VKVVILG
Sbjct: 4   INGDWYEALKGEFKKPYYKTLFN-TVNEEYRTRQIFPPANDIFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN+ QAHGLCFSV  G+++PPSLVN+YKELQ+D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNFNQAHGLCFSVKKGVQVPPSLVNIYKELQDDLGCTIPNHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + +VF+LWGA AQ+K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMAVNAQDRPVVFILWGAPAQRKKRMLNNSKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N +L+EHG T ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSQTNHFLEEHGVTPIDWQI 221


>gi|146329747|ref|YP_001209540.1| uracil-DNA glycosylase [Dichelobacter nodosus VCS1703A]
 gi|166201518|sp|A5EVB8|UNG_DICNV RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|146233217|gb|ABQ14195.1| uracil-DNA glycosylase [Dichelobacter nodosus VCS1703A]
          Length = 229

 Score =  241 bits (615), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 149/224 (66%), Gaps = 2/224 (0%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           E V+I ESWK +L   F  ++   +KE LL+ K +G   +P     F AFD TPF+ VK 
Sbjct: 7   ENVRIEESWKKVLYEQFSQDYFVRIKETLLAAKAQGIVTYPPNKLIFNAFDQTPFDAVKA 66

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEG 120
           VI+GQDPYH  GQA GL FSVP G+R PPSL+N+YKEL+    +F  P HG L  W  +G
Sbjct: 67  VIIGQDPYHGRGQAMGLSFSVPKGVRPPPSLLNIYKELKRSYPDFQVPDHGDLSAWAKQG 126

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTVE G+A SHR  GW++FT + I+ +SN  ++IVFMLWG  A+ K   +D +
Sbjct: 127 VLLLNASLTVEAGKAGSHRAIGWQEFTHAAIEALSNEREHIVFMLWGNFAKAKAQFIDAE 186

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H +L A HPSPL A   F GC HF +AN YL  HGKT +NWQ+
Sbjct: 187 KHCILTAVHPSPL-AGGAFIGCDHFRRANDYLIAHGKTPINWQV 229


>gi|254474210|ref|ZP_05087601.1| uracil-DNA glycosylase [Pseudovibrio sp. JE062]
 gi|211956740|gb|EEA91949.1| uracil-DNA glycosylase [Pseudovibrio sp. JE062]
          Length = 225

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 150/224 (66%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  ++    W+ +L    +  + + L+ FL +E   GK I+P  +  + AF+      V+
Sbjct: 1   MTQMQFEAGWQGILAPEMEKPYFQKLQAFLDAEAAAGKTIYPPAADCYAAFEAAALRDVR 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSV  G+++PPSL N+YKEL+ D+ F P +HG L HW  +G
Sbjct: 61  VVILGQDPYHGEGQAHGLSFSVRKGVKLPPSLRNIYKELESDLGFAPASHGCLTHWAEQG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN  L+VEE +A SH  +GW  FTD+ I  +S+  +++VF+LWGA AQKK +++D  
Sbjct: 121 VLLLNTSLSVEEAKAGSHAKKGWAPFTDAAIKGLSDIREHLVFILWGAHAQKKLELIDES 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL +AHPSPLSA  GFFG   FSK N YL+EHG   ++WQI
Sbjct: 181 KHLVLMSAHPSPLSARRGFFGSAPFSKTNAYLREHGLKEIDWQI 224


>gi|262170685|ref|ZP_06038363.1| uracil-DNA glycosylase [Vibrio mimicus MB-451]
 gi|261891761|gb|EEY37747.1| uracil-DNA glycosylase [Vibrio mimicus MB-451]
          Length = 226

 Score =  241 bits (614), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 148/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q ++ +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQDYFQQTMQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQMPQHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   +VF+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRTGLVFLLWGSHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFSK N+ LQE G   ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSKTNQVLQEQGLAPIDWQ 221


>gi|258620910|ref|ZP_05715944.1| uracil-DNA glycosylase [Vibrio mimicus VM573]
 gi|258623865|ref|ZP_05718819.1| uracil-DNA glycosylase [Vibrio mimicus VM603]
 gi|262166414|ref|ZP_06034151.1| uracil-DNA glycosylase [Vibrio mimicus VM223]
 gi|258583854|gb|EEW08649.1| uracil-DNA glycosylase [Vibrio mimicus VM603]
 gi|258586298|gb|EEW11013.1| uracil-DNA glycosylase [Vibrio mimicus VM573]
 gi|262026130|gb|EEY44798.1| uracil-DNA glycosylase [Vibrio mimicus VM223]
          Length = 226

 Score =  241 bits (614), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 148/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q ++ +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQDYFQQTMQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPQHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   +VF+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRTGLVFLLWGSHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFSK N+ LQE G   ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSKTNQVLQEQGLAPIDWQ 221


>gi|294650539|ref|ZP_06727896.1| uracil-DNA glycosylase [Acinetobacter haemolyticus ATCC 19194]
 gi|292823536|gb|EFF82382.1| uracil-DNA glycosylase [Acinetobacter haemolyticus ATCC 19194]
          Length = 239

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 155/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L +   S+ M NL+EFL  +K   K I+P     F A + TP N VK
Sbjct: 13  LSKVQLDESWKISLSDFLLSQKMDNLREFLQQQKNAEKIIYPPSKQIFNALNTTPLNAVK 72

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 73  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELSTDLVIPISRHGDLSKWAEQG 132

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   +++VF+LWGA AQ+K   +D  
Sbjct: 133 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHVVFILWGAYAQRKGQRIDRN 192

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RHLVL AAHPSPL+A+  GFFGC+ FSK+N YL++HG   ++WQ+
Sbjct: 193 RHLVLSAAHPSPLAANRGGFFGCKVFSKSNHYLKQHGIEPIDWQL 237


>gi|254507854|ref|ZP_05119984.1| uracil-DNA glycosylase [Vibrio parahaemolyticus 16]
 gi|219549227|gb|EED26222.1| uracil-DNA glycosylase [Vibrio parahaemolyticus 16]
          Length = 229

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q  + ++   F+ +E++ GK IFP     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGKEKQQAYFQDTLSFVEAERQSGKVIFPPAQDVFNAFRATEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNMYKELAQDIEGFQIPQHGYLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ +   +VF+LWGA AQKK   +D  +H VL  
Sbjct: 126 LTVEQGKAHSHSKSGWETFTDRVIEAINQHQSGVVFLLWGAHAQKKGRFIDRDKHHVLAG 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGCRHFS+ N  L + GK+ ++W +PL
Sbjct: 186 PHPSPLSAHRGFFGCRHFSQTNALLAQQGKSAIDWHLPL 224


>gi|154149041|ref|YP_001405949.1| uracil-DNA glycosylase [Campylobacter hominis ATCC BAA-381]
 gi|166201514|sp|A7I0A8|UNG_CAMHC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|153805050|gb|ABS52057.1| uracil-DNA glycosylase [Campylobacter hominis ATCC BAA-381]
          Length = 235

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/224 (50%), Positives = 150/224 (66%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E +KI +SWK +L+  F S +   +KE L+  K  G  I+P G+  F AF++TPF+KVK
Sbjct: 5   LENIKIEKSWKEVLKGEFLSPYFLEIKEKLVCLKNSGVTIYPPGNLIFNAFNLTPFDKVK 64

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA GL FSVP  +RIPPSL+N++KE+  D+    P  G L  W  +G
Sbjct: 65  VVILGQDPYHEVNQAMGLSFSVPKDVRIPPSLINIFKEINSDLGINEPNCGDLTFWAKQG 124

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V    A SH+  GW+ FTD+VI  +S   +NIVFMLWG  A+ K  ++D K
Sbjct: 125 VLLLNASLSVSAKIANSHKNFGWQIFTDAVIKTLSQKRENIVFMLWGNFAKAKATLIDAK 184

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+L AAHPSPL A   FFGC+HFSK N +L   G + +NW +
Sbjct: 185 KHLILTAAHPSPL-AGGAFFGCKHFSKCNNFLISRGISPINWDL 227


>gi|119503976|ref|ZP_01626057.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2080]
 gi|119459979|gb|EAW41073.1| uracil-DNA glycosylase [marine gamma proteobacterium HTCC2080]
          Length = 238

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 142/221 (64%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           ++   W   L +      M+ L  FL  EK  GK I+P G+  F A  +TP   V+VVIL
Sbjct: 17  RLRPEWLEALGDTLSGPKMQGLARFLRDEKALGKVIYPPGAEIFSALQLTPPEAVRVVIL 76

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSVP G+ IPPSL N++KELQ D+    P+HG L HW  +GVLLL
Sbjct: 77  GQDPYHGPGQAHGLSFSVPRGVGIPPSLRNIFKELQRDLKLDKPSHGCLSHWAEQGVLLL 136

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NA LTVE GRA SH+  GWE FTD VI  + +  + IVFMLWGA A+K   VL+   H +
Sbjct: 137 NASLTVESGRAGSHQNLGWEVFTDRVIATVRDIGKPIVFMLWGAQARKTVGVLEGFDHCI 196

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L A HPSPLSA  GF GC HFS+AN +L   G+  ++W +P
Sbjct: 197 LTAPHPSPLSAHRGFLGCGHFSQANAFLDRCGRGAIDWSLP 237


>gi|312129348|ref|YP_003996688.1| uracil-DNA glycosylase [Leadbetterella byssophila DSM 17132]
 gi|311905894|gb|ADQ16335.1| Uracil-DNA glycosylase [Leadbetterella byssophila DSM 17132]
          Length = 219

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 153/221 (69%), Gaps = 4/221 (1%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRI-FPRGSHYFRAFDITPFNKVKVV 62
           +KIHESWK +L   F+  +   LKE++  E   G ++ +P G   F AF+ TPF +VKVV
Sbjct: 1   MKIHESWKEVLAEEFEKPYFERLKEYVRQEY--GTQVCYPPGRLIFEAFNQTPFEEVKVV 58

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQAHGL FSVP G+  PPSL N++KEL++DV    P  G L  W  +GVL
Sbjct: 59  ILGQDPYHGPGQAHGLSFSVPPGVAFPPSLRNIFKELKDDVGKEVPMSGDLTEWARQGVL 118

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNA L+V  G+A SH+ +GWE FTD+VI L++   +N+VF+LWGA AQ K   +D  RH
Sbjct: 119 LLNATLSVRAGQAGSHQNQGWETFTDAVIHLLNQRKENLVFLLWGAYAQNKGKFIDPNRH 178

Query: 183 LVLKAAHPSPLSA-SHGFFGCRHFSKANRYLQEHGKTTVNW 222
           LVLKA HPSPLSA S G+FG +HFSK N YLQ+ GK  + W
Sbjct: 179 LVLKAKHPSPLSANSGGWFGTKHFSKTNEYLQQLGKPEIKW 219


>gi|157963130|ref|YP_001503164.1| uracil-DNA glycosylase [Shewanella pealeana ATCC 700345]
 gi|157848130|gb|ABV88629.1| uracil-DNA glycosylase [Shewanella pealeana ATCC 700345]
          Length = 222

 Score =  240 bits (613), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 7   HESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQ 66
           H SW S +    Q ++ ++L+ F+ +E+  GK I+P  S    AFD TP +KV+VV++GQ
Sbjct: 4   HSSWSSFINEQQQQDYFQSLQLFVEAERAAGKVIYPPESEVLAAFDSTPLDKVRVVLIGQ 63

Query: 67  DPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLN 125
           DPYH  GQAHGLCFSV  G++ PPSLVN+YKEL  D++ F  P HG L HW  +G+L+LN
Sbjct: 64  DPYHGPGQAHGLCFSVKHGVKTPPSLVNMYKELATDIDGFSIPEHGNLSHWAEQGILMLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE+G+A SH   GWE FT + ++L++   Q I+F+LWGA A KK  V++  +H V+
Sbjct: 124 TVLTVEQGKAHSHAKSGWETFTANALELLNQQAQPIIFVLWGAHAIKKGKVINAPQHQVI 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
              HPSPLSA  GFFGC+HFSK N  LQ  G+  ++WQ+
Sbjct: 184 SGPHPSPLSAYRGFFGCQHFSKINAILQARGEVPIDWQV 222


>gi|15642356|ref|NP_231989.1| uracil-DNA glycosylase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121727502|ref|ZP_01680620.1| uracil-DNA glycosylase [Vibrio cholerae V52]
 gi|147675455|ref|YP_001217862.1| uracil-DNA glycosylase [Vibrio cholerae O395]
 gi|153803105|ref|ZP_01957691.1| uracil-DNA glycosylase [Vibrio cholerae MZO-3]
 gi|153820188|ref|ZP_01972855.1| uracil-DNA glycosylase [Vibrio cholerae NCTC 8457]
 gi|153824166|ref|ZP_01976833.1| uracil-DNA glycosylase [Vibrio cholerae B33]
 gi|153825906|ref|ZP_01978573.1| uracil-DNA glycosylase [Vibrio cholerae MZO-2]
 gi|153828820|ref|ZP_01981487.1| uracil-DNA glycosylase [Vibrio cholerae 623-39]
 gi|227082483|ref|YP_002811034.1| uracil-DNA glycosylase [Vibrio cholerae M66-2]
 gi|229507575|ref|ZP_04397080.1| uracil-DNA glycosylase [Vibrio cholerae BX 330286]
 gi|229512229|ref|ZP_04401708.1| uracil-DNA glycosylase [Vibrio cholerae B33]
 gi|229513994|ref|ZP_04403456.1| uracil-DNA glycosylase [Vibrio cholerae TMA 21]
 gi|229519365|ref|ZP_04408808.1| uracil-DNA glycosylase [Vibrio cholerae RC9]
 gi|229607081|ref|YP_002877729.1| uracil-DNA glycosylase [Vibrio cholerae MJ-1236]
 gi|254226166|ref|ZP_04919762.1| uracil-DNA glycosylase [Vibrio cholerae V51]
 gi|254849481|ref|ZP_05238831.1| uracil-DNA glycosylase [Vibrio cholerae MO10]
 gi|255746961|ref|ZP_05420906.1| uracil-DNA glycosylase [Vibrio cholera CIRS 101]
 gi|262161495|ref|ZP_06030605.1| uracil-DNA glycosylase [Vibrio cholerae INDRE 91/1]
 gi|262168347|ref|ZP_06036044.1| uracil-DNA glycosylase [Vibrio cholerae RC27]
 gi|298500279|ref|ZP_07010084.1| uracil-DNA glycosylase [Vibrio cholerae MAK 757]
 gi|25009539|sp|Q9KPK8|UNG_VIBCH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|172047592|sp|A5F5R5|UNG_VIBC3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|254790592|sp|C3LQD1|UNG_VIBCM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|189339500|pdb|2JHQ|A Chain A, Crystal Structure Of Uracil Dna-Glycosylase From Vibrio
           Cholerae
 gi|9656928|gb|AAF95502.1| uracil-DNA glycosylase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121630170|gb|EAX62572.1| uracil-DNA glycosylase [Vibrio cholerae V52]
 gi|124121356|gb|EAY40099.1| uracil-DNA glycosylase [Vibrio cholerae MZO-3]
 gi|125621334|gb|EAZ49672.1| uracil-DNA glycosylase [Vibrio cholerae V51]
 gi|126509272|gb|EAZ71866.1| uracil-DNA glycosylase [Vibrio cholerae NCTC 8457]
 gi|126518311|gb|EAZ75536.1| uracil-DNA glycosylase [Vibrio cholerae B33]
 gi|146317338|gb|ABQ21877.1| uracil-DNA glycosylase [Vibrio cholerae O395]
 gi|148875696|gb|EDL73831.1| uracil-DNA glycosylase [Vibrio cholerae 623-39]
 gi|149740404|gb|EDM54535.1| uracil-DNA glycosylase [Vibrio cholerae MZO-2]
 gi|227010371|gb|ACP06583.1| uracil-DNA glycosylase [Vibrio cholerae M66-2]
 gi|227014254|gb|ACP10464.1| uracil-DNA glycosylase [Vibrio cholerae O395]
 gi|229344054|gb|EEO09029.1| uracil-DNA glycosylase [Vibrio cholerae RC9]
 gi|229349175|gb|EEO14132.1| uracil-DNA glycosylase [Vibrio cholerae TMA 21]
 gi|229352194|gb|EEO17135.1| uracil-DNA glycosylase [Vibrio cholerae B33]
 gi|229355080|gb|EEO20001.1| uracil-DNA glycosylase [Vibrio cholerae BX 330286]
 gi|229369736|gb|ACQ60159.1| uracil-DNA glycosylase [Vibrio cholerae MJ-1236]
 gi|254845186|gb|EET23600.1| uracil-DNA glycosylase [Vibrio cholerae MO10]
 gi|255735363|gb|EET90763.1| uracil-DNA glycosylase [Vibrio cholera CIRS 101]
 gi|262023239|gb|EEY41943.1| uracil-DNA glycosylase [Vibrio cholerae RC27]
 gi|262028806|gb|EEY47460.1| uracil-DNA glycosylase [Vibrio cholerae INDRE 91/1]
 gi|297540972|gb|EFH77026.1| uracil-DNA glycosylase [Vibrio cholerae MAK 757]
          Length = 226

 Score =  240 bits (613), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q  + +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   ++F+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFSK N+ LQ  G   +NWQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSKTNQLLQAQGIAPINWQ 221


>gi|260773464|ref|ZP_05882380.1| uracil-DNA glycosylase [Vibrio metschnikovii CIP 69.14]
 gi|260612603|gb|EEX37806.1| uracil-DNA glycosylase [Vibrio metschnikovii CIP 69.14]
          Length = 226

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ +  Q  + +N   F+  E+R GK I+P  +  F AF +T F+ VKVVILGQDP
Sbjct: 6   TWHEVIGHEKQQGYFKNTLAFVEQERRSGKVIYPPAAEVFNAFRLTEFHDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV   ++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPQVKTPPSLVNIYKELAQDIRGFSIPNHGYLKSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ ++ + Q IVF+LWGA AQKK  ++D +RH VL+A
Sbjct: 126 LTVEQGKAHSHANSGWETFTDRVIEALNQHGQGIVFLLWGAHAQKKGKMIDRQRHHVLEA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC+HFS  N+ L++ GK  ++WQ  L 
Sbjct: 186 PHPSPLSAHRGFLGCKHFSMTNQLLEQQGKQAIDWQPKLD 225


>gi|330828710|ref|YP_004391662.1| Uracil-DNA glycosylase [Aeromonas veronii B565]
 gi|328803846|gb|AEB49045.1| Uracil-DNA glycosylase [Aeromonas veronii B565]
          Length = 225

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/223 (51%), Positives = 153/223 (68%), Gaps = 4/223 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ +  + ++ ++    + +E+  GK I+P  +  F AF +T  ++VKVVILGQDP
Sbjct: 3   TWSDVIGSEKEQDYFKSTLATVRAEREAGKVIYPPATDVFNAFKLTELDQVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G+R PPSLVN+YKE+Q D+  F+ P HGFLE W  +GVLLLN V
Sbjct: 63  YHGPNQAHGLCFSVLPGVRTPPSLVNIYKEMQRDLPGFVTPNHGFLESWAKQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV+ G+A SH   GWE FTD VI+ I+ + Q +VF+LWGA AQKK   +D +RH VL A
Sbjct: 123 LTVQAGQAHSHAHLGWETFTDRVIEQINASCQGVVFLLWGAHAQKKGRFIDRQRHYVLTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ---IPLS 227
            HPSPLSA  GF GC HFS+ NR L++ GK+ + W+   IPL 
Sbjct: 183 PHPSPLSAHRGFIGCGHFSETNRLLEQQGKSPIEWKSVCIPLD 225


>gi|91226795|ref|ZP_01261448.1| uracil-DNA glycosylase [Vibrio alginolyticus 12G01]
 gi|91188926|gb|EAS75210.1| uracil-DNA glycosylase [Vibrio alginolyticus 12G01]
          Length = 226

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E+  GK IFP     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGEEKKQSYFVDTLSFVEAERAAGKAIFPPAKDVFNAFRFTEFKDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + + +VF+LWGA AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGAHAQKKGRFIDRNKHHVLAA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFGC+HFS+AN+ L    K  +NW +PL+
Sbjct: 186 PHPSPLSAHRGFFGCKHFSQANQLLTSQEKAPINWHLPLT 225


>gi|291518147|emb|CBK73368.1| Uracil-DNA glycosylase [Butyrivibrio fibrisolvens 16/4]
          Length = 224

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L   F+  + +NL E + SE     +++P     F AFD TP ++VKVVI+G
Sbjct: 4   ISNDWLEPLTPEFKKPYYKNLYESVKSEYH-SHQVYPPADDIFNAFDFTPLSQVKVVIIG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV  G++ PPSLVN+YKELQ+D+    P +G+LE W  +GVL+LN
Sbjct: 63  QDPYHEPGQAHGLCFSVKPGVKTPPSLVNIYKELQDDLGCYIPNNGYLEKWARQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SH+  GWEQFTD+VID+++   + IVF+LWG+ A KK   L++  HL+L
Sbjct: 123 NVLTVRAHEANSHKDLGWEQFTDAVIDILNKQDRPIVFLLWGSPAAKKCAKLNNPNHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLSA  GFFGC+HFS+ N +L+  G   ++WQI
Sbjct: 183 KAPHPSPLSAYRGFFGCKHFSRTNAFLKSKGLNPIDWQI 221


>gi|310658390|ref|YP_003936111.1| uracil-DNA-glycosylase [Clostridium sticklandii DSM 519]
 gi|308825168|emb|CBH21206.1| uracil-DNA-glycosylase [Clostridium sticklandii]
          Length = 221

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 151/221 (68%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +  + +W  +L++ F  ++   L+EFL+ E  K   I+P     F A  +T +  VK+VI
Sbjct: 2   ISFNNNWDDILKDEFDKQYYLELREFLIKE-YKSHLIYPDKYKIFEALKLTDYEDVKIVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV +G+ IPPSL+N+YKEL+ D+NF  P HG+L  W  +GVLL
Sbjct: 61  LGQDPYHGPNQAHGLAFSVSIGVPIPPSLLNIYKELERDINFRIPNHGYLVDWSKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV  G A SHRG+GWE FTD VI L+S   + +VF+LWG +A +K+ ++D  +HL
Sbjct: 121 LNTALTVRAGMANSHRGKGWEVFTDQVIRLLSLREKPMVFLLWGKNAAEKEALIDTSKHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VLKA HPSPLSA  GF GC HFSKAN++L ++    +NWQ+
Sbjct: 181 VLKAPHPSPLSAHRGFLGCGHFSKANKFLIKNSIAPINWQL 221


>gi|255034013|ref|YP_003084634.1| uracil-DNA glycosylase [Dyadobacter fermentans DSM 18053]
 gi|254946769|gb|ACT91469.1| uracil-DNA glycosylase [Dyadobacter fermentans DSM 18053]
          Length = 221

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 152/220 (69%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SWK  L   F+  +  +L  F+  E+ + K+IFP     F AF+   F++ KVVI
Sbjct: 3   VKIEQSWKERLAPEFEKPYFASLTAFV-REEYQTKQIFPPAKQIFNAFNYCSFDECKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+R+PPSL+N++KE+Q+D+    P  G LE W  +GVLL
Sbjct: 62  LGQDPYHGPGQAHGLCFSVNDGVRMPPSLINIFKEIQQDLGKPFPPSGNLERWAKQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV+   A SH+G+GWE+FTD+VI  +S+   N+VFMLWG  AQ+K  V+   +H 
Sbjct: 122 LNATLTVQAATAGSHQGKGWERFTDAVIKCVSDEKSNVVFMLWGRYAQEKGAVIAASKHF 181

Query: 184 VLKAAHPSPLSAS-HGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLKA HPSP+SA+  G+FG +HFSKAN YL+  G   +NW
Sbjct: 182 VLKAKHPSPMSANGGGWFGTKHFSKANEYLESKGLEPINW 221


>gi|116492271|ref|YP_804006.1| uracil-DNA glycosylase [Pediococcus pentosaceus ATCC 25745]
 gi|122266265|sp|Q03GV8|UNG_PEDPA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|116102421|gb|ABJ67564.1| Uracil-DNA glycosylase [Pediococcus pentosaceus ATCC 25745]
          Length = 230

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +L+  F+  +   L EFL  E    + I P   H F+AF+ TPF+KVKVVILG
Sbjct: 5   IHNDWQDVLQGEFEQAYYAKLHEFLKHE-YATQNIHPDMYHIFQAFEWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGQNQAHGLSFSVQPGVQVPPSLQNIYKELQSDLGIAPVQHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV +G+A SH+G GWE+ TD+ I  +S   Q +VF+LWG +A+ K  ++D  R++++
Sbjct: 124 SVLTVRDGQAYSHQGHGWERLTDTAIQALSEREQPVVFILWGKAARDKIKLIDQSRNIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG + FSK N  L+  G+T ++WQ+P
Sbjct: 184 QSAHPSPLSAYRGFFGSKPFSKTNEALEAMGETPIDWQLP 223


>gi|262278919|ref|ZP_06056704.1| uracil-DNA glycosylase [Acinetobacter calcoaceticus RUH2202]
 gi|262259270|gb|EEY78003.1| uracil-DNA glycosylase [Acinetobacter calcoaceticus RUH2202]
          Length = 237

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 153/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M NL++FL  EK+  K I+P     F A + TP   VK
Sbjct: 11  LSKVQLEESWKISLAPFLLSPQMDNLRDFLFQEKQAQKIIYPPSKQIFSALNTTPLADVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  GI +PPSL N++ EL  D+    P HG L  W ++G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQKGIALPPSLRNIFHELHTDLGIPAPRHGDLTKWANQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   +++VF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEAFTDEVIDVLNEQREHVVFILWGAYAQRKGQRINRD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RHLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 RHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|254514101|ref|ZP_05126162.1| uracil-DNA glycosylase [gamma proteobacterium NOR5-3]
 gi|219676344|gb|EED32709.1| uracil-DNA glycosylase [gamma proteobacterium NOR5-3]
          Length = 241

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 141/219 (64%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + + W  LL     S  M++L  FL   +  G  ++P     F AF  TP   V+ VILG
Sbjct: 17  LQKDWADLLGAELDSSSMQSLAAFLTERRGSGADVYPPADQVFAAFAQTPLQTVRAVILG 76

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGL FSV  G  +PPSL N+++EL  D+    P HG L  W  +GVLLLN
Sbjct: 77  QDPYHNEGQAHGLSFSVNRGTPVPPSLANIFRELHADLGLDIPPHGNLGAWARQGVLLLN 136

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE+ +  +H+G+GWEQFTD+VI L+S   Q +VFMLWGA AQKK   +D  +H VL
Sbjct: 137 TVLTVEKNQPGAHQGKGWEQFTDAVIRLLSQREQPLVFMLWGAQAQKKGQAIDAGKHCVL 196

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            ++HPSPLSA  GF GCRHFS+AN +L+  G   ++W +
Sbjct: 197 TSSHPSPLSAHRGFLGCRHFSRANAFLKSRGLVPIDWSL 235


>gi|166032810|ref|ZP_02235639.1| hypothetical protein DORFOR_02525 [Dorea formicigenerans ATCC
           27755]
 gi|166027167|gb|EDR45924.1| hypothetical protein DORFOR_02525 [Dorea formicigenerans ATCC
           27755]
          Length = 222

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 153/219 (69%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L+  F+  + + L E  ++E+ + ++IFP     F AF +TP +KVKVVILG
Sbjct: 4   INNDWLEALQGEFKKPYYKKLFE-TVNEEYRTRQIFPPADDIFNAFHLTPLHKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ IPPSLVN+YKEL +D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNVGQAHGLCFSVKKGVDIPPSLVNIYKELHDDLGCTIPNHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  +++ ++ IVF+LWGA AQ+K  +L++  HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMALNSQNRPIVFILWGAPAQRKASMLNNPNHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLSA  GFFG + FSK N++L+  G   ++WQI
Sbjct: 183 KAPHPSPLSAYRGFFGSKPFSKTNKFLEAGGVEPIDWQI 221


>gi|325297224|ref|YP_004257141.1| Uracil-DNA glycosylase [Bacteroides salanitronis DSM 18170]
 gi|324316777|gb|ADY34668.1| Uracil-DNA glycosylase [Bacteroides salanitronis DSM 18170]
          Length = 220

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK +L   F+ ++   L +F+  E      ++P G   F AF++ P+NKVK VI
Sbjct: 3   VQIEESWKQVLAPEFEKDYFVRLTDFVRQEYHN-TTVYPPGKLIFNAFNLCPYNKVKAVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+ +D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIHDDLGTPIPASGNLTRWAQQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+ I  ++ N +++VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNKGWEEFTDAAIRALATNREHLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA HGFFG RHFS+ N YL +HG+T +NW
Sbjct: 182 VLTSVHPSPLSAYHGFFGNRHFSRTNEYLMQHGETPINW 220


>gi|313900062|ref|ZP_07833562.1| uracil-DNA glycosylase [Clostridium sp. HGF2]
 gi|312955114|gb|EFR36782.1| uracil-DNA glycosylase [Clostridium sp. HGF2]
          Length = 222

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 148/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I   W  LL++ FQ E+ + L+ FL  E  K + I+P     F A   T +  VKVVI
Sbjct: 2   VQIGNDWDELLKDEFQKEYYQKLRVFLARE-YKTQTIYPGMYDIFNALRYTAYQDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN+Y+EL +D+    P HG L  W  EGVLL
Sbjct: 61  LGQDPYHGPGQAHGLCFSVKKGVNPPPSLVNIYQELHDDLGCSIPPHGELTKWTKEGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  TD +I  ++   + IVF+LWG +A++K  ++ +  HL
Sbjct: 121 LNTVLTVRRGQANSHRGKGWEILTDEIIRKLNEREKPIVFLLWGRNAKEKSTLITNPAHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L   HPSP SA +GFFGCRHFSK N +LQEHG+  ++WQI
Sbjct: 181 ILSCPHPSPFSADYGFFGCRHFSKTNAFLQEHGQQPIDWQI 221


>gi|254302923|ref|ZP_04970281.1| uracil-DNA glycosylase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148323115|gb|EDK88365.1| uracil-DNA glycosylase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 226

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE +L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFKKEYFLKLKE-ILEEEYKNYTVYPPKKDILNAFLLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKELQ+D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQRGQAHGLAFSVNYGIKTPPSLVNMYKELQDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD++I  ++   + ++F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSEANSHSKIGWQTFTDNIIKKLNEREKPVIFILWGNNAKAKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ NR L++  +  ++WQI
Sbjct: 182 LKGVHPSPLSANKGFFGCKHFSEVNRILKDLNQKEIDWQI 221


>gi|325122020|gb|ADY81543.1| uracil-DNA glycosylase [Acinetobacter calcoaceticus PHEA-2]
          Length = 237

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 153/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M +L++FL  +K+  K I+P     F A + TP   VK
Sbjct: 11  LSKVQLEESWKRSLAPFLLSPQMDSLRDFLFQQKQAQKIIYPPSKQIFNALNTTPLADVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  GI +PPSL N++ EL  D+  + P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQKGIALPPSLRNIFHELHTDLGILAPRHGDLTKWAKQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   Q+IVF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEAFTDEVIDVLNEQRQHIVFILWGAYAQRKGQRINRD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|148981666|ref|ZP_01816489.1| uracil-DNA glycosylase [Vibrionales bacterium SWAT-3]
 gi|145960789|gb|EDK26125.1| uracil-DNA glycosylase [Vibrionales bacterium SWAT-3]
          Length = 226

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+S++ +  + E+ +++  F+  ++  GK I+P     F AFD+TPF  V+VVILGQD
Sbjct: 5   KTWESIINDEREKEYFQSVLAFVEQQRNSGKTIYPPQEQVFSAFDMTPFESVRVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++IPPSL N+YKEL +D+  F  P HG+LE W  +GVL+LN 
Sbjct: 65  PYHGANQAHGLAFSVLPGVKIPPSLRNMYKELAQDIEGFEAPNHGYLEAWASQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEE +A SH   GWE FTD++I  ++   + I+F+LWGA AQKK   +D ++H VL 
Sbjct: 125 VLTVEEAQAHSHAKCGWETFTDAIIAELNQRSEPIIFLLWGAHAQKKGQAIDTQKHHVLA 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPLSA  GFFGC+HFS AN+ L    +  ++W++P
Sbjct: 185 APHPSPLSARRGFFGCQHFSTANKLLSSMDQQPIDWRLP 223


>gi|118602679|ref|YP_903894.1| uracil-DNA glycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567618|gb|ABL02423.1| Uracil-DNA glycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 219

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 149/216 (68%), Gaps = 4/216 (1%)

Query: 7   HESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQ 66
           H S K+LLE    ++ M +LK FL  +K+  K I P   ++F+AF++T F KVK++ILGQ
Sbjct: 7   HPSIKTLLE----TQSMIDLKRFLQQQKQAKKVILPYSKNWFKAFELTAFYKVKIIILGQ 62

Query: 67  DPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNA 126
           DPYH   QAHGL FSV  G++ PPSL N++KEL  D+N  P     L HW  +GVLLLN+
Sbjct: 63  DPYHGLEQAHGLSFSVVQGVKKPPSLDNIFKELYSDLNIEPNQSSDLTHWATQGVLLLNS 122

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE  +AASH  +GWE FTDS+I  +S   Q++VF+LWGA AQKK   +D  +HL+L 
Sbjct: 123 VLTVEAHKAASHANQGWEVFTDSIIKTLSEERQHLVFILWGAYAQKKAIFIDKDKHLILT 182

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
             HPSPLSA  GF GCRHFSKAN YL+ H +  ++W
Sbjct: 183 TTHPSPLSAYRGFLGCRHFSKANDYLKMHNQQVISW 218


>gi|262067013|ref|ZP_06026625.1| uracil-DNA glycosylase [Fusobacterium periodonticum ATCC 33693]
 gi|291379273|gb|EFE86791.1| uracil-DNA glycosylase [Fusobacterium periodonticum ATCC 33693]
          Length = 225

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 150/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE L +E  K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKDILEEEFEKEYFVKLKEILENE-YKNYTVYPPKKDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKELQ+D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQSGQAHGLAFSVNYGIKTPPSLVNMYKELQDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD++I  ++   + ++F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSEANSHSKIGWQTFTDNIIKKLNEREKPVIFILWGNNAKAKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ NR L+E  +  ++WQI
Sbjct: 182 LKGVHPSPLSANRGFFGCKHFSEVNRILKELNEKEIDWQI 221


>gi|253578130|ref|ZP_04855402.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850448|gb|EES78406.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 224

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  F   +   L + +++E +  ++IFP     F AF  TP N+VKVVILG
Sbjct: 4   ISGDWLEALKGEFHQPYYAKLYKTVMTEYQT-RKIFPPADDLFNAFHFTPLNEVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+  PPSLVN+Y+EL +D     P +G+LE W  +GVLLLN
Sbjct: 63  QDPYHNDGQAHGLCFSVKRGVETPPSLVNIYQELHDDCGCYIPNNGYLEKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWEQFTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEQFTDAAIQVLNEQDRPIVFLLWGRPAQMKKSMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFGC+HFSK N +L  +G   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGCKHFSKTNEFLVANGLEPIDWQI 221


>gi|325279916|ref|YP_004252458.1| Uracil-DNA glycosylase [Odoribacter splanchnicus DSM 20712]
 gi|324311725|gb|ADY32278.1| Uracil-DNA glycosylase [Odoribacter splanchnicus DSM 20712]
          Length = 220

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESW+  L+  F   +  +L  F+  E  +   +FP GS  F A++  PF KVKVVI
Sbjct: 3   VQIEESWRRQLQEEFDKPYFEHLVGFVKEEYAR-YTVFPPGSRIFHAYNTCPFEKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQ +GLCFSV  G+  PPSLVN++KE+Q D+    P  G LE W  +GVLL
Sbjct: 62  LGQDPYHEPGQYYGLCFSVMDGVPFPPSLVNIFKEIQNDLGKPIPCSGRLERWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +NA+LTV   +A SH+G+GWE+FTD+VI  +++  ++IVFMLWGA AQKK   +D  RH 
Sbjct: 122 INAILTVRAHQAGSHQGKGWEEFTDAVIRRLNDEREHIVFMLWGAYAQKKGVFIDRTRHC 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL A HPSPLSA  GFFGC+HFSKAN Y +  G   + W
Sbjct: 182 VLTAPHPSPLSADRGFFGCKHFSKANAYFRSKGLAEIEW 220


>gi|229521194|ref|ZP_04410614.1| uracil-DNA glycosylase [Vibrio cholerae TM 11079-80]
 gi|254285981|ref|ZP_04960942.1| uracil-DNA glycosylase [Vibrio cholerae AM-19226]
 gi|262192274|ref|ZP_06050430.1| uracil-DNA glycosylase [Vibrio cholerae CT 5369-93]
 gi|297580989|ref|ZP_06942914.1| uracil-DNA glycosylase [Vibrio cholerae RC385]
 gi|150423891|gb|EDN15831.1| uracil-DNA glycosylase [Vibrio cholerae AM-19226]
 gi|229341726|gb|EEO06728.1| uracil-DNA glycosylase [Vibrio cholerae TM 11079-80]
 gi|262031824|gb|EEY50406.1| uracil-DNA glycosylase [Vibrio cholerae CT 5369-93]
 gi|297534815|gb|EFH73651.1| uracil-DNA glycosylase [Vibrio cholerae RC385]
 gi|327484861|gb|AEA79268.1| Uracil-DNA glycosylase, family 1 [Vibrio cholerae LMA3894-4]
          Length = 226

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q  + +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   ++F+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFSK N+ LQ  G   +NWQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSKTNQLLQAQGIAPINWQ 221


>gi|28897274|ref|NP_796879.1| uracil-DNA glycosylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153846023|ref|ZP_01993822.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AQ3810]
 gi|260363602|ref|ZP_05776415.1| uracil-DNA glycosylase [Vibrio parahaemolyticus K5030]
 gi|260876239|ref|ZP_05888594.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AN-5034]
 gi|260896291|ref|ZP_05904787.1| uracil-DNA glycosylase [Vibrio parahaemolyticus Peru-466]
 gi|31077040|sp|Q87SC4|UNG_VIBPA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|28805483|dbj|BAC58763.1| uracil-DNA glycosylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149745004|gb|EDM56312.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AQ3810]
 gi|165994441|dbj|BAF99665.1| uracil DNA glycosylase [Vibrio parahaemolyticus]
 gi|165994453|dbj|BAF99674.1| uracil DNA glycosylase [Vibrio parahaemolyticus]
 gi|308085342|gb|EFO35037.1| uracil-DNA glycosylase [Vibrio parahaemolyticus Peru-466]
 gi|308092868|gb|EFO42563.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AN-5034]
 gi|308112537|gb|EFO50077.1| uracil-DNA glycosylase [Vibrio parahaemolyticus K5030]
 gi|328472038|gb|EGF42915.1| uracil-DNA glycosylase [Vibrio parahaemolyticus 10329]
          Length = 226

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E+  GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 6   TWHDVIGEEKKQSYFVDTLNFVEAERAAGKAIYPPAKDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ +   +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQHGVVFLLWGSHAQKKGRFIDRSKHHVLAA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC+HFS+AN+ L   GK  +NW +PL+
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLASQGKEPINWHLPLT 225


>gi|117617799|ref|YP_857642.1| uracil-DNA glycosylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|171460766|sp|A0KMZ1|UNG_AERHH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|117559206|gb|ABK36154.1| uracil-DNA glycosylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 222

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 149/216 (68%), Gaps = 1/216 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  ++ +  + ++ +     + SE+  GK I+P  +  F AF +T  ++VKVVILGQD
Sbjct: 2   QTWTDVIGSEKEQDYFKATLATVRSEREAGKVIYPPATDVFNAFKLTELDQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGLCFSV  G+R PPSLVN+YKE+Q D+  F+ P+HGFLE W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLCFSVLPGVRTPPSLVNIYKEMQRDLPGFVTPSHGFLESWAKQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV+ G+A SH   GWE FTD VI+ I+ + Q +VF+LWGA AQKK   +D +RH VL 
Sbjct: 122 VLTVQAGQAHSHAHLGWETFTDRVIEQINASCQGVVFLLWGAHAQKKGRFIDRQRHHVLS 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           A HPSPLSA  GF GC HFS+ NR L + G + +NW
Sbjct: 182 APHPSPLSAHRGFIGCGHFSETNRLLSQQGMSPINW 217


>gi|225572444|ref|ZP_03781308.1| hypothetical protein RUMHYD_00741 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040081|gb|EEG50327.1| hypothetical protein RUMHYD_00741 [Blautia hydrogenotrophica DSM
           10507]
          Length = 235

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 150/216 (69%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W   L+  F+  +   L + +L E+ + ++IFP     F AF  TP N+VKVVILGQDP
Sbjct: 7   EWLEALKGEFRKPYYAKLYKKVL-EEYQTRKIFPPAQEMFNAFHFTPLNEVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YHN GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+LE W  +GVLLLN VL
Sbjct: 66  YHNDGQAHGLCFSVKKDVEIPPSLVNIYQELHDDLGCYFPNNGYLEKWARQGVLLLNTVL 125

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV   +A SHRG GWE+FTD+ I ++    + IVF+LWG  AQ K+ +L + +HL+L+A 
Sbjct: 126 TVRAHQANSHRGIGWEEFTDAAIQVLDQQDRPIVFLLWGKPAQMKKSMLHNPKHLILEAP 185

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGCRHFS+ N +L+ +G T ++WQI
Sbjct: 186 HPSPLSAYRGFFGCRHFSQTNEFLRANGLTPIDWQI 221


>gi|167854852|ref|ZP_02477629.1| uracil-DNA glycosylase [Haemophilus parasuis 29755]
 gi|219871448|ref|YP_002475823.1| uracil-DNA glycosylase [Haemophilus parasuis SH0165]
 gi|254790580|sp|B8F6C3|UNG_HAEPS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|167854031|gb|EDS25268.1| uracil-DNA glycosylase [Haemophilus parasuis 29755]
 gi|219691652|gb|ACL32875.1| uracil-DNA glycosylase [Haemophilus parasuis SH0165]
          Length = 220

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/218 (53%), Positives = 147/218 (67%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW   +       + +++ +++  E+  GK I+P  +  F AF +T F  VKVVILGQDP
Sbjct: 3   SWTDAIGEEKTQPYFQHILQYVHQERLVGKVIYPPQNEVFSAFALTEFKDVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH   QAHGL FSV  GI  PPSLVN+YKEL +DV F  P+HG+L  W  +GVLLLN VL
Sbjct: 63  YHGPNQAHGLSFSVKPGIVPPPSLVNMYKELSQDVGFQIPSHGYLIEWAKQGVLLLNTVL 122

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE+G+A SH   GWE FTD VI  ++ + +N+VF+LWG+ AQKK   +D  RH VL A 
Sbjct: 123 TVEQGKAHSHANIGWETFTDKVIHQLNLHRENLVFLLWGSHAQKKGQFIDRSRHCVLTAP 182

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           HPSPLSA  GF GCRHFSK N YL+ HG   +NWQ+PL
Sbjct: 183 HPSPLSAHRGFLGCRHFSKTNDYLRSHGVEEINWQLPL 220


>gi|229524351|ref|ZP_04413756.1| uracil-DNA glycosylase [Vibrio cholerae bv. albensis VL426]
 gi|229337932|gb|EEO02949.1| uracil-DNA glycosylase [Vibrio cholerae bv. albensis VL426]
          Length = 226

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q  + +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   ++F+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFSK N+ LQ  G   +NWQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSKTNQLLQAQGIVPINWQ 221


>gi|229828801|ref|ZP_04454870.1| hypothetical protein GCWU000342_00883 [Shuttleworthia satelles DSM
           14600]
 gi|229791964|gb|EEP28078.1| hypothetical protein GCWU000342_00883 [Shuttleworthia satelles DSM
           14600]
          Length = 224

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   LE  F  ++ R L    + E+     I+P     F AF +TP +KVKVVILG
Sbjct: 4   IENDWLPALEPEFHKDYYRKLY-LRMKEEYHSYVIYPPSEEIFNAFHLTPLSKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQA GLCFSV  G+RIPPSL N+Y+EL  D+    P HG L  W  +GVLLLN
Sbjct: 63  QDPYHEPGQAQGLCFSVRKGVRIPPSLANIYQELNRDLGCYIPNHGSLVKWAEQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VL V   +A S RG GWE+FTD+ I +++  +Q IVFMLWG+SAQ K  +LDH  HL+L
Sbjct: 123 TVLAVRAHQANSLRGIGWEEFTDAAIRVLNERNQPIVFMLWGSSAQAKAAMLDHPGHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLSA  GFFGC HFSK N YL+E G   ++WQI
Sbjct: 183 KAPHPSPLSAYRGFFGCGHFSKCNEYLKEQGLEPIDWQI 221


>gi|269964511|ref|ZP_06178751.1| uracil-DNA glycosylase [Vibrio alginolyticus 40B]
 gi|269830748|gb|EEZ84967.1| uracil-DNA glycosylase [Vibrio alginolyticus 40B]
          Length = 226

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E+  GK IFP     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGEEKKQSYFVDTLNFVEAERAAGKAIFPPAKDVFNAFRFTEFKDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + + +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGSHAQKKGRFIDRNKHHVLAA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFGC+HFS+AN+ L    K  +NW +PL+
Sbjct: 186 PHPSPLSAHRGFFGCKHFSQANQLLTSQEKAPINWHLPLT 225


>gi|294085618|ref|YP_003552378.1| uracil-DNA glycosylase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665193|gb|ADE40294.1| uracil-DNA glycosylase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 225

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 146/217 (67%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I +SW   L     S+ M  L  FL +E+  G  I+P     F AFD+TPF+ VKVVI+G
Sbjct: 3   IEQSWHHHLGAVMNSKEMTQLFRFLDTERANGISIYPPPESVFMAFDLTPFDAVKVVIIG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSVP G++ PPSL N++KEL  D+    P HG LE W  +GVLLLN
Sbjct: 63  QDPYHGPRQAHGLSFSVPQGVKTPPSLRNIFKELVSDIGCPTPLHGNLESWAQQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
             LTVE+G+A SH G+GWE FTD+ I  +++  +++VF+LWG  A +K   +D  RHL+L
Sbjct: 123 NCLTVEDGKAGSHHGKGWEAFTDAAISQLADIREHLVFILWGRKAAEKGRTIDANRHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            AAHPSPLSA +GFFG R FS+ N YL+  G+T +NW
Sbjct: 183 TAAHPSPLSAYNGFFGSRPFSRTNSYLEAQGQTAINW 219


>gi|326801396|ref|YP_004319215.1| uracil-DNA glycosylase [Sphingobacterium sp. 21]
 gi|326552160|gb|ADZ80545.1| Uracil-DNA glycosylase [Sphingobacterium sp. 21]
          Length = 223

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 154/223 (69%), Gaps = 2/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
            + + +SWK +LE  F   +M  L+ FL +E+ +  ++FP     F AF+ TPF +VK V
Sbjct: 2   SIALEKSWKEILEPEFSKTYMSELRNFLRTEQAQ-YQVFPPNKLIFNAFEHTPFYEVKAV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGV 121
           ILGQDPYHN GQAHGL FSV  GI IPPSL N+Y EL  D+  F  P HG L  W  +GV
Sbjct: 61  ILGQDPYHNIGQAHGLSFSVQPGIAIPPSLRNMYIELSNDIPGFKIPNHGTLTKWADQGV 120

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLNAVLTV    AASH+ +GWE FTD+VI  ++   + IVF+LWG  A++K  ++D  +
Sbjct: 121 LLLNAVLTVRAHMAASHQKKGWEVFTDTVIKELAQRREGIVFILWGNYAKQKVKLIDSSK 180

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HL++ +AHPSPLSA +GFFG + FSK N YL++HGKT ++WQ+
Sbjct: 181 HLIITSAHPSPLSAHNGFFGSKPFSKTNDYLEKHGKTPIDWQV 223


>gi|325679580|ref|ZP_08159155.1| uracil-DNA glycosylase [Ruminococcus albus 8]
 gi|324108610|gb|EGC02851.1| uracil-DNA glycosylase [Ruminococcus albus 8]
          Length = 224

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 117/221 (52%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I  SW S+L + F+S +   L+EFL  E    + I+P     F A   T +  VK VI
Sbjct: 2   VNIGNSWDSILADEFKSPYYLQLREFLKREYAT-QTIYPDMYDIFNALKYTAYEDVKAVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  GI  PPSL N++KELQ DV F  P +G L  W  +GVLL
Sbjct: 61  IGQDPYHGEGQAHGLCFSVKRGIAPPPSLQNIFKELQNDVGFRIPNNGELTDWTKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV  G+A SHRG+GWE+ TD+VI  ++   + IVFMLWG +A++KQ ++ +  HL
Sbjct: 121 LNAVLTVRAGQANSHRGKGWEKLTDAVIRKLNEREKPIVFMLWGRNAKEKQALITNSHHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL AAHPSPLSA +GFFGCRHFS AN +L+  G+  ++W +
Sbjct: 181 VLTAAHPSPLSAYNGFFGCRHFSTANDFLKYTGQQPIDWSV 221


>gi|257454186|ref|ZP_05619456.1| uracil-DNA glycosylase [Enhydrobacter aerosaccus SK60]
 gi|257448359|gb|EEV23332.1| uracil-DNA glycosylase [Enhydrobacter aerosaccus SK60]
          Length = 238

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 112/226 (49%), Positives = 152/226 (67%), Gaps = 1/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  VK+ + WK  L     S +M  +++FL  +    K I+P GS  F AF++TP ++VK
Sbjct: 12  LANVKMPDDWKHALATELTSSNMDKIRQFLRDQYHAQKVIYPSGSQMFNAFNLTPLSQVK 71

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP  I  PPSL N+ +EL  D+   P  HG L HW  +G
Sbjct: 72  VVILGQDPYHGAGQAMGLSFSVPKAIPKPPSLQNILRELAADLGIAPSKHGDLTHWATQG 131

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE G+A SH+  GWE FTD+VI+ ++ + ++ VF+LWG+ AQKK   +D  
Sbjct: 132 VLLLNSMLSVEAGQAGSHQRIGWETFTDAVIEAVNQHCEHCVFILWGSYAQKKGRFIDTS 191

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HL++   HPSPL A+  GFFG R FSKAN YL  HGK+ ++WQ+P
Sbjct: 192 KHLIITGTHPSPLGANRGGFFGTRPFSKANDYLMAHGKSPIDWQLP 237


>gi|323494380|ref|ZP_08099491.1| uracil-DNA glycosylase [Vibrio brasiliensis LMG 20546]
 gi|323311384|gb|EGA64537.1| uracil-DNA glycosylase [Vibrio brasiliensis LMG 20546]
          Length = 227

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 147/224 (65%), Gaps = 1/224 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K   +W  ++    Q E+ +    F+ SE+  GK +FP     F AF  T F  VKVVI
Sbjct: 1   MKSQLTWHDVIGAEKQQEYFQQTLAFVESERASGKVVFPPAKDVFNAFKTTEFGDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH   QAHGLCFSV  G++ PPSLVN+YKEL +DV  F  P HG+L+ W  +GVL
Sbjct: 61  LGQDPYHGPNQAHGLCFSVLPGVKTPPSLVNMYKELAKDVEGFEIPKHGYLQSWAEQGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTVE+G+A SH   GWE FTD VI+ I+ +   +VF+LWGA AQKK   +D  +H
Sbjct: 121 LLNTVLTVEQGKAHSHAKSGWETFTDRVIEAINQHQSGVVFLLWGAHAQKKGRFIDRNKH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            VL   HPSPLSA  GFFGCRHFS+ N+ L + G   + W++P+
Sbjct: 181 FVLAGPHPSPLSAHRGFFGCRHFSQTNQILAQQGLEPIEWRLPV 224


>gi|167766430|ref|ZP_02438483.1| hypothetical protein CLOSS21_00935 [Clostridium sp. SS2/1]
 gi|317498292|ref|ZP_07956591.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711839|gb|EDS22418.1| hypothetical protein CLOSS21_00935 [Clostridium sp. SS2/1]
 gi|291560870|emb|CBL39670.1| Uracil-DNA glycosylase [butyrate-producing bacterium SSC/2]
 gi|316894501|gb|EFV16684.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 224

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  ++  + R L + ++ E    K IFP     F AF  TP   VKVVILG
Sbjct: 4   ITNDWADYLKEEYKKPYYRKLYQKVMDEYHT-KLIFPPADDIFNAFHFTPVKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+  PPSLVN+YKEL ED+    P +G+L+ W  +GV++LN
Sbjct: 63  QDPYHGDGQAHGLSFSVKPGVEAPPSLVNIYKELNEDLGCYIPNNGYLKKWADQGVMMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV+  RA SHRG GWE+FTD+ I +++   + IVFMLWG  AQ K+ +LD+  HL+L
Sbjct: 123 TVLTVQAHRANSHRGIGWEEFTDAAIRVLNQQDRPIVFMLWGRPAQSKKALLDNPNHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFGC HFS+AN +L+EHG   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGCHHFSQANEFLKEHGLAPIDWQI 221


>gi|299770397|ref|YP_003732423.1| uracil-DNA glycosylase [Acinetobacter sp. DR1]
 gi|298700485|gb|ADI91050.1| uracil-DNA glycosylase [Acinetobacter sp. DR1]
          Length = 237

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 152/225 (67%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M NL++FL  EK+  K I+P     F A + TP   VK
Sbjct: 11  LSKVQLEESWKISLAPFLLSPQMDNLRDFLFQEKQAQKIIYPPSKQIFSALNTTPLADVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  GI +PPSL N++ EL  D+    P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQKGIALPPSLRNIFHELHTDLGIPAPRHGDLTKWATQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   ++IVF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEAFTDEVIDVLNEQREHIVFILWGAYAQRKGQRINRD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|189459657|ref|ZP_03008442.1| hypothetical protein BACCOP_00284 [Bacteroides coprocola DSM 17136]
 gi|189433616|gb|EDV02601.1| hypothetical protein BACCOP_00284 [Bacteroides coprocola DSM 17136]
          Length = 220

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK +L   F  ++   L EF+  E +    ++P G   F AF++ P+NKVKVVI
Sbjct: 3   VQIEESWKQVLTPEFDKDYFIRLTEFVRREYQT-TTVYPPGKLIFNAFNLCPYNKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  GI  PPSL N++KE+ +D+    PT G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGIPFPPSLQNIFKEIHDDLGTPIPTTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+ I  ++ N +++VF+LWGA AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRQGWEEFTDAAIRALAENREHLVFILWGAYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA HGFFG +HFS+AN YL +HG+  + W
Sbjct: 182 VLTSVHPSPLSAYHGFFGNKHFSRANEYLIQHGEEPIKW 220


>gi|261392515|emb|CAX50070.1| uracil-DNA glycosylase (UDG) [Neisseria meningitidis 8013]
          Length = 219

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDINGFSIPDHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLAAHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|229528649|ref|ZP_04418039.1| uracil-DNA glycosylase (UDG) [Vibrio cholerae 12129(1)]
 gi|229332423|gb|EEN97909.1| uracil-DNA glycosylase (UDG) [Vibrio cholerae 12129(1)]
          Length = 226

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 145/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q  + +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   ++F+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFSK N+ LQ      +NWQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSKTNQLLQAQSIAPINWQ 221


>gi|315127603|ref|YP_004069606.1| uracil-DNA glycosylase [Pseudoalteromonas sp. SM9913]
 gi|315016117|gb|ADT69455.1| uracil-DNA glycosylase [Pseudoalteromonas sp. SM9913]
          Length = 220

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 150/218 (68%), Gaps = 2/218 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W S L +    ++M+   E++ +++ +G  ++P  S  F AFD TP + +KVVILGQDP
Sbjct: 3   NWSSFLNHELSQKYMQQTLEYIENKRGEGTAVYPPKSQVFSAFDATPLSDIKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           YH  GQAHGLCFSV P   ++PPSL N+YKEL  D+N F  P HG+L+ W  +GV LLN 
Sbjct: 63  YHGEGQAHGLCFSVLPEVKKLPPSLKNIYKELVTDINGFTTPEHGYLQGWAEQGVFLLNT 122

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH+  GWEQFTD+VI  I+ + Q +VF+LWGA AQKK   +D +RH VL 
Sbjct: 123 VLTVEQGQAHSHKHLGWEQFTDNVIAHINEHCQGVVFILWGAHAQKKGKSIDRQRHHVLA 182

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSA  GFFGC+HFSK N  L   G   +NWQ+
Sbjct: 183 GPHPSPLSAHRGFFGCQHFSKTNELLIGQGAQPINWQV 220


>gi|257461487|ref|ZP_05626583.1| uracil-DNA glycosylase [Campylobacter gracilis RM3268]
 gi|257441210|gb|EEV16357.1| uracil-DNA glycosylase [Campylobacter gracilis RM3268]
          Length = 231

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 153/224 (68%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ V+I   WK  L   F SE+   +KE LL+ K + + ++P G+  F AF++TPF +V+
Sbjct: 5   LDDVRIESGWKEALREEFLSEYFVKIKENLLAAKER-EIVYPPGNLIFNAFNLTPFERVR 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
            VILGQDPYH   QA GL FSVP G+RIPPSLVN+YKE++ D+    P  G L +W  +G
Sbjct: 64  AVILGQDPYHGAHQAMGLSFSVPRGVRIPPSLVNIYKEIKSDLGISEPESGDLSYWAKQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V   RA SH G GW+ FTD+VI ++S   Q++VFMLWG  A+ K  ++D +
Sbjct: 124 VLLLNASLSVGANRANSHSGFGWQAFTDAVIKILSARRQSLVFMLWGNFAKAKSALIDAQ 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+L AAHPSPL A   FFGC+HFS+ N YL+ HG   ++W +
Sbjct: 184 KHLILTAAHPSPL-AGGAFFGCKHFSRCNEYLRAHGLGEIDWDL 226


>gi|333031528|ref|ZP_08459589.1| Uracil-DNA glycosylase [Bacteroides coprosuis DSM 18011]
 gi|332742125|gb|EGJ72607.1| Uracil-DNA glycosylase [Bacteroides coprosuis DSM 18011]
          Length = 221

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 152/219 (69%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I E WK +LE+ F+  +   L +F+  E +    I+P  +  F AFD+ PF++ KVV+
Sbjct: 3   VRIEEKWKEVLEDEFKKPYFGMLTDFVRKEYQYHGPIYPPAALIFNAFDLCPFDQAKVVM 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV   ++IPPSL N+YKE++ D+   PP++G L HW  +GVL+
Sbjct: 63  IGQDPYHGDGQANGLCFSVNPDVQIPPSLRNIYKEIENDLGTKPPSNGDLSHWAKQGVLM 122

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+ I  ++   +N+VF+LWG+ AQ+K   ++ K+HL
Sbjct: 123 LNATLTVRAHQAGSHQNKGWEEFTDAAIQALATERENLVFILWGSYAQRKGAFINRKKHL 182

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA  GFFG  HFSK N YL +HGK  + W
Sbjct: 183 VLTSPHPSPLSAHRGFFGNNHFSKTNDYLIKHGKAPIEW 221


>gi|224418159|ref|ZP_03656165.1| uracil-DNA glycosylase [Helicobacter canadensis MIT 98-5491]
 gi|253827486|ref|ZP_04870371.1| uracil-DNA glycosylase [Helicobacter canadensis MIT 98-5491]
 gi|313141694|ref|ZP_07803887.1| uracil-DNA glycosylase [Helicobacter canadensis MIT 98-5491]
 gi|253510892|gb|EES89551.1| uracil-DNA glycosylase [Helicobacter canadensis MIT 98-5491]
 gi|313130725|gb|EFR48342.1| uracil-DNA glycosylase [Helicobacter canadensis MIT 98-5491]
          Length = 230

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 116/225 (51%), Positives = 157/225 (69%), Gaps = 3/225 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E +KI ESWK  L++ F   +   +K   L+ K  GK ++P     F AF++TPF  +K
Sbjct: 8   LENIKIEESWKLALKDEFLKPYFLEIKCHYLNAKNAGKILYPPAKLIFNAFNLTPFTSLK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTH-GFLEHWGHE 119
           VV+LGQDPYHN  QA GL FSVP GI +PPSL N+Y+EL ED+  IPP+H G L  W  +
Sbjct: 68  VVLLGQDPYHNPNQAMGLSFSVPKGIPLPPSLKNIYQELYEDLG-IPPSHNGDLTKWAKQ 126

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GVLLLN+VL+VE+ + ASH+  GW+ FTD+VI  IS   + I+F+LWG  A+ K++++D 
Sbjct: 127 GVLLLNSVLSVEQNKPASHQNFGWQTFTDNVISTISLQKEGIIFLLWGNYARAKKNLIDS 186

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           K+H +L+AAHPSPL A   FFGCRHFSK N+ L+   KT ++WQI
Sbjct: 187 KKHFILEAAHPSPL-ARGAFFGCRHFSKTNQILESLHKTPIDWQI 230


>gi|282901680|ref|ZP_06309596.1| hypothetical protein CRC_03100 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193443|gb|EFA68424.1| hypothetical protein CRC_03100 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 224

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 156/221 (70%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W S+L + FQ  + + L EFL+ E R  + I+P  S  F AF++TP+ KV V++
Sbjct: 5   LKVPGEWNSVLSDEFQKPYWKQLGEFLIQE-RSSQTIYPPESEVFSAFELTPYQKVNVLL 63

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH+  QAHGLCFSV  GI+ PPSL N+Y+ELQ+D+ F    HG+L +W  +G+L+
Sbjct: 64  LGQDPYHHRNQAHGLCFSVKPGIKPPPSLKNIYQELQQDLGFPIANHGYLANWAKQGILM 123

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV EG+A SH+ +GWE FTD VI  ++   + ++F+LWG  A+KK  ++D  RHL
Sbjct: 124 LNAVLTVREGQANSHKNQGWELFTDEVITKVNEKPEPVIFVLWGGYARKKIKLIDTNRHL 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           V+++AHPSPLSA HGFFG + FS  N  L+  GK  ++W++
Sbjct: 184 VIESAHPSPLSAYHGFFGSKPFSAINSALRIWGKPEIDWEL 224


>gi|149908883|ref|ZP_01897543.1| uracil-DNA glycosylase [Moritella sp. PE36]
 gi|149808157|gb|EDM68098.1| uracil-DNA glycosylase [Moritella sp. PE36]
          Length = 226

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 147/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L +  Q  +   L+ FL +E+  GK IFP+ +  F AF +TP   VKVVILGQD
Sbjct: 2   KTWSEFLLHEQQQPYYLELQNFLTAERAVGKVIFPKEADVFEAFSLTPLKDVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGLCFSV  GI+IPPSL N+YKEL  D++ F  P HG+L  W  +G+L+LN 
Sbjct: 62  PYHGPEQAHGLCFSVLPGIKIPPSLRNMYKELSTDIDGFAAPDHGYLIEWAQQGILMLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+ +A SH   GWE FTD V++L++   + I+F+LWG  A+KK   +D  RH VL+
Sbjct: 122 VLTVEQAKAHSHAKSGWETFTDHVVELLNQQDEEIIFVLWGNHAKKKGRHIDRSRHHVLE 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSAS GFFGC+HFS  N  LQ   +T +NWQ+
Sbjct: 182 GVHPSPLSASRGFFGCQHFSAINSRLQTRQQTAINWQV 219


>gi|78484707|ref|YP_390632.1| uracil-DNA glycosylase [Thiomicrospira crunogena XCL-2]
 gi|78362993|gb|ABB40958.1| Uracil-DNA glycosylase [Thiomicrospira crunogena XCL-2]
          Length = 232

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 156/225 (69%), Gaps = 1/225 (0%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           + +++ ESW +++   F+  +M+ LK FLL+EK  GK I P+   +F A + TPF  VKV
Sbjct: 4   QNIQLDESWLNVIGEEFEKPYMQQLKTFLLAEKAAGKEILPKAKLWFNALNSTPFEDVKV 63

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIR-IPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VILGQDPY   G AHGL FSV   ++ +P SL+N+ KEL +D+N      G+L+ W  +G
Sbjct: 64  VILGQDPYPTPGHAHGLSFSVLPDVKPLPKSLLNINKELLDDLNIDNTHCGYLQPWADQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNAVLTVE G+A +H+ +GWEQFTD+VI  ++   Q+IVF+LWGA AQKK  +++  
Sbjct: 124 VLLLNAVLTVEAGKANAHQNKGWEQFTDAVIHALATQRQHIVFILWGAYAQKKGKIINPA 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            H +LK+ HPSPLSA  GFFG + FSK N+YL EH    +NWQ+P
Sbjct: 184 HHFILKSPHPSPLSAYRGFFGSKPFSKTNQYLSEHNIPHINWQLP 228


>gi|189501830|ref|YP_001957547.1| hypothetical protein Aasi_0400 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|238692305|sp|B3ERG6|UNG_AMOA5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|189497271|gb|ACE05818.1| hypothetical protein Aasi_0400 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 220

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I  SWK  LE  F   +   L  F+ +E  K   I+P     F AF++  F+  KVVI
Sbjct: 3   VNIAPSWKPYLEEEFNKPYFEQLAAFVKAE-YKSNTIYPPAKQIFNAFELCSFDNTKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH + QA+GL FSV   +R+PPSLVN++KE++ D+    PT+G L  W  +GVLL
Sbjct: 62  LGQDPYHGFKQANGLSFSVGKEVRMPPSLVNIFKEIESDLGHPVPTNGDLTRWAQQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV E +  SH+ +GWE FTD++I ++S + Q++VFMLWG  AQKK+ ++D  +HL
Sbjct: 122 LNATLTVREKQPGSHQNKGWETFTDTIISILSQHKQHLVFMLWGNYAQKKEVLIDTSKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+AHPSP +A  GFFG +HFSKAN YL EHG T +NW
Sbjct: 182 VLKSAHPSPYAADRGFFGNKHFSKANAYLVEHGLTPINW 220


>gi|294788921|ref|ZP_06754161.1| uracil-DNA glycosylase [Simonsiella muelleri ATCC 29453]
 gi|294483023|gb|EFG30710.1| uracil-DNA glycosylase [Simonsiella muelleri ATCC 29453]
          Length = 219

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+  L       + +N+   + +E+  G  IFP  +  F AF +T F  V+VVILGQD
Sbjct: 2   KTWRQALGAEKSQPYFQNILARVQAERDAGLTIFPPAADVFNAFKLTEFADVRVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYHN GQAHGL FSV  G++IPPSLVN+YKEL +D+  F  P HG L HW  +GVLLLN 
Sbjct: 62  PYHNVGQAHGLAFSVREGVQIPPSLVNIYKELADDIAGFHTPKHGCLNHWAQQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV   +A SH   GWE FTD VI  I+ + QN+VFMLWG+ AQKK  ++D  +HLVL 
Sbjct: 122 VLTVRAHQAHSHAQFGWETFTDRVISQINAHRQNVVFMLWGSHAQKKGAMIDRTKHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YL++     ++WQI
Sbjct: 182 APHPSPLSAYRGFFGCKHFSQANDYLKQFNYQPIDWQI 219


>gi|145298200|ref|YP_001141041.1| uracil-DNA glycosylase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|172044433|sp|A4SK71|UNG_AERS4 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|142850972|gb|ABO89293.1| uracil-DNA glycosylase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 222

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 146/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ +  + ++ +     + SE+  GK I+P  +  F AF +T  ++VKVVILGQDP
Sbjct: 3   TWTDVIGSEKEQDYFKATLATVRSEREAGKVIYPPATEVFNAFKLTELDQVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G+R PPSLVN+YKE+Q D+ +F+ P HGFLE W  +GVLLLN V
Sbjct: 63  YHGPNQAHGLCFSVLPGVRTPPSLVNIYKEMQRDLPDFVTPNHGFLESWAQQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV+ G A SH   GWE FTD VI+ I+ + Q +VF+LWGA AQKK   +D  RH VL A
Sbjct: 123 LTVQAGMAHSHAHLGWETFTDRVIEQINASCQGVVFLLWGAHAQKKGRFIDRSRHHVLSA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFS+ NR L + G + +NW
Sbjct: 183 PHPSPLSAHRGFIGCGHFSETNRLLSQQGMSPINW 217


>gi|324506770|gb|ADY42883.1| Uracil-DNA glycosylase [Ascaris suum]
          Length = 316

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 153/223 (68%), Gaps = 2/223 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ + +   W+  L+   + E+M  +  FL S++ KG ++FP     F AF++TP ++++
Sbjct: 92  LKSLIMDAGWRRALDFELRKEYMHKIVRFLESQREKGIKVFPPRELIFNAFNLTPLSQIR 151

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHE 119
           VVI+GQDPYH+  QAHGLCFSV  GIR PPSL+N+YKEL+ D+ +F  P HG LE W  +
Sbjct: 152 VVIIGQDPYHDDNQAHGLCFSVSKGIRPPPSLINIYKELKTDIPHFTAPNHGCLESWARQ 211

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GV +LNA LTVE  +A SH G GW+ FTD VI +IS   + +VF+LWG  AQKK  ++DH
Sbjct: 212 GVFMLNATLTVEAHKANSHSGIGWQTFTDEVIRIISRERKGVVFLLWGGFAQKKAALVDH 271

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           K+H+V+KAAHPSPLSA   F GC  FSK N  L + GK  ++W
Sbjct: 272 KKHIVIKAAHPSPLSA-RLFLGCHCFSKTNDALVKLGKPAIDW 313


>gi|308389316|gb|ADO31636.1| uracil-DNA glycosylase [Neisseria meningitidis alpha710]
 gi|325130274|gb|EGC53042.1| uracil-DNA glycosylase [Neisseria meningitidis OX99.30304]
 gi|325136292|gb|EGC58900.1| uracil-DNA glycosylase [Neisseria meningitidis M0579]
          Length = 219

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDINGFSIPDHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|295134546|ref|YP_003585222.1| uracil-DNA glycosylase [Zunongwangia profunda SM-A87]
 gi|294982561|gb|ADF53026.1| uracil-DNA glycosylase [Zunongwangia profunda SM-A87]
          Length = 221

 Score =  237 bits (605), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 152/220 (69%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I+E WK+ LE  F+ ++ +NL EF+ +E      ++P+G H F AFD + F   +VVI
Sbjct: 3   VNINEGWKTHLETEFEKDYFKNLVEFVKNE-YSNFNVYPKGKHIFAAFDHSKFEDTRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCFSV  GI  PPSLVN++KE+  D     P  G LE W ++GVLL
Sbjct: 62  LGQDPYHGPGQANGLCFSVNDGIPQPPSLVNIFKEIHNDTGSSIPQSGNLERWAYQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+G+GWEQFTD VI+++S   +N+VFMLWG  A+KK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQGKGWEQFTDRVIEIVSAEKENVVFMLWGGYAKKKASKIDSSKHL 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG +HF+KAN YL  +GK  + W
Sbjct: 182 ILTSGHPSPLSANRGYWFGNKHFTKANEYLIANGKKPIEW 221


>gi|261211465|ref|ZP_05925753.1| uracil-DNA glycosylase [Vibrio sp. RC341]
 gi|260839420|gb|EEX66046.1| uracil-DNA glycosylase [Vibrio sp. RC341]
          Length = 226

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 148/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q ++ +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQDYFQQTLQFVESQRQSGKVIYPPAKEVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P+HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPSHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   +VF+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRSGLVFLLWGSHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+ N+ LQ  G   ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSQTNQLLQAQGIAPIHWQ 221


>gi|332971834|gb|EGK10780.1| uracil-DNA glycosylase [Kingella kingae ATCC 23330]
          Length = 219

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 114/217 (52%), Positives = 145/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  + + L   +  E+  G+ I+P     F AF  TP  +VKVVILGQDP
Sbjct: 3   TWDDILRDEMQQPYFQQLLATVQQERDNGQMIYPAPDDVFNAFAYTPLERVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHN  QAHGL FSV  G  +PPSL+N+YKEL  D+ +F  P HG L HW  +GVLLLN V
Sbjct: 63  YHNEQQAHGLAFSVQQGCAVPPSLINIYKELASDLPDFKQPAHGCLTHWAEQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV   +A SH   GWE+FTD V+  ++   +++VFMLWG+ AQKK   ++  +HLVL A
Sbjct: 123 LTVRAHQANSHAKLGWERFTDFVVAQLNQRAEHLVFMLWGSHAQKKGANINRNQHLVLTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS+AN YLQ+HG   +NWQI
Sbjct: 183 PHPSPLSAYRGFFGCRHFSQANDYLQQHGIAPINWQI 219


>gi|295397896|ref|ZP_06807958.1| uracil-DNA glycosylase [Aerococcus viridans ATCC 11563]
 gi|294973876|gb|EFG49641.1| uracil-DNA glycosylase [Aerococcus viridans ATCC 11563]
          Length = 226

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           K+   W   L    +SE+ +  ++F++   +KG  ++P  +H + AF+ TPF++VKVVIL
Sbjct: 6   KMPSDWAKELAPVLESENFKQFEDFIIQAYKKGP-VYPDQNHIYAAFEHTPFDQVKVVIL 64

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  G++IPPSL N+YKEL+ D++  P +HG L  W  +GVLLL
Sbjct: 65  GQDPYHQPGQAHGLSFSVNKGVKIPPSLRNIYKELRSDLDIQPASHGDLRQWADQGVLLL 124

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV +  A +H+G+GWE  TD+ I  ++   + IVF+LWG SA+ K  ++D  +H +
Sbjct: 125 NAVLTVPDSSANAHKGKGWEVLTDAAISALNQAREPIVFILWGNSAKAKATLIDENKHYI 184

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L +AHPSPLSA+ GFFG + FSKAN  L++ G+T ++WQ+
Sbjct: 185 LSSAHPSPLSATRGFFGTKPFSKANELLEKSGRTPIDWQV 224


>gi|291166138|gb|EFE28184.1| uracil-DNA glycosylase [Filifactor alocis ATCC 35896]
          Length = 224

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V     W SLL+  FQ E+ + L+ FL++E R  K I+P   H F A   T ++ VKVVI
Sbjct: 2   VNFGNKWDSLLKEEFQEEYYQKLRTFLITEYRT-KTIYPDMYHIFEAMKATDYDDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHG+ FSV  G+RIPPSL N+YKEL   +    P HG+L  W  +GVLL
Sbjct: 61  LGQDPYHEPNQAHGMAFSVQPGVRIPPSLFNIYKELSSQLGLTIPNHGYLMKWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTVE G+A SH+  GWEQFTD VI L++   + +VF+LWG++A  K  ++D K+HL
Sbjct: 121 LNAVLTVERGKANSHKNMGWEQFTDRVIQLVNAKEKPVVFLLWGSNAIAKAKMIDTKKHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL + HPSPLSA  GFFG  HF   N +L++     ++WQI
Sbjct: 181 VLTSPHPSPLSAYRGFFGNGHFLTTNEFLKQKYSQVIDWQI 221


>gi|331088633|ref|ZP_08337544.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|330407590|gb|EGG87090.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 254

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  F   + R L +  ++E+ + + IFP     F AF +TP  KVKVVILG
Sbjct: 36  ISGDWYEALKGEFSKPYYRTLFQ-TVNEEYRTRLIFPPAEDIFNAFHLTPLKKVKVVILG 94

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ +PPSLVN+YKEL +D+    P HG L  W ++GVL+LN
Sbjct: 95  QDPYHNNGQAHGLCFSVKKGVDVPPSLVNIYKELHDDLGCTIPDHGCLTKWANQGVLMLN 154

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + IVF+LWGA AQ+K+ +L++ +HL+L
Sbjct: 155 TVLTVRAHQANSHRGIGWEEFTDAAIMALNGQDRPIVFILWGAPAQRKKAMLNNPKHLIL 214

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            A HPSPLSA  GFFG R FSK N +L+  G+  ++WQI
Sbjct: 215 TAPHPSPLSAYRGFFGSRPFSKTNEFLESQGEEPIDWQI 253


>gi|256848059|ref|ZP_05553503.1| uracil-DNA glycosylase [Lactobacillus coleohominis 101-4-CHN]
 gi|256715119|gb|EEU30096.1| uracil-DNA glycosylase [Lactobacillus coleohominis 101-4-CHN]
          Length = 231

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 158/220 (71%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F++++ + L++FL+ E +    ++P   H F AF+ TPF+KVKVVILG
Sbjct: 5   IHNDWWPILKPQFEADYYQQLRQFLIQEYQH-HTVYPEMHHIFEAFEWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+++PPSL N+YKELQ D+ + P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGCSFSVLPGVKVPPSLQNIYKELQNDLGYPPVHHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV +G+A SHRG GWE+ TD+ I  +SN  + ++F+LWG +AQ K+ +++   ++VL
Sbjct: 124 SVLTVRDGQAYSHRGHGWEKLTDAAIQALSNRPEPVIFILWGRAAQAKKALINTTTNIVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSAS GFFG R FS+ N  L+  G+  ++WQ+P
Sbjct: 184 ESAHPSPLSASRGFFGSRPFSRTNEALKAMGEQPIDWQLP 223


>gi|313203826|ref|YP_004042483.1| uraciL-DNA glycosylase [Paludibacter propionicigenes WB4]
 gi|312443142|gb|ADQ79498.1| Uracil-DNA glycosylase [Paludibacter propionicigenes WB4]
          Length = 220

 Score =  237 bits (605), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SW   L++ F  E+   L EF+ +E  K +  FP     F AFD  PF+ VKVVI
Sbjct: 3   VKIEQSWNQALQSEFDKEYFAKLTEFVRNE-YKSRLTFPPAGLIFNAFDQCPFDDVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL+N++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGDGQAHGLCFSVNDGVAFPPSLLNIFKEIERDLGKPTPASGNLTRWAQQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV+   A SH+ RGWE FTD+VI  ++N   ++VFMLWG+ AQKK   +D  RHL
Sbjct: 122 LNATLTVQAHMAGSHQNRGWETFTDAVIHTLANKKDHLVFMLWGSYAQKKGAFIDTNRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+ HPSPLSA  GF G  HFS  N+YLQ++G   +NW
Sbjct: 182 VLKSVHPSPLSAYRGFIGNNHFSLTNQYLQKNGLPEINW 220


>gi|313898928|ref|ZP_07832455.1| uracil-DNA glycosylase [Clostridium sp. HGF2]
 gi|312956127|gb|EFR37768.1| uracil-DNA glycosylase [Clostridium sp. HGF2]
          Length = 219

 Score =  237 bits (605), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 149/217 (68%), Gaps = 1/217 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           + WK L +   Q E+ R L +FL  E+   + I+P     F  F   PF  VKVVILGQD
Sbjct: 2   KQWKELFQQEEQKEYYRKLMQFL-DEEYAHRTIYPPREDLFTCFTSCPFEAVKVVILGQD 60

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGLCFSV  G++IP SL N+YKEL+ D+N   P+HG L  W  +GV L+N V
Sbjct: 61  PYHQPDQAHGLCFSVRKGVQIPRSLKNIYKELKSDMNIDAPSHGCLTDWTKQGVFLMNTV 120

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           ++V EG+AASH+ +GWE FTD+VI  ++   + IVF+LWG+ AQKK +++  ++H +L +
Sbjct: 121 MSVREGQAASHKKKGWETFTDTVISALNEQEKGIVFVLWGSHAQKKAELITGRQHRILMS 180

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSAS GFFG R FS  NRYL+E G+T ++W++
Sbjct: 181 AHPSPLSASRGFFGSRPFSTVNRYLEEMGRTPIDWRL 217


>gi|303283238|ref|XP_003060910.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457261|gb|EEH54560.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 321

 Score =  237 bits (605), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 151/225 (67%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E + +  +W+ +LE  F+ E+  NLK FL  E   G ++FP   + FRAF+      VK
Sbjct: 96  IEDLLVESTWREILEPEFKKEYFGNLKTFLKREWSSGAKVFPATKNVFRAFNSCATANVK 155

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH+ GQA GL FSVP GI++P SL N+YKEL +D+    PTHG L+ W  +G
Sbjct: 156 VVILGQDPYHDDGQAMGLSFSVPKGIKVPSSLSNIYKELGDDLGCKKPTHGDLDKWATQG 215

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VL+LNA LTV   +A SH  +GWE FTD+ I  +S    N+VFMLWG +AQ+K+ ++   
Sbjct: 216 VLMLNASLTVRAHQANSHSKKGWEVFTDAAIRSLSKKQTNLVFMLWGKNAQEKERLIAKD 275

Query: 181 -RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HLVLK  HPS LSA  GF+GC+HFS+AN Y+++ G   ++WQI
Sbjct: 276 GNHLVLKCPHPSGLSAHRGFYGCKHFSQANAYIEKKGGVPIDWQI 320


>gi|261208813|ref|ZP_05923250.1| uracil-DNA glycosylase [Enterococcus faecium TC 6]
 gi|289567389|ref|ZP_06447757.1| uracil-DNA glycosylase [Enterococcus faecium D344SRF]
 gi|294616816|ref|ZP_06696557.1| uracil-DNA glycosylase [Enterococcus faecium E1636]
 gi|260077315|gb|EEW65035.1| uracil-DNA glycosylase [Enterococcus faecium TC 6]
 gi|289160814|gb|EFD08746.1| uracil-DNA glycosylase [Enterococcus faecium D344SRF]
 gi|291590322|gb|EFF22090.1| uracil-DNA glycosylase [Enterococcus faecium E1636]
          Length = 226

 Score =  237 bits (604), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSSEFSKDYYLHLREFLKKE-YASQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+   P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELNDDLGIAPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKIIDKSRHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|332851791|ref|ZP_08433716.1| uracil-DNA glycosylase [Acinetobacter baumannii 6013150]
 gi|332865829|ref|ZP_08436613.1| uracil-DNA glycosylase [Acinetobacter baumannii 6013113]
 gi|332872771|ref|ZP_08440737.1| uracil-DNA glycosylase [Acinetobacter baumannii 6014059]
 gi|322508253|gb|ADX03707.1| Uracil-DNA glycosylase [Acinetobacter baumannii 1656-2]
 gi|323517879|gb|ADX92260.1| uracil-DNA glycosylase [Acinetobacter baumannii TCDC-AB0715]
 gi|332729798|gb|EGJ61133.1| uracil-DNA glycosylase [Acinetobacter baumannii 6013150]
 gi|332735041|gb|EGJ66126.1| uracil-DNA glycosylase [Acinetobacter baumannii 6013113]
 gi|332739068|gb|EGJ69929.1| uracil-DNA glycosylase [Acinetobacter baumannii 6014059]
          Length = 240

 Score =  237 bits (604), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 14  LSKVQLEESWKRSLTPFLLSPYMDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVK 73

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 74  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELHTDLGVPVSRHGDLTKWAEQG 133

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 134 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 193

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 194 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 238


>gi|153840078|ref|ZP_01992745.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AQ3810]
 gi|149746336|gb|EDM57393.1| uracil-DNA glycosylase [Vibrio parahaemolyticus AQ3810]
          Length = 217

 Score =  237 bits (604), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 140/200 (70%), Gaps = 1/200 (0%)

Query: 29  FLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRI 88
           F+ +E+  GK I+P     F AF  T FN VKVVILGQDPYH   QAHGLCFSV  GI+ 
Sbjct: 17  FVEAERAAGKAIYPPAKDVFNAFRFTEFNDVKVVILGQDPYHGPNQAHGLCFSVLPGIKT 76

Query: 89  PPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFT 147
           PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN VLTVE+G+A SH   GWE FT
Sbjct: 77  PPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTVLTVEQGKAHSHSKTGWETFT 136

Query: 148 DSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSK 207
           D VI+ I+ +   +VF+LWG+ AQKK   +D  +H VL A HPSPLSA  GF GC+HFS+
Sbjct: 137 DRVIEAINQHQHGVVFLLWGSHAQKKGRFIDRSKHHVLAAPHPSPLSAHRGFLGCKHFSQ 196

Query: 208 ANRYLQEHGKTTVNWQIPLS 227
           AN+ L   GK  +NW +PL+
Sbjct: 197 ANQLLASQGKEPINWHLPLT 216


>gi|282890412|ref|ZP_06298940.1| hypothetical protein pah_c016o158 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499794|gb|EFB42085.1| hypothetical protein pah_c016o158 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 238

 Score =  237 bits (604), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 152/228 (66%), Gaps = 4/228 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M   +I  SW+  LE   +  ++  L  FL  E+  G +I+P  +  F A   TPF++VK
Sbjct: 10  MLPFEIESSWQKALEEELKKPYLLELAVFLEKERAMGAQIYPPKNLIFNALWNTPFDQVK 69

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVI+GQDPYH  GQAHGL FSVP GI  PPSL N++KEL ED+    P+HG L HW  +G
Sbjct: 70  VVIIGQDPYHGPGQAHGLSFSVPEGIPQPPSLKNIFKELAEDLGIPAPSHGCLLHWAKQG 129

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKK----QDV 176
           VLLLNA LTV +G   SH GRGWEQFTDS++  +    + +VF+LWG  AQKK    +++
Sbjct: 130 VLLLNATLTVRQGEPMSHEGRGWEQFTDSIVKALLIQKKPMVFILWGKWAQKKWEHFKNL 189

Query: 177 LDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            D  +HLVL AAHPSP SA  GFFGC HFSK N++L++H  T ++W+I
Sbjct: 190 QDPNQHLVLTAAHPSPFSAHQGFFGCHHFSKTNQWLEKHHLTPIDWKI 237


>gi|257886660|ref|ZP_05666313.1| uracil-DNA glycosylase [Enterococcus faecium 1,141,733]
 gi|257892871|ref|ZP_05672524.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,408]
 gi|257822714|gb|EEV49646.1| uracil-DNA glycosylase [Enterococcus faecium 1,141,733]
 gi|257829250|gb|EEV55857.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,408]
          Length = 226

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSSEFSKDYYLHLREFLKKE-YATQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+  +P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELHDDLGIVPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|242310643|ref|ZP_04809798.1| uracil-DNA glycosylase [Helicobacter pullorum MIT 98-5489]
 gi|239523041|gb|EEQ62907.1| uracil-DNA glycosylase [Helicobacter pullorum MIT 98-5489]
          Length = 231

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI ESWK  L+  F   +   +K   ++ K  GK I+P  +  F AF++TPF+ +K
Sbjct: 8   LDKLKIEESWKEALKEEFFKPYFLEIKRNYIAAKSSGKTIYPPANLTFNAFNLTPFDTLK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYHN  QA GL FSVP GI +PPSL N+YKE+  D+   P  +G L  W  +G
Sbjct: 68  VVILGQDPYHNPHQAMGLSFSVPKGIPLPPSLKNIYKEITNDLGIPPSQNGDLSQWARQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VL+VE  + ASH+  GW+ FTD+VI  ISN  + IVF+LWG  A+ K++++D  
Sbjct: 128 VLLLNSVLSVEHNKPASHQNFGWQTFTDNVIKTISNQKKGIVFLLWGNYAKAKKNLIDSS 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H +L+AAHPSPL+ S GF GCRHFS+ N  L+   K+ +NWQI
Sbjct: 188 KHFILEAAHPSPLARS-GFLGCRHFSQTNAILESLHKSPINWQI 230


>gi|293608248|ref|ZP_06690551.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828821|gb|EFF87183.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 237

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 152/225 (67%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S  M +L++FL  +K+  K I+P     F A + TP   VK
Sbjct: 11  LSKVQLEESWKRSLAPFLLSPQMDSLRDFLFQQKQAQKIIYPPSKQIFNALNTTPLADVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  GI +PPSL N++ EL  D+    P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQKGIALPPSLRNIFHELHTDLGIPAPRHGDLTKWATQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   Q+IVF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEAFTDEVIDVLNEQRQHIVFILWGAYAQRKGQRINRD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|89072524|ref|ZP_01159096.1| uracil-DNA glycosylase [Photobacterium sp. SKA34]
 gi|89051628|gb|EAR57081.1| uracil-DNA glycosylase [Photobacterium sp. SKA34]
          Length = 220

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 147/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW + +       +  ++++ + + +  GK ++P     F AF  TP  K KVVILGQDP
Sbjct: 4   SWSTFIAQQQTQAYFTDIEQAVDAARNAGKVVYPPQEDVFNAFTSTPLEKTKVVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G++ PPSLVN+YKEL  D++ F  P HG+L+ W  +GVLLLN V
Sbjct: 64  YHGPKQAHGLSFSVLSGVKTPPSLVNMYKELATDIDGFTIPEHGYLQPWAEQGVLLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD  I+ I++N + ++F+LWGA AQKK   +D  RH VL +
Sbjct: 124 LTVEQGNAHSHAKIGWETFTDRAIEYINDNTEGVIFLLWGAHAQKKGKKIDTDRHHVLHS 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSA  GFFGC+HFSK N+ L E GK+++NWQ+
Sbjct: 184 AHPSPLSAYRGFFGCQHFSKTNQLLAEMGKSSINWQL 220


>gi|84393248|ref|ZP_00992010.1| uracil-DNA glycosylase [Vibrio splendidus 12B01]
 gi|84376154|gb|EAP93040.1| uracil-DNA glycosylase [Vibrio splendidus 12B01]
          Length = 226

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +SW+S++ +    E+ +++ +F+  ++  GK I+P     F AFD+TPF  V+VVILGQD
Sbjct: 5   KSWESIINDERDKEYFQSVLDFVEQQRNSGKTIYPPQEQVFSAFDMTPFESVRVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++IPPSL N+YKEL +D++ F  P+HG+L+ W  +GVL+LN 
Sbjct: 65  PYHGAKQAHGLAFSVLPGVKIPPSLRNMYKELAQDIDGFEIPSHGYLDTWASQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEE +A SH   GWE FTD++I  ++   + I+F+LWGA AQKK   +D  +H VL 
Sbjct: 125 VLTVEEAKAHSHAKCGWEVFTDAIIAELNQRSEPIIFLLWGAHAQKKGQAIDADKHHVLT 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPLSA  GFFGC+HFS  N+ L    +  ++W++P
Sbjct: 185 APHPSPLSARRGFFGCQHFSTTNKLLSSMDQQPIDWRLP 223


>gi|325202084|gb|ADY97538.1| uracil-DNA glycosylase [Neisseria meningitidis M01-240149]
 gi|325208162|gb|ADZ03614.1| uracil-DNA glycosylase [Neisseria meningitidis NZ-05/33]
          Length = 219

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDINGFSIPDHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLAAHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|319410472|emb|CBY90832.1| uracil-DNA glycosylase (UDG) [Neisseria meningitidis WUE 2594]
 gi|325134531|gb|EGC57176.1| uracil-DNA glycosylase [Neisseria meningitidis M13399]
          Length = 219

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N     + + +   +  E+  G+ I+P  +  F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKHQPYFQKILNAVRQERLSGQIIYPPETDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDINGFSIPDHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLAAHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|170728314|ref|YP_001762340.1| uracil-DNA glycosylase [Shewanella woodyi ATCC 51908]
 gi|169813661|gb|ACA88245.1| uracil-DNA glycosylase [Shewanella woodyi ATCC 51908]
          Length = 222

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           + W   L    + ++ R L+ F+L+E+  GK +FP  +  F AF++TP +KV+VVI+GQD
Sbjct: 5   KDWDGFLAAEREQDYYRALQAFVLAERANGKAVFPPEAEVFTAFNLTPLDKVRVVIIGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGLCFSV  GI+IPPSLVN+YKEL  D+  F  P HG L  W  +GVL+LN 
Sbjct: 65  PYHGPDQAHGLCFSVKHGIKIPPSLVNMYKELATDIPGFTAPEHGHLSSWAEQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH   GWE FT   ++L++     IVF+LWGA A KK  V+  K+H +L 
Sbjct: 125 VLTVEQGKAHSHAKSGWETFTGHAMELLNQQTSPIVFILWGAHAIKKGKVITGKQHHILS 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSA  GFFGC+HFSK N+ L   G   +NWQ+
Sbjct: 185 GPHPSPLSAYRGFFGCQHFSKTNQILTSLGTPEINWQV 222


>gi|227552176|ref|ZP_03982225.1| uracil-DNA glycosylase [Enterococcus faecium TX1330]
 gi|227178667|gb|EEI59639.1| uracil-DNA glycosylase [Enterococcus faecium TX1330]
          Length = 229

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/227 (49%), Positives = 157/227 (69%), Gaps = 3/227 (1%)

Query: 1   MEGVK--IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNK 58
           ME +K  IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +
Sbjct: 1   MEVLKEIIHNSWQEVLSSEFSKDYYLHLREFLKKE-YATQKIHPDMYHIYEALELTPYEE 59

Query: 59  VKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGH 118
           VKVVILGQDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+  +P  HG L  W  
Sbjct: 60  VKVVILGQDPYHGENQAHGLSFSVQPGMKIPPSLRNIYKELHDDLGIVPVQHGNLVSWAK 119

Query: 119 EGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLD 178
           +GVLLLN VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D
Sbjct: 120 QGVLLLNTVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMID 179

Query: 179 HKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
             RH+++ + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 180 KSRHIIITSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 226


>gi|260588463|ref|ZP_05854376.1| uracil-DNA glycosylase [Blautia hansenii DSM 20583]
 gi|331082259|ref|ZP_08331386.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260541337|gb|EEX21906.1| uracil-DNA glycosylase [Blautia hansenii DSM 20583]
 gi|330403053|gb|EGG82618.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 227

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 151/216 (69%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W   L+  F+ E+ + L + +  E ++ ++IFP     F AF  TP ++VKVVILGQDP
Sbjct: 7   QWLEALKPEFKKEYYKELFQKVGQEYQE-RKIFPAPDDIFNAFHFTPLDEVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YHN GQAHGLCFSV   + IPPSLVN+Y+EL +D     P +G+LE W  +GVL+LN VL
Sbjct: 66  YHNDGQAHGLCFSVKPEVEIPPSLVNIYQELHDDCGCYIPDNGYLEKWARQGVLMLNTVL 125

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV   +A SHRG GWEQFTD+ I +++   + IVF+LWG  AQ K  +L++ +HL+L+A 
Sbjct: 126 TVRAHQANSHRGIGWEQFTDAAIRVLNEQDRPIVFLLWGRPAQMKHSMLNNPKHLILEAP 185

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGCRHFSK N +L+++G   ++WQI
Sbjct: 186 HPSPLSAYRGFFGCRHFSKTNEFLEQNGLAPIDWQI 221


>gi|153815067|ref|ZP_01967735.1| hypothetical protein RUMTOR_01284 [Ruminococcus torques ATCC 27756]
 gi|317501854|ref|ZP_07960039.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|145847635|gb|EDK24553.1| hypothetical protein RUMTOR_01284 [Ruminococcus torques ATCC 27756]
 gi|316896744|gb|EFV18830.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 222

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  F   + R L +  ++E+ + + IFP     F AF +TP  KVKVVILG
Sbjct: 4   ISGDWYEALKGEFSKPYYRTLFQ-TVNEEYRTRLIFPPAEDIFNAFHLTPLKKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ +PPSLVN+YKEL +D+    P HG L  W ++GVL+LN
Sbjct: 63  QDPYHNNGQAHGLCFSVKKGVDVPPSLVNIYKELHDDLGCTIPDHGCLTKWANQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + IVF+LWGA AQ+K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMALNGQDRPIVFILWGAPAQRKKAMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            A HPSPLSA  GFFG R FSK N +L+  G+  ++WQI
Sbjct: 183 TAPHPSPLSAYRGFFGSRPFSKTNEFLESQGEEPIDWQI 221


>gi|260550107|ref|ZP_05824321.1| uracil-DNA glycosylase [Acinetobacter sp. RUH2624]
 gi|260406862|gb|EEX00341.1| uracil-DNA glycosylase [Acinetobacter sp. RUH2624]
          Length = 237

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 11  LSKVQLEESWKRSLTPFLLSPYMDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELNTDLGVPISRHGDLTKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|296314415|ref|ZP_06864356.1| uracil-DNA glycosylase [Neisseria polysaccharea ATCC 43768]
 gi|296838850|gb|EFH22788.1| uracil-DNA glycosylase [Neisseria polysaccharea ATCC 43768]
          Length = 219

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 151/218 (69%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQKILNAVRQERLSGQIIYPPSVDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|295109726|emb|CBL23679.1| Uracil-DNA glycosylase [Ruminococcus obeum A2-162]
          Length = 231

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 149/215 (69%), Gaps = 1/215 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W   L+  F   +   L + ++ E +  ++IFP     F AF  TP ++VKVVILGQDPY
Sbjct: 8   WLEALKGEFHQPYYTKLYKTVMQEYQT-RKIFPPADDMFNAFHFTPLSQVKVVILGQDPY 66

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           HN GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+LE W  +GVL+LN VLT
Sbjct: 67  HNDGQAHGLCFSVKKDVEIPPSLVNIYQELHDDLGCYIPDNGYLEKWARQGVLMLNTVLT 126

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           V   +A SHRG GWEQFTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L+A H
Sbjct: 127 VRAHQANSHRGIGWEQFTDAAIRILNEQDRPIVFLLWGRPAQMKKSMLNNPKHLILEAPH 186

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           PSPLSA  GFFGCRHFSK N +L ++G   ++WQI
Sbjct: 187 PSPLSAYRGFFGCRHFSKTNEFLIQNGLEPIDWQI 221


>gi|329957679|ref|ZP_08298154.1| uracil-DNA glycosylase [Bacteroides clarus YIT 12056]
 gi|328522556|gb|EGF49665.1| uracil-DNA glycosylase [Bacteroides clarus YIT 12056]
          Length = 220

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I +SWK+ L+  F  ++   L  F+  E  K   I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEDSWKAHLQPEFDKDYFYTLTNFVREEYGK-YAIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ED+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKEDIGTDAPPTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+  GWE FTD+ I +++   +++VF+LWGA AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNHGWETFTDAAIRILAEEREHLVFILWGAYAQRKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSKAN YL+ HG+  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSKANEYLKAHGEEEIKW 220


>gi|160938377|ref|ZP_02085732.1| hypothetical protein CLOBOL_03275 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438750|gb|EDP16507.1| hypothetical protein CLOBOL_03275 [Clostridium bolteae ATCC
           BAA-613]
          Length = 224

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L + F+  + + L + +  E  + KR+FP     F AF  TP   VKVVILG
Sbjct: 4   ITNDWLGPLSSEFKKPYYKELYKTVKHE-YETKRVFPEPDDIFNAFAFTPLADVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHNYGQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHNYGQAHGLCFSVKPDVDIPPSLVNIYQELHDDLGCYIPNNGYLKKWADQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHR  GWE+FTD+ I +++   + +VF+LWG  AQ K+ +L++ RHL+L
Sbjct: 123 TVLTVRAHQANSHRDIGWEKFTDAAIGILNQQDRPMVFILWGRPAQTKKAMLNNPRHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSAS GFFG R FSK N +L EHG T V+WQI
Sbjct: 183 EAPHPSPLSASRGFFGSRPFSKTNAFLTEHGLTPVDWQI 221


>gi|328958159|ref|YP_004375545.1| uracil-DNA glycosylase [Carnobacterium sp. 17-4]
 gi|328674483|gb|AEB30529.1| uracil-DNA glycosylase [Carnobacterium sp. 17-4]
          Length = 227

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/224 (50%), Positives = 157/224 (70%), Gaps = 1/224 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V ++ SW  +L+    +     LKEFL+ E ++   ++P   H ++AF+ TP+N+VKVVI
Sbjct: 3   VPVNNSWLPILQEQTNTPSYHLLKEFLVQEYQE-TIVYPEMHHIWQAFEWTPYNEVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV   ++IPPSLVN+YKELQ D+   P  HG+LE W  +GVLL
Sbjct: 62  LGQDPYHGPKQAHGLSFSVLPTVKIPPSLVNIYKELQSDLGISPVDHGYLESWAKQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV +G+A SH+G+GWE  TD+VI  +S+ +Q +VF+LWG  + KK+ ++D  +H+
Sbjct: 122 LNTVLTVRKGQAHSHKGKGWETLTDAVIKKLSDRNQPMVFILWGNPSIKKRALIDESKHV 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           VL + HPSPLSA  GFFG + FSKAN  L + G+  +NWQ+P S
Sbjct: 182 VLTSVHPSPLSAYRGFFGSKPFSKANDALIKFGEEPINWQLPES 225


>gi|203283979|ref|YP_002221719.1| uracil DNA glycosylase [Borrelia duttonii Ly]
 gi|238690552|sp|B5RKV2|UNG_BORDL RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|201083422|gb|ACH93013.1| uracil DNA glycosylase [Borrelia duttonii Ly]
          Length = 223

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 151/221 (68%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L++ F   + + L  F+ +E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEMLKSEFCKGYFKRLVSFIKNEYKTKKDKIFPPPRLIFNAFDTLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQA+GL FSV   I+IPPSL N++KE++  +      +G L  W  +G  
Sbjct: 63  ILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERSLKIKTIPNGDLTRWAEQGTF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN++LTVEEGR +SH+  GWE FT+ VI +IS N  N+VFMLWG  A+ K++++D  +H
Sbjct: 123 LLNSILTVEEGRPSSHKDIGWEIFTNEVIKIISKNLNNVVFMLWGNFAKGKKELIDTSKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA +GF G  HFSK  RYLQEH KTT+N+Q
Sbjct: 183 LILETSHPSPYSAHNGFLGSNHFSKTLRYLQEHNKTTINFQ 223


>gi|184157934|ref|YP_001846273.1| uracil-DNA glycosylase [Acinetobacter baumannii ACICU]
 gi|239502189|ref|ZP_04661499.1| uracil-DNA glycosylase [Acinetobacter baumannii AB900]
 gi|238685513|sp|A3M500|UNG_ACIBT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238691005|sp|B2HZE0|UNG_ACIBC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|183209528|gb|ACC56926.1| Uracil DNA glycosylase [Acinetobacter baumannii ACICU]
 gi|193077202|gb|ABO11994.2| uracil-DNA glycosylase [Acinetobacter baumannii ATCC 17978]
          Length = 237

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 11  LSKVQLEESWKRSLTPFLLSPYMDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELHTDLGVPVSRHGDLTKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|257895235|ref|ZP_05674888.1| uracil-DNA glycosylase [Enterococcus faecium Com12]
 gi|257897857|ref|ZP_05677510.1| uracil-DNA glycosylase [Enterococcus faecium Com15]
 gi|293377233|ref|ZP_06623438.1| uracil-DNA glycosylase [Enterococcus faecium PC4.1]
 gi|257831800|gb|EEV58221.1| uracil-DNA glycosylase [Enterococcus faecium Com12]
 gi|257835769|gb|EEV60843.1| uracil-DNA glycosylase [Enterococcus faecium Com15]
 gi|292644094|gb|EFF62199.1| uracil-DNA glycosylase [Enterococcus faecium PC4.1]
          Length = 226

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSSEFSKDYYLHLREFLKKE-YATQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+  +P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGMKIPPSLRNIYKELHDDLGIVPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|254804999|ref|YP_003083220.1| uracil-DNA glycosylase [Neisseria meningitidis alpha14]
 gi|254668541|emb|CBA05970.1| uracil-DNA glycosylase [Neisseria meningitidis alpha14]
          Length = 219

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV EG+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVREGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|254674215|emb|CBA09999.1| Uracil DNA glycosylase [Neisseria meningitidis alpha275]
          Length = 219

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLAAHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|169633378|ref|YP_001707114.1| uracil-DNA glycosylase [Acinetobacter baumannii SDF]
 gi|238688143|sp|B0VMZ7|UNG_ACIBS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|169152170|emb|CAP01073.1| uracil-DNA glycosylase [Acinetobacter baumannii]
          Length = 237

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L +   S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 11  LSKVQLEESWKRSLTSFLLSPYMDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELHTDLGVPVSRHGDLTKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH  +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 131 VLLLNSVLTVEAGQPTSHHKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|169796137|ref|YP_001713930.1| uracil-DNA glycosylase [Acinetobacter baumannii AYE]
 gi|213157129|ref|YP_002319174.1| uracil-DNA glycosylase [Acinetobacter baumannii AB0057]
 gi|215483591|ref|YP_002325812.1| uracil-DNA glycosylase [Acinetobacter baumannii AB307-0294]
 gi|301345936|ref|ZP_07226677.1| uracil-DNA glycosylase [Acinetobacter baumannii AB056]
 gi|301510607|ref|ZP_07235844.1| uracil-DNA glycosylase [Acinetobacter baumannii AB058]
 gi|301597398|ref|ZP_07242406.1| uracil-DNA glycosylase [Acinetobacter baumannii AB059]
 gi|226725636|sp|B7H3L4|UNG_ACIB3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725637|sp|B7I526|UNG_ACIB5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238688100|sp|B0VD25|UNG_ACIBY RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|169149064|emb|CAM86941.1| uracil-DNA glycosylase [Acinetobacter baumannii AYE]
 gi|213056289|gb|ACJ41191.1| uracil-DNA glycosylase [Acinetobacter baumannii AB0057]
 gi|213987045|gb|ACJ57344.1| uracil-DNA glycosylase [Acinetobacter baumannii AB307-0294]
          Length = 237

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 11  LSKVQLEESWKRSLTPFLLSPYMDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELHTDLGVPISRHGDLTKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|156973264|ref|YP_001444171.1| uracil-DNA glycosylase [Vibrio harveyi ATCC BAA-1116]
 gi|166225569|sp|A7MS85|UNG_VIBHB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|156524858|gb|ABU69944.1| hypothetical protein VIBHAR_00945 [Vibrio harveyi ATCC BAA-1116]
          Length = 226

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 148/220 (67%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q  +  +   F+ +E+  GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 6   TWHDVIGEEKQQSYFVDTLNFVEAERAAGKAIYPPAKDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + + +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGSHAQKKGRFIDRNKHHVLTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFG + FS+AN+ L + GK  +NW +P++
Sbjct: 186 PHPSPLSAHRGFFGSKPFSQANQILVQQGKEVINWHLPMT 225


>gi|325204206|gb|ADY99659.1| uracil-DNA glycosylase [Neisseria meningitidis M01-240355]
          Length = 219

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L N  +  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGNEKRQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDINGFSIPDHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|332534737|ref|ZP_08410565.1| uracil-DNA glycosylase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035824|gb|EGI72308.1| uracil-DNA glycosylase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 220

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 151/218 (69%), Gaps = 2/218 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W + LE+  Q  +M+   E++ + + +G  ++P  +  F AFD T  N ++VVILGQDP
Sbjct: 3   NWATFLESELQQPYMQQTLEYVANRRNEGVAVYPPEAQVFSAFDATALNDIRVVILGQDP 62

Query: 69  YHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           YH  GQAHGLCFSV P   ++PPSL N+YKEL  D++ FI P HG+L+ W  +GV LLN 
Sbjct: 63  YHGEGQAHGLCFSVLPDVKKLPPSLKNMYKELAVDISGFIIPEHGYLQSWADQGVFLLNT 122

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH+  GWEQFTD+VI  I+ + + +VF+LWGA AQKK   +D  RH VLK
Sbjct: 123 VLTVEQGQAHSHKHLGWEQFTDNVIAHINKHCEGVVFILWGAHAQKKGKGIDSARHHVLK 182

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSA  GFFGC+HFS+ N  LQ   +  +NWQ+
Sbjct: 183 GPHPSPLSAHRGFFGCKHFSQTNELLQAQSEKPINWQV 220


>gi|314937693|ref|ZP_07845017.1| uracil-DNA glycosylase [Enterococcus faecium TX0133a04]
 gi|314943358|ref|ZP_07850131.1| uracil-DNA glycosylase [Enterococcus faecium TX0133C]
 gi|314947590|ref|ZP_07851000.1| uracil-DNA glycosylase [Enterococcus faecium TX0082]
 gi|314953548|ref|ZP_07856459.1| uracil-DNA glycosylase [Enterococcus faecium TX0133A]
 gi|314994067|ref|ZP_07859388.1| uracil-DNA glycosylase [Enterococcus faecium TX0133B]
 gi|314996855|ref|ZP_07861861.1| uracil-DNA glycosylase [Enterococcus faecium TX0133a01]
 gi|313589022|gb|EFR67867.1| uracil-DNA glycosylase [Enterococcus faecium TX0133a01]
 gi|313591502|gb|EFR70347.1| uracil-DNA glycosylase [Enterococcus faecium TX0133B]
 gi|313594427|gb|EFR73272.1| uracil-DNA glycosylase [Enterococcus faecium TX0133A]
 gi|313597939|gb|EFR76784.1| uracil-DNA glycosylase [Enterococcus faecium TX0133C]
 gi|313642939|gb|EFS07519.1| uracil-DNA glycosylase [Enterococcus faecium TX0133a04]
 gi|313645983|gb|EFS10563.1| uracil-DNA glycosylase [Enterococcus faecium TX0082]
          Length = 229

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/227 (49%), Positives = 156/227 (68%), Gaps = 3/227 (1%)

Query: 1   MEGVK--IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNK 58
           ME +K  IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +
Sbjct: 1   MEFLKEIIHNSWQEVLSSEFSKDYYLHLREFLKKE-YASQKIHPDMYHIYEALELTPYEE 59

Query: 59  VKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGH 118
           VKVVILGQDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+   P  HG L  W  
Sbjct: 60  VKVVILGQDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELYDDLGIAPVQHGNLVSWAK 119

Query: 119 EGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLD 178
           +GVLLLN VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D
Sbjct: 120 QGVLLLNTVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMID 179

Query: 179 HKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
             RH+++ + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 180 KSRHIIITSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 226


>gi|109899878|ref|YP_663133.1| uracil-DNA glycosylase [Pseudoalteromonas atlantica T6c]
 gi|109702159|gb|ABG42079.1| Uracil-DNA glycosylase [Pseudoalteromonas atlantica T6c]
          Length = 222

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W +LL    Q  +  ++  F+ SE+  GK ++P     F AF  T FN++KVVILGQDP
Sbjct: 6   TWHTLLGEEKQQAYFTDMMNFIASERANGKVVYPAAKDVFNAFSCTEFNQIKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G++ PPSL N+YK LQ D  +F+ P HG L+ W  +GV LLN V
Sbjct: 66  YHGPNQAHGLSFSVQKGVKTPPSLKNMYKALQHDFPDFVVPEHGCLQSWAEQGVFLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE+FTD VI LI+ + Q++VF+LWG+ AQKK  ++D  +H +L A
Sbjct: 126 LTVEQGKAHSHAKIGWERFTDKVIALINEHAQDVVFLLWGSHAQKKAGLIDASKHHILTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSA  GFF C HF++ N+ L + G+T + WQI
Sbjct: 186 AHPSPLSAYRGFFECGHFAQTNQILLDSGRTPIKWQI 222


>gi|317130823|ref|YP_004097105.1| uracil-DNA glycosylase [Bacillus cellulosilyticus DSM 2522]
 gi|315475771|gb|ADU32374.1| uracil-DNA glycosylase [Bacillus cellulosilyticus DSM 2522]
          Length = 227

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++ SW  LL+  FQ E+ + L   +  E  + K+I+P   + F A   TP  K KVVILG
Sbjct: 5   VNNSWDELLQKEFQKEYFKTLCSHV-EEAYENKQIYPEKQNIFHALASTPVEKTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL N+YKELQ D+ +  P HGFL+ W  EGVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVKRGVKVPPSLRNIYKELQSDLGYAIPHHGFLQKWADEGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE  +  SH+G GWE FTD VI  ++N ++ I++MLWG  AQ K+ ++ +  H +L
Sbjct: 124 TVLTVEAHKPNSHKGIGWELFTDEVIRTLNNKNEPIIYMLWGKHAQAKEALISNPNHYIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           K+ HPSP SAS GFFG R FSKAN  L++HGK  V+W+I
Sbjct: 184 KSPHPSPFSASKGFFGSRPFSKANAILKQHGKEEVDWKI 222


>gi|261886101|ref|ZP_06010140.1| uracil-DNA glycosylase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 232

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 155/224 (69%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  VKI +SWK +L++ F S +   +K  L+S  + GK ++P  +  F AF++TPF+KVK
Sbjct: 5   LAKVKIEDSWKEVLKDEFLSSYFLEIKFNLISALKSGK-VYPPSNLIFNAFNLTPFDKVK 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYHN G+A GL FSVP G+R+PPSL N+YKE+++D+  I P  G L +W  +G
Sbjct: 64  VVILGQDPYHNEGEAMGLSFSVPKGVRVPPSLANIYKEIKDDLGIIEPNCGDLSYWAKQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V    A SH   GW+ F+D+VI  IS     +VFMLWG  A+ K ++++  
Sbjct: 124 VLLLNATLSVGARMANSHSNFGWQIFSDAVIKNISEKKTGVVFMLWGNYARAKANLIEAN 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL A   FFG RHFSK N YL ++G+T ++W +
Sbjct: 184 KHLVLTAAHPSPL-ARGAFFGSRHFSKCNNYLIKNGQTPIDWDL 226


>gi|238762783|ref|ZP_04623752.1| Uracil-DNA glycosylase [Yersinia kristensenii ATCC 33638]
 gi|238699088|gb|EEP91836.1| Uracil-DNA glycosylase [Yersinia kristensenii ATCC 33638]
          Length = 230

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW  ++ +  +  + ++   ++ +E+  GK I+P     F AF +T  N+VKVVILGQDP
Sbjct: 8   SWHDVIGHEKEQPYFKDTLAYVAAERSAGKIIYPPQKDVFNAFRLTELNQVKVVILGQDP 67

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 68  YHGPNQAHGLSFSVLPGVPAPPSLVNIYKELATDIPGFQRPNHGFLQSWAEQGVLLLNTV 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G A SH   GWE FTD VI  ++ +   ++FMLWGA AQKK  ++D +RH +LKA
Sbjct: 128 LTVEAGNAHSHANLGWETFTDKVIAALNEHRDGVIFMLWGAHAQKKGRIIDTQRHFILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+AN+ LQ+HG+  ++WQ
Sbjct: 188 PHPSPLSAHRGFLGCKHFSQANQLLQQHGQQPIDWQ 223


>gi|255320511|ref|ZP_05361692.1| uracil-DNA glycosylase [Acinetobacter radioresistens SK82]
 gi|262378403|ref|ZP_06071560.1| uracil-DNA glycosylase [Acinetobacter radioresistens SH164]
 gi|255302483|gb|EET81719.1| uracil-DNA glycosylase [Acinetobacter radioresistens SK82]
 gi|262299688|gb|EEY87600.1| uracil-DNA glycosylase [Acinetobacter radioresistens SH164]
          Length = 237

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L +      M +L+ FL  EK+  K I+P     F+A ++TP ++VK
Sbjct: 11  LSKVQLDESWKYALADFLLGAKMEHLRNFLREEKKAQKTIYPPNPEIFKALNMTPLDQVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+    P HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVHRGVGLPPSLRNIFHELHTDLGVPEPHHGDLTKWAKQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE FTD VID+++   +++VF+LWGA AQ+K   ++  
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEDFTDYVIDVVNEQREHVVFILWGAYAQRKGQRINQD 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RHLVLKAAHPSPL+A+  GFFGC+ FSK N YL +HG   ++WQ+
Sbjct: 191 RHLVLKAAHPSPLAANRGGFFGCKVFSKTNNYLTQHGIEPIDWQL 235


>gi|304387520|ref|ZP_07369709.1| uracil-DNA glycosylase [Neisseria meningitidis ATCC 13091]
 gi|304338407|gb|EFM04528.1| uracil-DNA glycosylase [Neisseria meningitidis ATCC 13091]
          Length = 219

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|292489106|ref|YP_003531993.1| uracil-DNA-glycosylase [Erwinia amylovora CFBP1430]
 gi|292900226|ref|YP_003539595.1| uracil-DNA glycosylase [Erwinia amylovora ATCC 49946]
 gi|291200074|emb|CBJ47200.1| uracil-DNA glycosylase [Erwinia amylovora ATCC 49946]
 gi|291554540|emb|CBA22126.1| uracil-DNA-glycosylase [Erwinia amylovora CFBP1430]
 gi|312173264|emb|CBX81519.1| uracil-DNA-glycosylase [Erwinia amylovora ATCC BAA-2158]
          Length = 226

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  + R+    + +E+  GK I+P     F AF +T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKEQPYFRDTLAMVAAERASGKTIYPPQKDVFNAFRLTGLGAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+ +PPSLVN+YKEL  D+  F  P HGFLE W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLAFSVLPGVAVPPSLVNIYKELVTDIPGFERPNHGFLESWARQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD+VI  I+ + + +VF+LWG+ AQKK  ++D +RH VL+A
Sbjct: 126 LTVEAGQAHSHAKFGWETFTDNVIAAINQHREGVVFLLWGSHAQKKGSIIDRQRHYVLQA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HFSK NR+L E G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCAHFSKTNRWLSEQGETPIDW 220


>gi|69245050|ref|ZP_00603208.1| Uracil-DNA glycosylase [Enterococcus faecium DO]
 gi|257879252|ref|ZP_05658905.1| uracil-DNA glycosylase [Enterococcus faecium 1,230,933]
 gi|257881930|ref|ZP_05661583.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,502]
 gi|257890081|ref|ZP_05669734.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,410]
 gi|258615653|ref|ZP_05713423.1| uracil-DNA glycosylase [Enterococcus faecium DO]
 gi|260558698|ref|ZP_05830887.1| uracil-DNA glycosylase [Enterococcus faecium C68]
 gi|293554057|ref|ZP_06674655.1| uracil-DNA glycosylase [Enterococcus faecium E1039]
 gi|293559457|ref|ZP_06675994.1| uracil-DNA glycosylase [Enterococcus faecium E1162]
 gi|293567356|ref|ZP_06678706.1| uracil-DNA glycosylase [Enterococcus faecium E1071]
 gi|294618435|ref|ZP_06698007.1| uracil-DNA glycosylase [Enterococcus faecium E1679]
 gi|294621191|ref|ZP_06700377.1| uracil-DNA glycosylase [Enterococcus faecium U0317]
 gi|68196051|gb|EAN10483.1| Uracil-DNA glycosylase [Enterococcus faecium DO]
 gi|257813480|gb|EEV42238.1| uracil-DNA glycosylase [Enterococcus faecium 1,230,933]
 gi|257817588|gb|EEV44916.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,502]
 gi|257826441|gb|EEV53067.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,410]
 gi|260075157|gb|EEW63470.1| uracil-DNA glycosylase [Enterococcus faecium C68]
 gi|291589958|gb|EFF21756.1| uracil-DNA glycosylase [Enterococcus faecium E1071]
 gi|291595307|gb|EFF26628.1| uracil-DNA glycosylase [Enterococcus faecium E1679]
 gi|291599257|gb|EFF30288.1| uracil-DNA glycosylase [Enterococcus faecium U0317]
 gi|291601748|gb|EFF32002.1| uracil-DNA glycosylase [Enterococcus faecium E1039]
 gi|291606519|gb|EFF35916.1| uracil-DNA glycosylase [Enterococcus faecium E1162]
          Length = 226

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSSEFSKDYYLHLREFLKKE-YASQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+   P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELYDDLGIAPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|226354897|ref|YP_002784637.1| uracil-DNA glycosylase [Deinococcus deserti VCD115]
 gi|259563555|sp|C1CXS7|UNG_DEIDV RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226316887|gb|ACO44883.1| putative Uracil-DNA glycosylase [Deinococcus deserti VCD115]
          Length = 248

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 3/218 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SWK  L   F + +   LK+FL+ E+R+   ++P  +  F A   TP   VKV+ILGQDP
Sbjct: 28  SWKEALAEEFAAPYFHALKDFLV-EERRTHTVYPPAADVFNALRYTPLENVKVMILGQDP 86

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+RIPPSL N+YKELQ D+  F PP HG+L+ W  +GVLLLNAV
Sbjct: 87  YHGPGQAHGLSFSVRPGVRIPPSLKNIYKELQSDIPGFTPPRHGYLKAWAEQGVLLLNAV 146

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G A SH G+GWE FTD+VI  ++N  Q +VF+LWGA A+KK  ++    H+++++
Sbjct: 147 LTVRAGEANSHAGKGWESFTDAVIRAVNNRPQRVVFVLWGAYARKKARLITAPHHVIIES 206

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           AHPSPLS +  F G R FS+ N  L+E G+  ++WQ+P
Sbjct: 207 AHPSPLSVTR-FMGTRPFSRVNAALEEAGEAPIDWQLP 243


>gi|167764836|ref|ZP_02436957.1| hypothetical protein BACSTE_03228 [Bacteroides stercoris ATCC
           43183]
 gi|167697505|gb|EDS14084.1| hypothetical protein BACSTE_03228 [Bacteroides stercoris ATCC
           43183]
          Length = 220

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I +SWK+ L+  F  ++   L  F+  E  K   I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEDSWKAHLQPEFDKDYFYTLTNFVREEYGK-YAIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADIGTDAPPTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE FTD+ I +++   +++VF+LWG  AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNRGWETFTDAAIRILAEEREHLVFILWGVYAQRKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSK N YL+ HGK  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSKTNEYLKAHGKEEIKW 220


>gi|331701666|ref|YP_004398625.1| Uracil-DNA glycosylase [Lactobacillus buchneri NRRL B-30929]
 gi|329129009|gb|AEB73562.1| Uracil-DNA glycosylase [Lactobacillus buchneri NRRL B-30929]
          Length = 230

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L+  F+  + + L++FL+SE  K + I P  +H F AF +TPF+KVKVVILG
Sbjct: 5   IKNDWWDVLKPEFEKTYYQQLRQFLISE-YKTQYIHPDMNHIFEAFQLTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QA GL FSV  G++IPPSL N+YKELQ D+   P  HG LE W  +GVLLLN
Sbjct: 64  QDPYHEPHQAQGLSFSVMPGVKIPPSLQNIYKELQSDLGIKPVEHGDLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWEQ TD+ I  +S   + +VF+LWG +A+ K  ++D K ++V+
Sbjct: 124 SVLTVRNGQAFSHKGKGWEQLTDAAIQKLSAREKPVVFILWGRAARDKIALIDTKTNVVI 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG + FSK N  L+  G+  +NWQ+P
Sbjct: 184 QSAHPSPLSAHRGFFGSKPFSKTNEALEAMGEEPINWQLP 223


>gi|266622200|ref|ZP_06115135.1| uracil-DNA glycosylase [Clostridium hathewayi DSM 13479]
 gi|288866103|gb|EFC98401.1| uracil-DNA glycosylase [Clostridium hathewayi DSM 13479]
          Length = 224

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L   F+  + R L + +  E  + +R+FP     F AF  TP ++VKVVILG
Sbjct: 4   IDNDWLEPLSVEFKKPYYRELYKKVKHE-YETRRVFPEADDIFNAFQFTPLSRVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHNYGQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHNYGQAHGLCFSVKPDVEIPPSLVNIYQELHDDLGCDIPNNGYLKKWADQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SH+G GWE FTD+ I +++   + +VF+LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHAANSHQGIGWETFTDAAIKILNEQDRPMVFLLWGRPAQNKKSMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFGCRHFSK N YL+ +G   ++WQI
Sbjct: 183 EAPHPSPLSAFRGFFGCRHFSKTNEYLKANGLEPIDWQI 221


>gi|116333320|ref|YP_794847.1| uracil-DNA glycosylase [Lactobacillus brevis ATCC 367]
 gi|122269992|sp|Q03SK6|UNG_LACBA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|116098667|gb|ABJ63816.1| Uracil-DNA glycosylase [Lactobacillus brevis ATCC 367]
          Length = 239

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 156/222 (70%), Gaps = 3/222 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +LE  F+  + + L+ FL+ E+ +  RI P   H F AF+ TPF++VKVVILG
Sbjct: 5   IHNDWWPVLEPEFEKPYYQELRRFLV-EEYQHYRIDPDMYHIFTAFEWTPFSQVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHG  FSV  G  IPPSLVN+YKELQ+D+   P  HG+L+HW  +GVLLLN
Sbjct: 64  QDPYHNPGQAHGCSFSVLPGTEIPPSLVNIYKELQDDLGVQPVQHGYLKHWADQGVLLLN 123

Query: 126 AVLTVEEG--RAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +VLTV +G   A +HRG GWEQ TDS I+ +S   + ++F+LWG++A+ K  ++D + ++
Sbjct: 124 SVLTVRDGIKTANTHRGHGWEQLTDSAIEKLSARPEPVIFILWGSAARSKIKLIDTQTNI 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL++ HPSPLSA  GFFG + FSK N  L   G+T ++WQ+P
Sbjct: 184 VLQSPHPSPLSAYRGFFGSKPFSKTNIALTSLGETPIDWQLP 225


>gi|251791912|ref|YP_003006632.1| uracil-DNA glycosylase [Aggregatibacter aphrophilus NJ8700]
 gi|247533299|gb|ACS96545.1| uracil-DNA glycosylase [Aggregatibacter aphrophilus NJ8700]
          Length = 222

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 153/218 (70%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  ++    Q  + + + + + +E+  GK I+P     F AF +T F++VKVVILGQD
Sbjct: 2   KTWTDVIGQEKQQPYFQQVLQRVHAERDAGKVIYPPAHDVFNAFKLTEFDQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++ PPSL+N+YKEL  D+ +F  P HG+L  W  +GVLLLNA
Sbjct: 62  PYHGPNQAHGLSFSVKPGVKPPPSLLNMYKELSTDIADFQIPNHGYLVEWAQQGVLLLNA 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV++G A SH G GWE FTD VI+ ++ + +N+VF+LWG+ AQKK   +D ++H VL 
Sbjct: 122 VLTVQQGLAHSHAGWGWEIFTDKVIEALNQHRENLVFLLWGSPAQKKGQFIDRQKHCVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFGCRHFSKAN YLQ+H    ++WQ+
Sbjct: 182 SVHPSPLSAHRGFFGCRHFSKANAYLQQHHIEPIDWQL 219


>gi|300909248|ref|ZP_07126709.1| uracil-DNA glycosylase [Lactobacillus reuteri SD2112]
 gi|300893113|gb|EFK86472.1| uracil-DNA glycosylase [Lactobacillus reuteri SD2112]
          Length = 244

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 20  IHNDWWEVLKPQFESAYYAQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 78

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+  IP  HG+L+ W  +GVLLLN
Sbjct: 79  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCIPVNHGYLKKWADQGVLLLN 138

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 139 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 198

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 199 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 238


>gi|257870101|ref|ZP_05649754.1| uracil-DNA glycosylase [Enterococcus gallinarum EG2]
 gi|257804265|gb|EEV33087.1| uracil-DNA glycosylase [Enterococcus gallinarum EG2]
          Length = 229

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 155/220 (70%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W+ +L+  F   + + L+EFL  E    ++I P   H + A  +TP+++VKVVILG
Sbjct: 5   LENDWQEVLQASFDQTYYQQLREFLKVE-YATQKIHPAMDHIYEALKLTPYHEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+RIPPSL N+YKELQ D+   P +HG+L  W  +G+LLLN
Sbjct: 64  QDPYHGPHQAHGLSFSVQPGVRIPPSLRNIYKELQSDLGIAPVSHGYLVPWAQQGILLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + ++F+LWG  AQ+K+ ++D K+H+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNQRDKPVIFVLWGKPAQQKKALIDTKKHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSAS GFFG + FSK N+ L    +T ++WQ+P
Sbjct: 184 ESPHPSPLSASRGFFGSKPFSKINQALIALDETPIDWQLP 223


>gi|227545082|ref|ZP_03975131.1| uracil-DNA glycosylase [Lactobacillus reuteri CF48-3A]
 gi|227184931|gb|EEI65002.1| uracil-DNA glycosylase [Lactobacillus reuteri CF48-3A]
          Length = 245

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 21  IHNDWWEVLKPQFESAYYAQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 79

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+  IP  HG+L+ W  +GVLLLN
Sbjct: 80  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCIPVNHGYLKKWADQGVLLLN 139

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 140 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 199

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 200 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 239


>gi|77361476|ref|YP_341051.1| uracil-DNA glycosylase [Pseudoalteromonas haloplanktis TAC125]
 gi|123587918|sp|Q3IG47|UNG_PSEHT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|76876387|emb|CAI87609.1| uracil-DNA-glycosylase [Pseudoalteromonas haloplanktis TAC125]
          Length = 220

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 145/217 (66%), Gaps = 2/217 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W + L+   Q  +M+   +++   + +G  ++P     F AF  T  + ++VVILGQDPY
Sbjct: 4   WTAFLKQELQQAYMQQTLDYVAKRRSEGVAVYPPKDQVFSAFTATQLSDIRVVILGQDPY 63

Query: 70  HNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           H  GQAHGLCFSV P   ++PPSL N+YKEL  D+N F+ PTHG+L+ W  +GV LLN V
Sbjct: 64  HGEGQAHGLCFSVLPEVKKLPPSLKNIYKELASDINDFVIPTHGYLQSWAEQGVFLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH+  GWEQFTD VI  I+ + + ++F+LWGA AQKK   +D  R  +L  
Sbjct: 124 LTVEQGQAHSHKHLGWEQFTDKVITHINTHCEGVIFILWGAHAQKKGKGIDSARQHILAG 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS  N  LQ  GKT +NWQ+
Sbjct: 184 PHPSPLSAHRGFFGCRHFSATNALLQSQGKTPINWQV 220


>gi|153951537|ref|YP_001397343.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. doylei 269.97]
 gi|166201515|sp|A7H1G3|UNG_CAMJD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|152938983|gb|ABS43724.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. doylei 269.97]
          Length = 231

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNIIIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           +VILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IVILGQDPYHQENQAMGLSFSVPKNVKIPPSLNNIFKELQNDLNITPAKSGDLSFWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D+VI  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAVIHKLSNEKSGLVFMLWGNYAKSKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPIDWKI 230


>gi|6435747|pdb|2EUG|A Chain A, Crystal Structure Of Escherichia Coli Uracil Dna
           Glycosylase And Its Complexes With Uracil And Glycerol:
           Structure And Glycosylase Mechanism Revisited
 gi|6435749|pdb|3EUG|A Chain A, Crystal Structure Of Escherichia Coli Uracil Dna
           Glycosylase And Its Complexes With Uracil And Glycerol:
           Structure And Glycosylase Mechanism Revisited
          Length = 229

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  H  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220


>gi|261868611|ref|YP_003256533.1| hypothetical protein D11S_1960 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413943|gb|ACX83314.1| hypothetical protein D11S_1960 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 222

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 114/217 (52%), Positives = 151/217 (69%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +WK ++    Q  + + +   + +E+ +GK I+P     F AF +T F +VKVVILGQDP
Sbjct: 3   TWKDVIGQEKQQPYFQQVLGRVHAEREQGKIIYPPAPDVFNAFKLTEFEQVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+R PPSLVN+Y+EL +D+  F  P HG L  W  +GVLLLN+V
Sbjct: 63  YHGPNQAHGLSFSVKHGVRPPPSLVNIYQELSKDIEGFQIPNHGCLLEWAQQGVLLLNSV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI+ +++  +N+VF+LWG+ AQKK   +D ++H VL +
Sbjct: 123 LTVEQGLAHSHANWGWEIFTDKVIETLNSQRENLVFLLWGSPAQKKGRFIDRQKHCVLTS 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS+AN YLQ+H  T +NWQ+
Sbjct: 183 VHPSPLSAHRGFFGCRHFSQANAYLQQHHITPINWQL 219


>gi|120435977|ref|YP_861663.1| uracil-DNA glycosylase [Gramella forsetii KT0803]
 gi|166200401|sp|A0M1V1|UNG_GRAFK RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|117578127|emb|CAL66596.1| uracil-DNA glycosylase [Gramella forsetii KT0803]
          Length = 221

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 153/220 (69%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I +SWK+ L+N F+ E+  NL  ++  E  + K  FP G+  F AFD + F   KVVI
Sbjct: 3   VRIDQSWKNKLDNEFEKEYFENLITYIKDEYSEHK-CFPPGNEIFAAFDYSSFEDTKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCFSV  G+  PPSL+N++KE++ D+N   P+ G LE W ++GVLL
Sbjct: 62  LGQDPYHGIGQANGLCFSVKDGVAFPPSLINIFKEIESDLNKPIPSTGNLERWANQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA L+V   +A SH+ +GWE FTD VI ++S   +N+VF+LWG  A+KK  ++D+ +HL
Sbjct: 122 LNATLSVRAHQAGSHQNKGWETFTDQVIRIVSETKENVVFLLWGGYAKKKTKLIDNSKHL 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG +HFSK N YL+  G+  + W
Sbjct: 182 ILTSGHPSPLSANRGYWFGNKHFSKTNEYLKSQGEQPIEW 221


>gi|325266584|ref|ZP_08133261.1| uracil-DNA glycosylase [Kingella denitrificans ATCC 33394]
 gi|324982027|gb|EGC17662.1| uracil-DNA glycosylase [Kingella denitrificans ATCC 33394]
          Length = 228

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  +L    Q  + + + + + +E+  G+ ++P     F AF  TP++KVKVVILGQD
Sbjct: 10  KTWTDVLGQEKQKPYFQAVLQQVRAERAAGQTVYPPEKEVFNAFRYTPWDKVKVVILGQD 69

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYHN  QAHGL FSV  G  IPPSL N+YKEL  D+  F  P HG L  W  +GVLLLN 
Sbjct: 70  PYHNEHQAHGLAFSVQKGCDIPPSLANIYKELSNDIAGFQMPAHGCLTDWAEQGVLLLNT 129

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV   +A SH G GWE FTD+VI  ++    ++VF+LWG+ AQKK   LD  RHLVL+
Sbjct: 130 VLTVRAHQAHSHAGLGWETFTDTVIRALNEYGSHLVFLLWGSHAQKKAAWLDESRHLVLR 189

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YLQ HG   ++WQI
Sbjct: 190 APHPSPLSAYRGFFGCRHFSQANAYLQAHGLAPIDWQI 227


>gi|325206002|gb|ADZ01455.1| uracil-DNA glycosylase [Neisseria meningitidis M04-240196]
          Length = 219

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|312068098|ref|XP_003137054.1| uracil-DNA glycosylase [Loa loa]
 gi|307767776|gb|EFO27010.1| uracil-DNA glycosylase [Loa loa]
          Length = 292

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (69%), Gaps = 2/214 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L   F+ E+M  + +FL  EK KG +IFP     F AF++TP  +++VV++GQDPY
Sbjct: 77  WRRVLLVEFRKEYMDKIVKFLQMEKEKGVKIFPPQHQIFNAFNLTPLKQIRVVLIGQDPY 136

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVL 128
           H   QAHGLCFSV  G+R+PPSL+N+YKEL+ D+ NF  P HG LE W H+GV +LNA L
Sbjct: 137 HGENQAHGLCFSVCKGVRLPPSLINIYKELKMDIPNFKVPDHGCLESWAHQGVFMLNATL 196

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE  R  SH   GW++FTD VI +IS   + IVF+LWG  A KK+ ++D K+H+V+K A
Sbjct: 197 TVEAHRPNSHNHIGWQKFTDEVIRIISRECKGIVFLLWGGFAHKKEYIIDKKKHIVIKTA 256

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           HPSPLSA   FFGC+ FS+ N  L + G+  ++W
Sbjct: 257 HPSPLSARM-FFGCKCFSRTNEALVKLGQPAIDW 289


>gi|325263502|ref|ZP_08130236.1| uracil-DNA glycosylase [Clostridium sp. D5]
 gi|324031211|gb|EGB92492.1| uracil-DNA glycosylase [Clostridium sp. D5]
          Length = 222

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W   LE  F+  + + L + +  E R  ++IFP  +  F AF +TP   VKVVILG
Sbjct: 4   LNGDWYEALEGEFKKPYYKELFKTVNQEYRT-RKIFPPANDIFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ +PPSLVN+Y+EL +D+    P+HG L  W  +GVL+LN
Sbjct: 63  QDPYHNDGQAHGLCFSVKKGVEVPPSLVNIYQELHDDLGCTIPSHGCLTKWAQQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  + +  + IVF+LWG+ AQ+K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMALGSQDRPIVFILWGSPAQRKKAMLNNPQHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N YL  HG   V+WQI
Sbjct: 183 QAPHPSPLSAYRGFFGSRPFSQTNEYLSSHGVEPVDWQI 221


>gi|293571428|ref|ZP_06682456.1| uracil-DNA glycosylase [Enterococcus faecium E980]
 gi|291608500|gb|EFF37794.1| uracil-DNA glycosylase [Enterococcus faecium E980]
          Length = 226

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L   F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSPEFSKDYYLHLREFLKKE-YASQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+   P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELNDDLGIAPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D  RH+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|161870064|ref|YP_001599235.1| uracil-DNA glycosylase [Neisseria meningitidis 053442]
 gi|189037442|sp|A9LZA2|UNG_NEIM0 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|161595617|gb|ABX73277.1| uracil-DNA glycosylase [Neisseria meningitidis 053442]
          Length = 219

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLAAHRKHLVFMLWGGYAQQKRKLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|311746140|ref|ZP_07719925.1| uracil-DNA glycosylase [Algoriphagus sp. PR1]
 gi|126576361|gb|EAZ80639.1| uracil-DNA glycosylase [Algoriphagus sp. PR1]
          Length = 220

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/219 (52%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +KI  SWK  L++HF  +    L  F+  E  K K +FP G   F AF   P N+VKVVI
Sbjct: 3   IKIESSWKEALKHHFLKDSFMKLTSFVKDEYSKDK-VFPPGKEIFSAFWHCPLNEVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  GI  PPSL+N+ KEL+ D+    P +G L  W  +GV L
Sbjct: 62  LGQDPYHGPGQAHGLSFSVKPGIPFPPSLLNILKELKSDLGLDLPPNGDLTRWADQGVFL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD VI +IS   + +VF+LWGA AQKK  ++D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQKKGWEEFTDEVIQVISKEREGVVFLLWGAYAQKKALLIDETKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LKA HPSPLSA  GF GC+HFSK N YL   GK  + W
Sbjct: 182 ILKAPHPSPLSAHRGFLGCKHFSKTNEYLLSKGKEPIKW 220


>gi|218708535|ref|YP_002416156.1| uracil-DNA glycosylase [Vibrio splendidus LGP32]
 gi|218321554|emb|CAV17506.1| Uracil-DNA glycosylase [Vibrio splendidus LGP32]
          Length = 224

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+S++ +    E+ +++  F+  ++  GK ++P     F AFD+TPF  V+VVILGQD
Sbjct: 5   KTWESIINDERDKEYFQSVLAFVEQQRNSGKTVYPPQEQVFSAFDMTPFESVRVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++IPPSL N+YKEL +D+  F  P+HG+L+ W  +GVL+LN 
Sbjct: 65  PYHGANQAHGLAFSVLPGVKIPPSLRNMYKELAQDIEGFEIPSHGYLDSWASQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEE +A SH   GWE FTD++I  ++   + I+F+LWGA AQKK   +D  +H VL 
Sbjct: 125 VLTVEEAKAHSHAKCGWETFTDAIIAELNQRSEPIIFLLWGAHAQKKGQAIDADKHHVLV 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPLSA  GFFGC+HFS  N+ L    + +++W++P
Sbjct: 185 APHPSPLSARRGFFGCQHFSTTNKLLSSMDQQSIDWRLP 223


>gi|146281600|ref|YP_001171753.1| uracil-DNA glycosylase [Pseudomonas stutzeri A1501]
 gi|145569805|gb|ABP78911.1| uracil-DNA glycosylase [Pseudomonas stutzeri A1501]
          Length = 206

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 140/203 (68%)

Query: 23  MRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSV 82
           M  L  FL  EK  GK I+P G   F A + TP  +VKVVILGQDPYH  GQAHGLCFSV
Sbjct: 1   MVELGAFLRREKAAGKTIYPPGPMIFNALNSTPLEQVKVVILGQDPYHGPGQAHGLCFSV 60

Query: 83  PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRG 142
             G+  PPSL N++KEL+ D+N   P HG+L+ W  +GVL+LN  LTVE G A SH   G
Sbjct: 61  QPGVAPPPSLQNIFKELKRDLNLDIPQHGYLQRWAEQGVLMLNTSLTVERGLAGSHAKAG 120

Query: 143 WEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGC 202
           W+QFTD +I+++     ++VFMLWGA AQ K  ++D  RHL+LK+ HPSPLSA  GF G 
Sbjct: 121 WQQFTDRIIEVVGERRPHLVFMLWGAHAQSKAKLIDATRHLMLKSVHPSPLSAHRGFIGN 180

Query: 203 RHFSKANRYLQEHGKTTVNWQIP 225
            HFS+AN++L++ G   ++WQ+P
Sbjct: 181 GHFSRANQFLRQQGMQPIDWQLP 203


>gi|284035180|ref|YP_003385110.1| uracil-DNA glycosylase [Spirosoma linguale DSM 74]
 gi|283814473|gb|ADB36311.1| uracil-DNA glycosylase [Spirosoma linguale DSM 74]
          Length = 221

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 152/220 (69%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I ESW++ L+  F   +   L +FL  E    +R+FP G+  F AFD   F+  +VVI
Sbjct: 3   VSIAESWRNRLQPEFDKPYFSELAQFLRHEYST-QRVFPPGALMFNAFDKCSFDDTRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GL FSV  GI  PPSL+N++KE+Q+D+    P  G LE W  +GV+L
Sbjct: 62  LGQDPYHGEGQANGLAFSVADGITKPPSLINIFKEIQDDLGKPIPKSGNLERWASQGVML 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV  G+A SH+G+GWE FTD+VI LIS   ++ VFMLWGA AQKK  V+D K+HL
Sbjct: 122 LNATLTVRAGQAGSHQGKGWETFTDAVIKLISEEKEHGVFMLWGAFAQKKGAVIDGKKHL 181

Query: 184 VLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNW 222
           +LKA HPSP++A++ G+FG +HFS+AN YL+  G   V W
Sbjct: 182 ILKAKHPSPMAANYGGWFGNKHFSQANAYLESKGLAPVEW 221


>gi|296446131|ref|ZP_06888079.1| uracil-DNA glycosylase [Methylosinus trichosporium OB3b]
 gi|296256325|gb|EFH03404.1| uracil-DNA glycosylase [Methylosinus trichosporium OB3b]
          Length = 222

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V++ ESWK+ L       +   L+ F+ +E  +G  ++P     FRAFD  PF+ V+ VI
Sbjct: 5   VRLDESWKARLTGELDQPYFAELRRFVRAEYERGP-VYPPAKQIFRAFDECPFDAVEAVI 63

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCF+V   +  PPSL N++KE++ D+         L  W  +GVLL
Sbjct: 64  LGQDPYHGAGQANGLCFAVERTVAPPPSLQNIFKEIENDLGRPVSRDPDLSRWARQGVLL 123

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV EG A SH+G+GWE+FTD+ +  +S   + IVF+LWGA A++K   +D +RHL
Sbjct: 124 LNATLTVREGAAGSHQGKGWERFTDAAVAALSREREGIVFLLWGAYARQKGAGVDRRRHL 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL+ AHPSPLSA +GFFGCRHFSKAN YL+  G   + W
Sbjct: 184 VLECAHPSPLSARNGFFGCRHFSKANAYLEARGAAPIEW 222


>gi|294637626|ref|ZP_06715905.1| uracil-DNA glycosylase [Edwardsiella tarda ATCC 23685]
 gi|291089181|gb|EFE21742.1| uracil-DNA glycosylase [Edwardsiella tarda ATCC 23685]
          Length = 238

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 144/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + R+   F+ +E++ GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 12  TWHDVIGAEKEQPYFRDTLAFVAAERQNGKTIYPPQQDVFNAFRFTEFNDVKVVILGQDP 71

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKELQ D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 72  YHGPNQAHGLSFSVRPGVATPPSLQNMYKELQNDIPGFTIPPHGYLKSWADQGVLLLNTV 131

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWEQFTD V+  +++  + IVF+LWGA AQKK  ++D +RH VLKA
Sbjct: 132 LTVERGQAHSHAHLGWEQFTDRVVAALNSQREGIVFLLWGAHAQKKGRIIDSQRHHVLKA 191

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC HFS  NR LQE G   ++WQ
Sbjct: 192 PHPSPLSAHRGFLGCGHFSATNRLLQEQGLAPIDWQ 227


>gi|13096539|pdb|1FLZ|A Chain A, Uracil Dna Glycosylase With Uaap
          Length = 228

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  H  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 5   TWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 65  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 125 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 185 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 219


>gi|228473666|ref|ZP_04058416.1| uracil-DNA glycosylase [Capnocytophaga gingivalis ATCC 33624]
 gi|228274880|gb|EEK13695.1| uracil-DNA glycosylase [Capnocytophaga gingivalis ATCC 33624]
          Length = 222

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 153/221 (69%), Gaps = 2/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I  SWKSLL   F+  + ++L +F+  E ++    +P+G   F AFD  P +K+KVV+
Sbjct: 3   VHISPSWKSLLSEEFEKPYFKSLTDFVKKEYKE-HTCYPKGKDIFAAFDQCPIDKLKVVL 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GL FSV  GI  PPSLVN++KE+QED+N   P  G L  W  +GVLL
Sbjct: 62  LGQDPYHGEGQANGLSFSVNEGIAHPPSLVNIFKEIQEDINVPYPESGNLSRWAQQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE FTD+VI L+S+N Q +VF+LWG  A+KK  ++D K+H 
Sbjct: 122 LNATLTVRANQAGSHQHQGWETFTDTVIKLVSDNCQGVVFLLWGGFAKKKTSLIDTKKHC 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNWQ 223
           VL + HPSPLSA+ G+ FG +HFS+AN YL   GK  ++W+
Sbjct: 182 VLTSGHPSPLSANRGYWFGNKHFSQANAYLSSVGKEIIDWK 222


>gi|238920933|ref|YP_002934448.1| uracil-DNA glycosylase, [Edwardsiella ictaluri 93-146]
 gi|238870502|gb|ACR70213.1| uracil-DNA glycosylase, putative [Edwardsiella ictaluri 93-146]
          Length = 256

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 144/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++       + R+   F+ +E+  GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 31  TWHDVIGAEKDQPYFRDTLTFVATERSNGKTIYPPQQDVFNAFRFTEFNDVKVVILGQDP 90

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL+ D+  F  P+HG+L+ W  +GVLLLN V
Sbjct: 91  YHGPNQAHGLSFSVLPGVPTPPSLQNMYKELKSDIPGFEIPSHGYLKSWADQGVLLLNTV 150

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWEQFTD V++ +++    IVF+LWGA AQKK  ++D +RH VLKA
Sbjct: 151 LTVERGQAHSHAQLGWEQFTDRVVEALNSQRSGIVFLLWGAHAQKKGRIIDTQRHRVLKA 210

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFS  N+ LQE G   ++WQ
Sbjct: 211 PHPSPLSAHRGFLGCRHFSMTNQLLQEQGMAPIDWQ 246


>gi|124009527|ref|ZP_01694202.1| uracil-DNA glycosylase [Microscilla marina ATCC 23134]
 gi|123984873|gb|EAY24841.1| uracil-DNA glycosylase [Microscilla marina ATCC 23134]
          Length = 218

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 150/219 (68%), Gaps = 3/219 (1%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SWK  L+  F+  + ++L  F+  E    + ++P G+  F AFD +PF++ +VVI
Sbjct: 3   VKIADSWKEKLQEEFEKSYFKDLVAFVKDEYL-SQTVYPPGNQIFNAFDKSPFDRTRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+RIPPSL N++KE+ +D+    P  G LE W  +GVLL
Sbjct: 62  IGQDPYHGAGQANGLCFSVSDGVRIPPSLRNIFKEINQDLGKDIPKSGNLERWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV    A SH+ +GWEQFTD+VI  IS+  +N+VF+LWG  A+ K  V+D  +H 
Sbjct: 122 LNATLTVRAKTAGSHQNKGWEQFTDAVIKAISDEKENVVFLLWGRYARDKGKVVDRNKHC 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL+A HPSP+  + GF GCRHFS+AN +L+  G   ++W
Sbjct: 182 VLEAPHPSPM--AKGFVGCRHFSRANEFLKSKGLAEIDW 218


>gi|198275593|ref|ZP_03208124.1| hypothetical protein BACPLE_01758 [Bacteroides plebeius DSM 17135]
 gi|198271222|gb|EDY95492.1| hypothetical protein BACPLE_01758 [Bacteroides plebeius DSM 17135]
          Length = 220

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I E WK  L   F+ ++   L +F+  E ++   ++P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEEGWKKALAPEFEKDYFVRLTDFVRQEYQQ-TTVYPPGRLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+ +D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVAFPPSLQNIFKEIHDDLGMPIPASGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ RGWE+FTD+ I +++   +++VF+LWGA AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRRGWEEFTDAAIRVLAEQKEHLVFILWGAYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA +GFFG +HFS+ N YL  HG+T +NW
Sbjct: 182 VLTSVHPSPLSAYNGFFGNKHFSRTNEYLVAHGETPINW 220


>gi|293391852|ref|ZP_06636186.1| uracil-DNA glycosylase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952386|gb|EFE02505.1| uracil-DNA glycosylase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 222

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +WK ++    Q  + + +   + +E+ +GK I+P     F AF +T F +VKVVILGQDP
Sbjct: 3   TWKDVIGQEKQQPYFQQVLGRVHAEREQGKIIYPPAPDVFNAFKLTEFEQVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+R PPSLVN+Y+EL +D++ F  P HG L  W  +GVLLLN+V
Sbjct: 63  YHGPNQAHGLSFSVKHGVRPPPSLVNIYQELSKDIDGFQIPNHGCLLEWAQQGVLLLNSV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI+ +++  +N+VF+LWG+ AQKK   +D ++H VL +
Sbjct: 123 LTVEQGLAHSHANWGWEIFTDKVIETLNSQRENLVFVLWGSPAQKKGRFIDRQKHCVLTS 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGCRHFS+AN YLQ+H    +NWQ+ L
Sbjct: 183 VHPSPLSAHRGFFGCRHFSQANAYLQQHHIAPINWQLTL 221


>gi|167077379|gb|ABZ10911.1| uracil-DNA glycosylase [Bacillus sp. HJ171]
          Length = 245

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 149/226 (65%), Gaps = 1/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ V++ E WK  L N   S +M +L+ FL    +    I+P     F A ++TP ++VK
Sbjct: 19  LDNVRLPEDWKKALANELTSNNMDDLRAFLKEAYQSENSIYPPAPLIFNALNLTPLSQVK 78

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP  I  PPSL N+ KE+  DV   P  HG L +W  +G
Sbjct: 79  VVILGQDPYHGPGQAMGLSFSVPKAIPKPPSLNNLLKEMASDVGIAPSKHGDLTYWAQQG 138

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTV E    SH+  GWEQFTD+VID+++   ++ VF+LWG+ AQKK   ++  
Sbjct: 139 VLLLNSSLTVRESEPNSHQNNGWEQFTDAVIDVVNEQTEHTVFILWGSKAQKKGKYINTD 198

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HL+L A HPSPL+A+  GFFG + FSK N YL ++G+T ++WQ+P
Sbjct: 199 KHLILTAVHPSPLAANRGGFFGSKPFSKTNDYLVQYGQTPIDWQLP 244


>gi|260555187|ref|ZP_05827408.1| uracil-DNA glycosylase [Acinetobacter baumannii ATCC 19606]
 gi|260411729|gb|EEX05026.1| uracil-DNA glycosylase [Acinetobacter baumannii ATCC 19606]
          Length = 237

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 157/225 (69%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  V++ ESWK  L     S +M +L++FL  +K+  K I+P     F A +ITP + VK
Sbjct: 11  LSKVQLEESWKRSLIPFLLSPYMDSLRDFLFQQKQAQKIIYPPSKQIFNALNITPLDHVK 70

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QA+GL FSV  G+ +PPSL N++ EL  D+      HG L  W  +G
Sbjct: 71  VVILGQDPYHGPNQANGLSFSVQRGVALPPSLRNIFHELHTDLGVPVSRHGDLTKWAEQG 130

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+VLTVE G+  SH+ +GWE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ +
Sbjct: 131 VLLLNSVLTVEAGQPTSHQKQGWEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINRE 190

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL+A+  GFFGC+ FSK N+YL++HG   ++WQ+
Sbjct: 191 KHLVLTAAHPSPLAANRGGFFGCKVFSKTNQYLKQHGIEPIDWQL 235


>gi|119713592|gb|ABL97643.1| uracil-DNA glycosylase [uncultured marine bacterium EB0_39H12]
          Length = 226

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 112/217 (51%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I  SW + L +  +  ++  L  FL+ EK K + I+P   + F +  +TP NK KVVILG
Sbjct: 9   IDISWLNQLSSELKKSYLDELWNFLMKEKLKDRIIYPTEENIFSSLKLTPLNKTKVVILG 68

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQA+GL FSV   + IPPSL N++KE+ +D+N  PP +G L  W  +GVLLLN
Sbjct: 69  QDPYHGPGQANGLAFSVNKEVSIPPSLNNIFKEVSDDLNRPPPKNGDLTFWAKQGVLLLN 128

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE+    SH G GWE+FTD +++++ N  +NIVF+LWGA AQ+K  ++D  RH + 
Sbjct: 129 TVLTVEDSHPDSHAGHGWEEFTDRIVEIL-NLKKNIVFLLWGAKAQRKGLMIDQNRHKIF 187

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            A HPSPLSA  GFFGC+HFSKAN+YLQE GK  + W
Sbjct: 188 YAPHPSPLSAYKGFFGCKHFSKANQYLQEKGKKPICW 224


>gi|78777759|ref|YP_394074.1| uracil-DNA glycosylase [Sulfurimonas denitrificans DSM 1251]
 gi|123549908|sp|Q30Q92|UNG_SULDN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|78498299|gb|ABB44839.1| Uracil-DNA glycosylase [Sulfurimonas denitrificans DSM 1251]
          Length = 223

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 116/224 (51%), Positives = 147/224 (65%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M  +KI  SW+ +L + FQ  +  +LKEFL+ EK+K   ++P  S+ F AF+ TPF  VK
Sbjct: 1   MIDLKIESSWREVLLDEFQKPYFNSLKEFLVGEKQK-YTLYPHSSNIFAAFESTPFESVK 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QAHGL FSV  G+  PPSL N++KEL +D+    P  G L  W  EG
Sbjct: 60  VVILGQDPYHGVNQAHGLAFSVNDGVPPPPSLCNIFKELHDDIGCEIPKSGNLMSWAKEG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           V LLN VL+V    A SH+ RGWE FTD+VI L+S   +N+VF+LWGA A  K  ++D K
Sbjct: 120 VFLLNTVLSVRASEANSHKNRGWEVFTDTVIRLLSEKKENLVFILWGAPAGAKASLIDEK 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKA HPSPLS+  GFFG + FSK + YL   G   V W I
Sbjct: 180 KHLILKAPHPSPLSSYRGFFGSKPFSKTDEYLISKGLKPVEWCI 223


>gi|59801200|ref|YP_207912.1| uracil-DNA glycosylase [Neisseria gonorrhoeae FA 1090]
 gi|194098589|ref|YP_002001651.1| uracil-DNA glycosylase [Neisseria gonorrhoeae NCCP11945]
 gi|239998966|ref|ZP_04718890.1| uracil-DNA glycosylase [Neisseria gonorrhoeae 35/02]
 gi|240112885|ref|ZP_04727375.1| uracil-DNA glycosylase [Neisseria gonorrhoeae MS11]
 gi|240117934|ref|ZP_04731996.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID1]
 gi|240125737|ref|ZP_04738623.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-92-679]
 gi|240128192|ref|ZP_04740853.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493754|ref|ZP_05106925.1| uracil-DNA glycosylase [Neisseria gonorrhoeae 1291]
 gi|268594811|ref|ZP_06128978.1| uracil-DNA glycosylase [Neisseria gonorrhoeae 35/02]
 gi|268598968|ref|ZP_06133135.1| uracil-DNA glycosylase [Neisseria gonorrhoeae MS11]
 gi|268603647|ref|ZP_06137814.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID1]
 gi|268684332|ref|ZP_06151194.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-92-679]
 gi|268686590|ref|ZP_06153452.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-93-1035]
 gi|293399064|ref|ZP_06643229.1| uracil-DNA glycosylase [Neisseria gonorrhoeae F62]
 gi|75507381|sp|Q5F8I7|UNG_NEIG1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238690201|sp|B4RLL6|UNG_NEIG2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|59718095|gb|AAW89500.1| putative uracil-DNA glycosylase [Neisseria gonorrhoeae FA 1090]
 gi|193933879|gb|ACF29703.1| uracil-DNA glycosylase [Neisseria gonorrhoeae NCCP11945]
 gi|226512794|gb|EEH62139.1| uracil-DNA glycosylase [Neisseria gonorrhoeae 1291]
 gi|268548200|gb|EEZ43618.1| uracil-DNA glycosylase [Neisseria gonorrhoeae 35/02]
 gi|268583099|gb|EEZ47775.1| uracil-DNA glycosylase [Neisseria gonorrhoeae MS11]
 gi|268587778|gb|EEZ52454.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID1]
 gi|268624616|gb|EEZ57016.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-92-679]
 gi|268626874|gb|EEZ59274.1| uracil-DNA glycosylase [Neisseria gonorrhoeae SK-93-1035]
 gi|291610478|gb|EFF39588.1| uracil-DNA glycosylase [Neisseria gonorrhoeae F62]
 gi|317164258|gb|ADV07799.1| uracil-DNA glycosylase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 219

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPEADVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +G+LLLN 
Sbjct: 62  PYHGVGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGILLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|312870284|ref|ZP_07730412.1| uracil-DNA glycosylase [Lactobacillus oris PB013-T2-3]
 gi|311094168|gb|EFQ52484.1| uracil-DNA glycosylase [Lactobacillus oris PB013-T2-3]
          Length = 240

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S+    L +FL +E    + I+P   H F AF+ TPF+ VKVVILG
Sbjct: 5   IHNDWWDVLKPQFESQSYSQLHDFLKTEYTH-RTIYPEMHHIFEAFEWTPFHNVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ DV F P  HG+L+HW  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGCSFSVLPGVAVPPSLQNIYKELQSDVGFQPVNHGYLKHWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   Q +VF+LWG +A+ K+ +++   +++L
Sbjct: 124 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPQPVVFILWGRAARDKKKLINTNTNIIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 184 ESPHPSPLSANRGFFGSRPFSKTNEALQAMGEKPIDWQLP 223


>gi|332686229|ref|YP_004456003.1| uracil-DNA glycosylase, family 1 [Melissococcus plutonius ATCC
           35311]
 gi|332370238|dbj|BAK21194.1| uracil-DNA glycosylase, family 1 [Melissococcus plutonius ATCC
           35311]
          Length = 231

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 164/220 (74%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+S+LE+ F  E+   L++FL  E+   K+++P   H F A ++TPF KVKVVILG
Sbjct: 5   IHNSWQSVLEDEFSKEYYIALRQFL-KEEYTHKKVYPDMYHIFSALELTPFEKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV   ++IPPSL+N+YKEL+ D+ + P +HGFLE W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPCVKIPPSLMNIYKELEADLGYAPVSHGFLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV+ G+A SH+G+GWE  TD++I  ++   + +VF+LWG  AQ+K  +++ ++H+++
Sbjct: 124 TVLTVQAGQAYSHQGKGWENLTDAIIKKLNEREKPVVFILWGRPAQEKIKMINTQKHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K++HPSPLS+  GFFG + FSKAN+ L++ G+T +NWQ+P
Sbjct: 184 KSSHPSPLSSHRGFFGSKPFSKANQALEKLGETPINWQLP 223


>gi|283955530|ref|ZP_06373025.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792991|gb|EFC31765.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 1336]
          Length = 231

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAIDQNIIIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           ++ILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFKELQNDLNITPTKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEASKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKSKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  V+W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPVDWKI 230


>gi|15677095|ref|NP_274247.1| uracil-DNA glycosylase [Neisseria meningitidis MC58]
 gi|121634910|ref|YP_975155.1| uracil-DNA glycosylase [Neisseria meningitidis FAM18]
 gi|25009538|sp|Q9JZA1|UNG_NEIMB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166200411|sp|A1KU26|UNG_NEIMF RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|7226461|gb|AAF41604.1| uracil-DNA glycosylase [Neisseria meningitidis MC58]
 gi|120866616|emb|CAM10367.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|316985074|gb|EFV64027.1| uracil-DNA glycosylase [Neisseria meningitidis H44/76]
 gi|325132215|gb|EGC54909.1| uracil-DNA glycosylase [Neisseria meningitidis M6190]
 gi|325138198|gb|EGC60768.1| uracil-DNA glycosylase [Neisseria meningitidis ES14902]
 gi|325140548|gb|EGC63069.1| uracil-DNA glycosylase [Neisseria meningitidis CU385]
 gi|325142406|gb|EGC64812.1| uracil-DNA glycosylase [Neisseria meningitidis 961-5945]
 gi|325198353|gb|ADY93809.1| uracil-DNA glycosylase [Neisseria meningitidis G2136]
 gi|325200148|gb|ADY95603.1| uracil-DNA glycosylase [Neisseria meningitidis H44/76]
          Length = 219

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|157414399|ref|YP_001481655.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 81116]
 gi|172046986|sp|A8FJP1|UNG_CAMJ8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|157385363|gb|ABV51678.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747043|gb|ADN90313.1| Uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni M1]
          Length = 231

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNIIIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           ++ILGQDPYH   QA GL FSVP  ++IPPSL NV+KELQ D+N  P   G L  W  +G
Sbjct: 68  IIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNVFKELQNDLNITPAKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKNKEILIDNA 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPIDWKI 230


>gi|330447426|ref|ZP_08311075.1| uracil-DNA glycosylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491617|dbj|GAA05572.1| uracil-DNA glycosylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 220

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 144/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW + +       +  ++++ + + +  GK ++P     F AF  TP  K KVVILGQDP
Sbjct: 4   SWSTFIAQQQAQAYFTDIEQAVDAARNAGKVVYPPQEDVFNAFTSTPLEKTKVVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G++ PPSL N+YKEL  D++ F  P HG+L+ W  +GVLLLN V
Sbjct: 64  YHGPKQAHGLSFSVLPGVKTPPSLANMYKELATDIDGFTIPEHGYLQPWAEQGVLLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD  I+ I++N + ++F+LWGA AQKK   +D  RH VL +
Sbjct: 124 LTVEQGNAHSHAKIGWETFTDRAIEYINDNTEGVIFLLWGAHAQKKGKKIDKTRHHVLHS 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSA  GFFGC+HFSK N+ L E GK  +NWQI
Sbjct: 184 AHPSPLSAYRGFFGCQHFSKTNQLLAEMGKAPINWQI 220


>gi|315634831|ref|ZP_07890113.1| uracil-DNA glycosylase [Aggregatibacter segnis ATCC 33393]
 gi|315476383|gb|EFU67133.1| uracil-DNA glycosylase [Aggregatibacter segnis ATCC 33393]
          Length = 223

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  ++    Q  + + + + + +E+  GK I+P     F AF +T F +VKVVILGQD
Sbjct: 3   KTWTDVIGQEKQQPYFQQVLQRVHAERELGKIIYPPAPDVFNAFKLTEFEQVKVVILGQD 62

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++ PPSL+N+YKEL  D+  F  P HG+L  W  +GVLLLN+
Sbjct: 63  PYHGPNQAHGLSFSVKPGVKPPPSLLNMYKELSNDIEGFQMPNHGYLVEWAQQGVLLLNS 122

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G A SH   GWE FTD VI+ ++ + +N+VF+LWG+ AQKK   +D ++H VL 
Sbjct: 123 VLTVEQGLAHSHANWGWEIFTDKVIEALNQHRENLVFLLWGSPAQKKGQFIDRQKHCVLT 182

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFGC HFSKAN YLQ+HG   +NWQ+
Sbjct: 183 SVHPSPLSAHRGFFGCHHFSKANAYLQQHGIAPINWQL 220


>gi|309378490|emb|CBX22915.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 219

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/217 (51%), Positives = 149/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L    +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQDP
Sbjct: 3   TWHDALGGEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+N F  P HG L  W  +GVLLLN V
Sbjct: 63  YHGEGQAHGLAFSVRQGVRIPPSLLNIYKELETDINGFSIPAHGCLTAWAEQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + HL+L A
Sbjct: 123 LTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKLIDSQNHLILTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 183 PHPSPLSAYRGFFGCRHFSQANSYLGRHGIDPINWKL 219


>gi|269959619|ref|ZP_06174000.1| uracil-DNA glycosylase [Vibrio harveyi 1DA3]
 gi|269835677|gb|EEZ89755.1| uracil-DNA glycosylase [Vibrio harveyi 1DA3]
          Length = 226

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E+  GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGEEKEQSYFVDTLNFVEAERAAGKAIYPPAKDVFNAFRFTEFKDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGIKTPPSLVNMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I+ + + +VF+LWG+ AQKK   +D  +H VL A
Sbjct: 126 LTVEQGKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGSHAQKKGRFIDRNKHYVLTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFG + FS+AN+ L + GK  +NW +P++
Sbjct: 186 PHPSPLSAHRGFFGSKPFSQANQILSQQGKEVINWHLPMA 225


>gi|238021495|ref|ZP_04601921.1| hypothetical protein GCWU000324_01395 [Kingella oralis ATCC 51147]
 gi|237868475|gb|EEP69481.1| hypothetical protein GCWU000324_01395 [Kingella oralis ATCC 51147]
          Length = 222

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L       + +++   + +E++ G+ ++P  +  F AF +T F + KVVILGQD
Sbjct: 5   QTWHDALAAEKAQPYFQHILATVRAERQSGQTVYPPAADVFNAFKLTEFAQTKVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  GI +PPSLVN+YKEL +D+  F  P  G L HW  +GVLLLN 
Sbjct: 65  PYHGEHQAHGLAFSVQHGISVPPSLVNIYKELADDIAGFQIPVSGCLNHWAEQGVLLLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV   +A SH   GWE FTD VI  ++ + QNIVFMLWG+ AQKK  ++D  RHLVL 
Sbjct: 125 VLTVRAHQAHSHANLGWETFTDRVIAQLNAHRQNIVFMLWGSHAQKKGAMIDRHRHLVLT 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YL +HG   +NWQI
Sbjct: 185 APHPSPLSAYRGFFGCKHFSQANAYLAQHGIAPINWQI 222


>gi|227510623|ref|ZP_03940672.1| uracil-DNA glycosylase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190275|gb|EEI70342.1| uracil-DNA glycosylase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 246

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L+  F+  + + L++FL+SE  K + I P  +H F AF +TPF+KVKVVILG
Sbjct: 21  IKNDWWDVLQPEFEKAYYQQLRQFLISE-YKTQYIHPDMNHIFEAFQLTPFSKVKVVILG 79

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+RIPPSL N+YKELQ D+   P  HG L  W  +GVLLLN
Sbjct: 80  QDPYHEPHQAHGLSFSVMPGVRIPPSLQNIYKELQSDLGIKPVHHGCLTSWAKQGVLLLN 139

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWEQ TD+ I  +S   + +VF+LWG +A+ K  ++D   ++VL
Sbjct: 140 SVLTVRNGQAFSHKGKGWEQLTDAAIQKLSAREEPVVFILWGRAARNKIALIDTDTNVVL 199

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 200 QSAHPSPLSANRGFFGSKPFSKTNEALIAMGEEPINWQLP 239


>gi|93006500|ref|YP_580937.1| uracil-DNA glycosylase [Psychrobacter cryohalolentis K5]
 gi|92394178|gb|ABE75453.1| Uracil-DNA glycosylase [Psychrobacter cryohalolentis K5]
          Length = 245

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 153/226 (67%), Gaps = 1/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ V++ E WK  L     S++M +L+ FL    +    I+P     F AF++TP ++VK
Sbjct: 19  LDNVRLPEDWKQALSEELTSDNMDSLRAFLKGAYQSEDGIYPPAQLIFNAFNLTPLSQVK 78

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP  I  PPSL N+ KE+ +D+   P  HG L +W  +G
Sbjct: 79  VVILGQDPYHRPGQAMGLSFSVPKVIPKPPSLNNLLKEMADDIGIKPSAHGDLTYWAQQG 138

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTV EG   SH+ +GWE+FTD+VID+I+   ++ VF+LWG+ AQKK   ++  
Sbjct: 139 VLLLNSSLTVREGEPNSHQNQGWEKFTDAVIDVINEQTEHTVFILWGSKAQKKGKYINTD 198

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HL+L A HPSPL+A+  GFFG + FSK N YL ++G+T ++WQ+P
Sbjct: 199 KHLILTAVHPSPLAANRGGFFGSKPFSKTNDYLVQYGQTPIDWQLP 244


>gi|71066052|ref|YP_264779.1| uracil-DNA glycosylase [Psychrobacter arcticus 273-4]
 gi|71039037|gb|AAZ19345.1| Uracil-DNA glycosylase [Psychrobacter arcticus 273-4]
          Length = 247

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 154/230 (66%), Gaps = 7/230 (3%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFL----LSEKRKGKRIFPRGSHYFRAFDITPF 56
           ++ V++ E WK  L     S++M +L+ FL     SE   G  I+P     F AF++TP 
Sbjct: 19  LDNVRLPEDWKQALAEELTSDNMDSLRAFLKEAYQSESEDG--IYPPAPLMFNAFNLTPL 76

Query: 57  NKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHW 116
           ++VKVVILGQDPYH  GQA GL FSVP  I  PPSL N+ KE+ +D+   P  HG L +W
Sbjct: 77  SQVKVVILGQDPYHRPGQAMGLSFSVPKAIPKPPSLNNLLKEMADDIGIKPSAHGDLTYW 136

Query: 117 GHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDV 176
             +GVLLLN+ LTV EG   SH+ +GWEQFTD+VID+I+    + VF+LWG+ AQKK   
Sbjct: 137 AQQGVLLLNSSLTVREGEPNSHQNQGWEQFTDAVIDVINEQTAHTVFILWGSKAQKKGKY 196

Query: 177 LDHKRHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++  +HL+L A HPSPL+A+  GFFG + FSK N YL ++G+T ++WQ+P
Sbjct: 197 INTDKHLILTAVHPSPLAANRGGFFGSKPFSKTNDYLVQYGQTPIDWQLP 246


>gi|56708604|ref|YP_170500.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110671075|ref|YP_667632.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134301441|ref|YP_001121409.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|187931169|ref|YP_001891153.1| uracil-DNA glycosylase [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|224457789|ref|ZP_03666262.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254368769|ref|ZP_04984782.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           FSC022]
 gi|254371236|ref|ZP_04987238.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254875467|ref|ZP_05248177.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|73920173|sp|Q5NEP2|UNG_FRATT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|123169255|sp|Q14G45|UNG_FRAT1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166200399|sp|A4IWI7|UNG_FRATW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238691549|sp|B2SFW5|UNG_FRATM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|56605096|emb|CAG46211.1| Uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110321408|emb|CAL09594.1| Uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134049218|gb|ABO46289.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151569476|gb|EDN35130.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|157121690|gb|EDO65860.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           FSC022]
 gi|187712078|gb|ACD30375.1| uracil-DNA glycosylase [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|254841466|gb|EET19902.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159833|gb|ADA79224.1| uracil-DNA glycosylase [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 220

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 141/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQKPYFKQILDFLACESAKGKVIFPTKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI+ IS N  N+VFMLWG+ A+KK+ ++D  RHL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLWGSHARKKKVLIDSSRHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNL 218


>gi|227513638|ref|ZP_03943687.1| uracil-DNA glycosylase [Lactobacillus buchneri ATCC 11577]
 gi|227083154|gb|EEI18466.1| uracil-DNA glycosylase [Lactobacillus buchneri ATCC 11577]
          Length = 246

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L+  F+  + + L++FL+SE  K + I P  +H F AF +TPF+KVKVVILG
Sbjct: 21  IKNDWWDVLQPEFEKAYYQQLRQFLISE-YKTQYIHPDMNHIFEAFQLTPFSKVKVVILG 79

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+RIPPSL N+YKELQ D+   P  HG L  W  +GVLLLN
Sbjct: 80  QDPYHEPHQAHGLSFSVMPGVRIPPSLQNIYKELQSDLGIKPVHHGCLTSWAKQGVLLLN 139

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWEQ TD+ I  +S   + +VF+LWG +A+ K  ++D   ++VL
Sbjct: 140 SVLTVRNGQAFSHKGKGWEQLTDAAIQKLSAREEPVVFILWGRAARNKIALIDTNTNVVL 199

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 200 QSAHPSPLSANRGFFGSKPFSKTNEALIAMGEEPINWQLP 239


>gi|54112867|gb|AAV29067.1| NT02FT1833 [synthetic construct]
          Length = 220

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 141/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQKPYFKQILDFLACESAKGKVIFPTKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI+ IS N  N+VFMLWG+ A+KK+ ++D  RHL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLWGSHARKKKVLIDSSRHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNL 218


>gi|118475295|ref|YP_891322.1| uracil-DNA glycosylase [Campylobacter fetus subsp. fetus 82-40]
 gi|166201513|sp|A0RM89|UNG_CAMFF RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|118414521|gb|ABK82941.1| uracil-DNA glycosylase [Campylobacter fetus subsp. fetus 82-40]
          Length = 232

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 155/224 (69%), Gaps = 2/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  VKI +SWK +L++ F S +   +K  L++  + GK ++P  +  F AF++TPF+KVK
Sbjct: 5   LAKVKIEDSWKEVLKDEFLSSYFLEIKFNLINALKNGK-VYPPSNLIFNAFNLTPFDKVK 63

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYHN G+A GL FSVP G+R+PPSL N+YKE+++D+  I P  G L +W  +G
Sbjct: 64  VVILGQDPYHNEGEAMGLSFSVPKGVRVPPSLANIYKEIKDDLGIIEPNCGDLSYWAKQG 123

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA L+V    A SH   GW+ F+D+VI  IS     +VFMLWG  A+ K ++++  
Sbjct: 124 VLLLNATLSVGARMANSHSNFGWQIFSDAVIKNISEKKTGVVFMLWGNYARAKANLIEAN 183

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HLVL AAHPSPL A   FFG RHFSK N YL ++G+T ++W +
Sbjct: 184 KHLVLTAAHPSPL-ARGAFFGSRHFSKCNNYLIKNGQTPIDWDL 226


>gi|57237093|ref|YP_178105.1| uracil-DNA glycosylase [Campylobacter jejuni RM1221]
 gi|148926886|ref|ZP_01810564.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205356463|ref|ZP_03223227.1| uracil DNA glycosylase [Campylobacter jejuni subsp. jejuni CG8421]
 gi|73920170|sp|Q5HX80|UNG_CAMJR RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|57165897|gb|AAW34676.1| uracil-DNA glycosylase [Campylobacter jejuni RM1221]
 gi|145844463|gb|EDK21571.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205345650|gb|EDZ32289.1| uracil DNA glycosylase [Campylobacter jejuni subsp. jejuni CG8421]
 gi|315057526|gb|ADT71855.1| Uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni S3]
          Length = 231

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNIVIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           ++ILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFKELQNDLNITPAKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKNKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPIDWKI 230


>gi|86151228|ref|ZP_01069443.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86154017|ref|ZP_01072218.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|121612589|ref|YP_999810.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167004785|ref|ZP_02270543.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315123689|ref|YP_004065693.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|166201516|sp|A1VXG9|UNG_CAMJJ RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|85841575|gb|EAQ58822.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85842431|gb|EAQ59645.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|87248961|gb|EAQ71923.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315017411|gb|ADT65504.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 231

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNIIIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           ++ILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFKELQNDLNITPAKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKSKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPIDWKI 230


>gi|326803644|ref|YP_004321462.1| uracil-DNA glycosylase [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650042|gb|AEA00225.1| uracil-DNA glycosylase [Aerococcus urinae ACS-120-V-Col10a]
          Length = 224

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W+  L+  F+S   + L+EFL  E R  + I+P   H + AF +TPF++VKVVILG
Sbjct: 5   INNQWQEALDPVFESPAYQKLREFLKDEYR-NQVIYPDMWHIYEAFKLTPFDQVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+Y+EL  DV F P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHEPHQAHGLSFSVQKGVAIPPSLNNIYQELSNDVGFQPVHHGNLTEWAEQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV +G+A SHRGRGWE+ TD  I  ++  +Q +VF+LWG +A+ K+  +D  +H VL
Sbjct: 124 SVLTVRQGKAHSHRGRGWEEVTDFAIKQLNKRNQRVVFILWGNAAKSKRRFIDENKHAVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            + HPSPLSA  GFFG R FSKAN+ L E G++ +NWQ+
Sbjct: 184 TSVHPSPLSAYRGFFGSRPFSKANQLLIESGQSPINWQL 222


>gi|218768226|ref|YP_002342738.1| uracil-DNA glycosylase [Neisseria meningitidis Z2491]
 gi|25009537|sp|Q9JUC4|UNG_NEIMA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|121052234|emb|CAM08557.1| putative uracil-DNA glycosylase [Neisseria meningitidis Z2491]
          Length = 219

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GIRIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGIRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K+ ++D + +L+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKLIDSQNYLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|86149705|ref|ZP_01067935.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88597695|ref|ZP_01100928.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218561767|ref|YP_002343546.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|25009541|sp|Q9PJ40|UNG_CAMJE RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|85839973|gb|EAQ57232.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88189999|gb|EAQ93975.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359473|emb|CAL34257.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|284925379|gb|ADC27731.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315927767|gb|EFV07094.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315930863|gb|EFV09853.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 305]
          Length = 231

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 155/224 (69%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L + FQ ++   +K+  L+   +   I+P  +  F AF++ P  ++K
Sbjct: 8   IDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNIIIYPPANLIFNAFNLCPLKEIK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           ++ILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFKELQNDLNITPAKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKNKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++ GK  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVGKIPIDWKI 230


>gi|227363396|ref|ZP_03847522.1| uracil-DNA glycosylase [Lactobacillus reuteri MM2-3]
 gi|227071585|gb|EEI09882.1| uracil-DNA glycosylase [Lactobacillus reuteri MM2-3]
          Length = 245

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 21  IHNDWWEVLKPQFESAYYAQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 79

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L+ W  +GVLLLN
Sbjct: 80  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCTPVNHGYLKKWADQGVLLLN 139

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 140 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 199

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 200 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 239


>gi|71660235|ref|XP_821835.1| uracil-DNA glycosylase [Trypanosoma cruzi strain CL Brener]
 gi|6469614|gb|AAF13355.1| uracil-DNA-glycosylase [Trypanosoma cruzi]
 gi|70887224|gb|EAN99984.1| uracil-DNA glycosylase [Trypanosoma cruzi]
          Length = 298

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 155/220 (70%), Gaps = 3/220 (1%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W++ L+    + + RN+++F+  EK KGK I P     F AF+ TP +++KVV+LGQDPY
Sbjct: 75  WRAFLQPLTSTTNFRNIEQFIEGEKTKGKVILPPSDLIFSAFNSTPLDRLKVVLLGQDPY 134

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVL 128
           HN GQAHGLCFSV  G+R PPSL+N+YKEL  D++ F  P HG+L+ W  +GVL+LNA L
Sbjct: 135 HNIGQAHGLCFSVLPGVRPPPSLLNMYKELTTDISGFKSPPHGYLQCWAEQGVLMLNATL 194

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQN-IVFMLWGASAQKKQDVLDHKRHLVLKA 187
           TVE  +A SH   GW+ FTD VI L+S  HQ  IVF+LWG  A+KK  ++D KRHLV++ 
Sbjct: 195 TVEAHQANSHAKCGWQAFTDGVIRLLSEKHQRPIVFLLWGGFARKKITLIDQKRHLVIEN 254

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           AHPSPLSA+  ++G R FSK N  L + G + ++W IP+S
Sbjct: 255 AHPSPLSAAK-WWGSRPFSKCNAALTQLGHSPIDWSIPMS 293


>gi|225025647|ref|ZP_03714839.1| hypothetical protein EIKCOROL_02549 [Eikenella corrodens ATCC
           23834]
 gi|224941597|gb|EEG22806.1| hypothetical protein EIKCOROL_02549 [Eikenella corrodens ATCC
           23834]
          Length = 219

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   +    Q  + +++   +  E+  G+ ++P  +  F AF  T F +V+VVILGQD
Sbjct: 2   QTWHEAIGAEKQQPYFQHIIHSVHHEREAGQIVYPPAADVFNAFRATEFGRVRVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G+ +PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN 
Sbjct: 62  PYHGANQAHGLAFSVREGVAVPPSLVNIYKELAQDIPGFQIPKHGYLQSWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE FTD VI +++   +++VFMLWG+ AQKK  +++  RHLVL 
Sbjct: 122 VLTVRAGQAHSHAALGWETFTDHVIAVLNEGREHLVFMLWGSHAQKKGAIINRSRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YLQ+HG   ++WQI
Sbjct: 182 APHPSPLSAHRGFFGCRHFSQANAYLQQHGLPPIDWQI 219


>gi|332162706|ref|YP_004299283.1| uracil-DNA glycosylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606814|emb|CBY28312.1| uracil-DNA glycosylase, family 1 [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666936|gb|ADZ43580.1| uracil-DNA glycosylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 228

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + ++   ++ +E+  GK I+P     F AF +T  ++VKVVILGQDP
Sbjct: 6   TWHDVIGQEKEQPYFKDTLAYVAAERNAGKTIYPAQHDVFNAFRLTELDQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVLPGVPAPPSLVNIYKELATDIPGFQRPNHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G A SH   GWE FTD VI  ++ +   ++FMLWGA AQKK  ++D +RH +LKA
Sbjct: 126 LTVEAGNAHSHANLGWETFTDKVIAALNEHRDGVIFMLWGAHAQKKGRIIDTQRHFILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+AN+ LQ+HG+  ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLQQHGQQPIDWQ 221


>gi|269140079|ref|YP_003296780.1| uracil-DNA glycosylase [Edwardsiella tarda EIB202]
 gi|267985740|gb|ACY85569.1| uracil-DNA glycosylase [Edwardsiella tarda EIB202]
 gi|304559906|gb|ADM42570.1| Uracil-DNA glycosylase [Edwardsiella tarda FL6-60]
          Length = 231

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 144/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++       + R+   F+ +E+  GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 6   TWHDVIGAEKDQPYFRDTLTFVATERSNGKTIYPPQQDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL+ D+  F  P+HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVLPGVPTPPSLQNMYKELKSDIPGFEIPSHGYLKSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWEQFTD V++ +++    IVF+LWGA AQKK  ++D +RH VLKA
Sbjct: 126 LTVERGQAHSHAQLGWEQFTDRVVEALNSQRSGIVFLLWGAHAQKKGRIIDTQRHRVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFS  N+ LQE G   ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSMTNQLLQEQGIAPIDWQ 221


>gi|197304073|ref|ZP_03169099.1| hypothetical protein RUMLAC_02811 [Ruminococcus lactaris ATCC
           29176]
 gi|197296855|gb|EDY31429.1| hypothetical protein RUMLAC_02811 [Ruminococcus lactaris ATCC
           29176]
          Length = 222

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W   L+  F   + R L    ++E+ K + IFP     F AF +TP   VKVVILG
Sbjct: 4   LNGDWYEALKGEFAKPYYRKLFA-TVNEEYKTRLIFPPAKDIFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN+GQAHGLCFSV  G+ IPPSLVN+YKEL +D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNHGQAHGLCFSVQKGVEIPPSLVNIYKELHDDLGCTIPDHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  +++  + IVF+LWGA AQ+K+ +L++++HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMALNSQDRPIVFILWGAPAQRKKRMLNNQKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N +L+++G   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSQTNAFLEKNGIEPIDWQI 221


>gi|203287522|ref|YP_002222537.1| uracil DNA glycosylase [Borrelia recurrentis A1]
 gi|238690581|sp|B5RQN2|UNG_BORRA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|201084742|gb|ACH94316.1| uracil DNA glycosylase [Borrelia recurrentis A1]
          Length = 223

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L++ F   + + L  F+ +E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEMLKSEFCKGYFKRLVSFIKNEYKTKKDKIFPPPRLIFNAFDTLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQA+GL FSV   I+IPPSL N++KE++  +      +G L  W  +G  
Sbjct: 63  ILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERSLKIKTIPNGDLTRWAEQGTF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN++LTVEEGR +SH+  GW+ FT+ VI +IS N  N+VFMLWG  A+ K+ ++D  +H
Sbjct: 123 LLNSILTVEEGRPSSHKDIGWKIFTNEVIKIISKNLNNVVFMLWGNFAKGKKKLIDTSKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA +GF G  HFSK  RYLQEH KTT+N+Q
Sbjct: 183 LILETSHPSPYSAHNGFLGSNHFSKTLRYLQEHNKTTINFQ 223


>gi|282600121|ref|ZP_05973100.2| uracil-DNA glycosylase [Providencia rustigianii DSM 4541]
 gi|282566503|gb|EFB72038.1| uracil-DNA glycosylase [Providencia rustigianii DSM 4541]
          Length = 230

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ +     + ++   F+ SE++ GK I+P     F AF  T    VKVVILGQDP
Sbjct: 10  TWHDVIGSEKSQTYFQDTLAFVASERQNGKIIYPPQEDVFNAFRYTELADVKVVILGQDP 69

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI+ PPSLVN+YKEL++D+  F+ P HG+L  W  +GVLLLN V
Sbjct: 70  YHGPGQAHGLSFSVLPGIKAPPSLVNMYKELEQDIPGFVRPNHGYLLSWARQGVLLLNTV 129

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI+ I+ + + +VF+LWGA AQKK  ++D KRH VLKA
Sbjct: 130 LTVEQGNAHSHAHLGWETFTDKVIEAINEHTEGVVFLLWGAHAQKKGRIIDTKRHHVLKA 189

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFSK N+ L++ G T +NW
Sbjct: 190 PHPSPLSAHRGFLGCGHFSKTNQLLEQQGLTPINW 224


>gi|325144634|gb|EGC66933.1| uracil-DNA glycosylase [Neisseria meningitidis M01-240013]
          Length = 219

 Score =  234 bits (597), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPAADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|325681996|ref|ZP_08161514.1| uracil-DNA glycosylase [Lactobacillus reuteri MM4-1A]
 gi|324978640|gb|EGC15589.1| uracil-DNA glycosylase [Lactobacillus reuteri MM4-1A]
          Length = 244

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 20  IHNDWWEVLKPQFESAYYAQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 78

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L+ W  +GVLLLN
Sbjct: 79  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCTPVNHGYLKKWADQGVLLLN 138

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 139 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 198

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 199 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 238


>gi|294782940|ref|ZP_06748266.1| uracil-DNA glycosylase [Fusobacterium sp. 1_1_41FAA]
 gi|294481581|gb|EFG29356.1| uracil-DNA glycosylase [Fusobacterium sp. 1_1_41FAA]
          Length = 225

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 150/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  FQ ++   LK  +L ++ +   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFQKDYFVELKN-ILEKEYENYTVYPPKKDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTSLTVRDSEANSHSKIGWQTFTDNVIKKLNEREKPIIFILWGNNAKAKEKFIDTSKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK AHPSPLSA+ GFFGC+HFS+ NR L+E  +  ++WQI
Sbjct: 182 LKGAHPSPLSANRGFFGCKHFSEVNRILKELKEKEIDWQI 221


>gi|332881726|ref|ZP_08449374.1| uracil-DNA glycosylase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680365|gb|EGJ53314.1| uracil-DNA glycosylase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 220

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SWK  L   F+  +   L  F+  E R     +P G   F AF++ P++K KVVI
Sbjct: 3   VQIEPSWKQHLAPEFEKPYFVKLTNFVRQEYRT-TTCYPPGKLIFNAFNLCPYDKAKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+Q D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIQTDLGTPVPQSGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+ I  ++   +++VF+LWG+ AQKK   +D  RHL
Sbjct: 122 LNATLTVRAHQAGSHQRQGWEEFTDAAIKALAEGREHLVFILWGSYAQKKGAFIDRSRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA HGFFG RHFS AN YL++HG+T +NW
Sbjct: 182 VLASAHPSPLSAFHGFFGNRHFSLANAYLEQHGETPINW 220


>gi|258647759|ref|ZP_05735228.1| uracil-DNA glycosylase [Prevotella tannerae ATCC 51259]
 gi|260852616|gb|EEX72485.1| uracil-DNA glycosylase [Prevotella tannerae ATCC 51259]
          Length = 220

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI   W++ L   F S++   L +F+ +E + G   +P GS  F AFD+ PF++V+VV+
Sbjct: 3   VKIESGWQACLAEEFASDYFAQLTDFVRAEYQSGP-CYPPGSQIFNAFDLCPFDRVRVVL 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA GLCFSV  G+  PPSL N++KE+Q DV    P  G L  W  +GVLL
Sbjct: 62  LGQDPYHEPGQAEGLCFSVRDGVPFPPSLQNIFKEIQADVGHAIPASGSLRRWAAQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV    A SH+G GWE FTD+VI  +S   +++VF+LWG+ A +K +++D  RHL
Sbjct: 122 LNATLTVRAHAAGSHQGHGWETFTDAVIRRLSAAREHLVFLLWGSYAGRKAELIDASRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +L++AHPSPLSA  GFFG  HF+  N YL+ HG   +NW
Sbjct: 182 ILRSAHPSPLSAYRGFFGNHHFTLCNDYLRAHGLEPINW 220


>gi|240014123|ref|ZP_04721036.1| uracil-DNA glycosylase [Neisseria gonorrhoeae DGI18]
 gi|240016558|ref|ZP_04723098.1| uracil-DNA glycosylase [Neisseria gonorrhoeae FA6140]
 gi|240080746|ref|ZP_04725289.1| uracil-DNA glycosylase [Neisseria gonorrhoeae FA19]
 gi|240115640|ref|ZP_04729702.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID18]
 gi|240121685|ref|ZP_04734647.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID24-1]
 gi|240123493|ref|ZP_04736449.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID332]
 gi|268596866|ref|ZP_06131033.1| uracil-DNA glycosylase [Neisseria gonorrhoeae FA19]
 gi|268601321|ref|ZP_06135488.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID18]
 gi|268682122|ref|ZP_06148984.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID332]
 gi|268550654|gb|EEZ45673.1| uracil-DNA glycosylase [Neisseria gonorrhoeae FA19]
 gi|268585452|gb|EEZ50128.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID18]
 gi|268622406|gb|EEZ54806.1| uracil-DNA glycosylase [Neisseria gonorrhoeae PID332]
          Length = 219

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 150/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRHERLSGQIIYPPEADVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +G+LLLN 
Sbjct: 62  PYHGVGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGILLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|148543633|ref|YP_001271003.1| uracil-DNA glycosylase [Lactobacillus reuteri DSM 20016]
 gi|184153047|ref|YP_001841388.1| uracil-DNA glycosylase [Lactobacillus reuteri JCM 1112]
 gi|167011640|sp|A5VIJ2|UNG_LACRD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|229557921|sp|B2G626|UNG_LACRJ RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|148530667|gb|ABQ82666.1| Uracil-DNA glycosylase [Lactobacillus reuteri DSM 20016]
 gi|183224391|dbj|BAG24908.1| uracil-DNA glycosylase [Lactobacillus reuteri JCM 1112]
          Length = 229

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 5   IHNDWWEVLKPQFESAYYAQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCTPVNHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 124 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 184 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 223


>gi|259502765|ref|ZP_05745667.1| uracil-DNA glycosylase [Lactobacillus antri DSM 16041]
 gi|259169268|gb|EEW53763.1| uracil-DNA glycosylase [Lactobacillus antri DSM 16041]
          Length = 240

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S+    L +FL +E    + I+P   H F AF+ TPF+ VKVVILG
Sbjct: 5   IHNDWWDVLKPEFESQSYSQLHDFLKTEYTH-RTIYPEMHHIFEAFEWTPFHDVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ DV F P  HG+L+HW  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGCSFSVLPGVAVPPSLQNIYKELQSDVGFRPVNHGYLKHWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   Q +VF+LWG +A+ K+ +++   +++L
Sbjct: 124 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPQPVVFILWGRAARDKKKLINLNTNIIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 184 ESPHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 223


>gi|322818179|gb|EFZ25663.1| uracil-DNA glycosylase [Trypanosoma cruzi]
          Length = 298

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 155/220 (70%), Gaps = 3/220 (1%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W++ L+    + + RN+++F+  EK KGK I P     F AF+ TP +++KVV+LGQDPY
Sbjct: 75  WRAFLQPLTSTTNFRNIEQFIEGEKAKGKVILPPSDLIFSAFNSTPLDRLKVVLLGQDPY 134

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVL 128
           HN GQAHGLCFSV  G+R PPSL+N+YKEL  D++ F  P HG+L+ W  +GVL+LNA L
Sbjct: 135 HNIGQAHGLCFSVLPGVRPPPSLLNMYKELTTDISGFKSPPHGYLQCWAEKGVLMLNATL 194

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQN-IVFMLWGASAQKKQDVLDHKRHLVLKA 187
           TVE  +A SH   GW+ FTD VI L+S  HQ  IVF+LWG  A+KK  ++D KRHLV++ 
Sbjct: 195 TVEAHQANSHAKCGWQAFTDGVIRLLSEKHQRPIVFLLWGGFARKKITLIDQKRHLVIEN 254

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           AHPSPLSA+  ++G R FSK N  L + G + ++W IP+S
Sbjct: 255 AHPSPLSAAK-WWGSRPFSKCNAALTQLGHSPIDWSIPMS 293


>gi|153206811|ref|ZP_01945652.1| uracil-DNA glycosylase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218445|ref|YP_002305232.1| uracil-DNA glycosylase [Coxiella burnetii CbuK_Q154]
 gi|238058163|sp|B6J738|UNG_COXB1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|120577174|gb|EAX33798.1| uracil-DNA glycosylase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012707|gb|ACJ20087.1| uracil-DNA glycosylase [Coxiella burnetii CbuK_Q154]
          Length = 229

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 149/217 (68%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+++L    Q  + + + +F+  E++ GK I+P     F A  +TP+  VKVVILGQD
Sbjct: 8   QTWQTVLGEEKQEPYFQEILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAVKVVILGQD 67

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGL FSV  G+  PPSL N++KEL  D+    P+HGFLE W  +GVLLLNA 
Sbjct: 68  PYHGPNQAHGLAFSVRPGVPAPPSLQNIFKELHADLGVSIPSHGFLEKWAKQGVLLLNAA 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+  SH   GW +FTD VI+ ++++ + IVF+LWG+ AQKK  ++ + RH +LKA
Sbjct: 128 LTVEAGKPQSHANIGWHRFTDKVIESLNDHPEGIVFLLWGSYAQKKSQLITNLRHRILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA+ GF GCRHFSKAN+ L E G+  ++W +
Sbjct: 188 PHPSPLSAARGFLGCRHFSKANQLLHEMGRGEIDWAL 224


>gi|193506917|gb|ACF19423.1| uracil-DNA glycosylase [Photobacterium aplysiae]
          Length = 226

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+S++ +  + E+ +++  F+  ++  GK I+P     F AFD+TPF  V+VVILGQD
Sbjct: 5   KTWESIINDEREKEYFQSVLAFVEQQRNSGKTIYPPQEQVFSAFDMTPFESVRVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++IPPSL N+YKEL +D+  F  P+HG+L+ W  +GVL+LN 
Sbjct: 65  PYHGANQAHGLAFSVLPGVKIPPSLRNMYKELAQDIEGFEIPSHGYLDAWASQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEE +A SH   GWE FTD++I  ++   + I+F+LWGA AQKK   +D   H VL 
Sbjct: 125 VLTVEEAKAHSHAKCGWETFTDAIIAELNQRSEPIIFLLWGAHAQKKGQAIDTGMHHVLA 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPLSA  GFFGC+HFS  N+ L    +  ++W +P
Sbjct: 185 APHPSPLSARRGFFGCKHFSTTNKLLSSMDQQPIDWHLP 223


>gi|320103706|ref|YP_004179297.1| Uracil-DNA glycosylase [Isosphaera pallida ATCC 43644]
 gi|319750988|gb|ADV62748.1| Uracil-DNA glycosylase [Isosphaera pallida ATCC 43644]
          Length = 277

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+  L    +      +  F+ +E+R G  ++P     F AF+ TP ++VK V+LGQDP
Sbjct: 60  AWRIALGRRVEQSKYEEIGAFVAAERRIGT-VYPPHDQVFAAFEATPPDQVKAVLLGQDP 118

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGLCFSV  G+ IPPSLVN+ +ELQ D+ F PP HG L  W ++GVL+LN VL
Sbjct: 119 YHGPGQAHGLCFSVRPGVPIPPSLVNILQELQNDLGFPPPRHGDLRSWANQGVLMLNTVL 178

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV  G+A SHRGRGWE+FTD+VI  IS     +VF+LWG  A+ K+ ++D  RH ++++A
Sbjct: 179 TVRSGQANSHRGRGWEEFTDAVIAEISAGPHPVVFILWGNPAKAKRKLIDVNRHAIVQSA 238

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA HGFFG R FS+ NR L   G+  ++W++
Sbjct: 239 HPSPLSAHHGFFGSRPFSQVNRALARFGRAPIDWRL 274


>gi|113460626|ref|YP_718692.1| uracil-DNA glycosylase [Haemophilus somnus 129PT]
 gi|170718074|ref|YP_001785110.1| uracil-DNA glycosylase [Haemophilus somnus 2336]
 gi|123031203|sp|Q0I271|UNG_HAES1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|189037440|sp|B0UWA7|UNG_HAES2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|112822669|gb|ABI24758.1| Uracil-DNA glycosylase [Haemophilus somnus 129PT]
 gi|168826203|gb|ACA31574.1| uracil-DNA glycosylase [Haemophilus somnus 2336]
          Length = 223

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +WK  +    Q  + +++ + +   ++ G+ I+P     F AF +T F++V+VVILGQDP
Sbjct: 3   TWKEAIGQEKQQPYFQHILQQVQQARQSGRTIYPPQEEVFSAFRLTEFDQVRVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI  PPSLVN+YKEL  D+  F  P+HG+L  W  +GVLLLN V
Sbjct: 63  YHGVNQAHGLAFSVKPGIAPPPSLVNIYKELSTDIMGFQTPSHGYLVGWAKQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI +++    ++VF+LWG+ AQKK   +D  +H VL +
Sbjct: 123 LTVEQGLAHSHANFGWETFTDRVIHVLNEQRDHLVFLLWGSHAQKKGQFIDRTKHCVLTS 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFGCRHFSK N+YL+ H  T +NWQ+P++
Sbjct: 183 PHPSPLSAHRGFFGCRHFSKTNQYLRHHNLTEINWQLPMT 222


>gi|302759108|ref|XP_002962977.1| hypothetical protein SELMODRAFT_66695 [Selaginella moellendorffii]
 gi|300169838|gb|EFJ36440.1| hypothetical protein SELMODRAFT_66695 [Selaginella moellendorffii]
          Length = 280

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 147/224 (65%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E + +  SW  +L++ F+  +M NL+ F+  +      ++P  +  F AF+  PF++VK
Sbjct: 57  LEKLLVEPSWVEVLQDEFKKPYMENLQTFVKQQAAGKVPVYPPAAKVFNAFNSCPFDRVK 116

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VV+LGQDPYH  GQA GL FSVP GIRIP SL+N+YKE+  DV    P HG LE W ++G
Sbjct: 117 VVLLGQDPYHGPGQAMGLSFSVPEGIRIPSSLLNMYKEIHSDVGCRVPLHGNLEKWAYQG 176

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV E +A SH  +GWE FTD+ I  IS     +VF+LWG  AQ+K  +++  
Sbjct: 177 VLLLNTVLTVREQQANSHAKKGWEPFTDAAIRAISKRKTGVVFLLWGNCAQEKIRLINPN 236

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            H VLKAAHPS LSA  GFFGCRHFSK N  L+      +NWQ+
Sbjct: 237 EHHVLKAAHPSGLSAHKGFFGCRHFSKTNELLESANILPINWQV 280


>gi|257883885|ref|ZP_05663538.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,501]
 gi|257819723|gb|EEV46871.1| uracil-DNA glycosylase [Enterococcus faecium 1,231,501]
          Length = 226

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ +L + F  ++  +L+EFL  E    ++I P   H + A ++TP+ +VKVVILG
Sbjct: 5   IHNSWQEVLSSEFSKDYYLHLREFLKKE-YASQKIHPDMYHIYEALELTPYEEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G++IPPSL N+YKEL +D+   P  HG L  W  +GVLLLN
Sbjct: 64  QDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELYDDLGIAPVQHGNLVSWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE+ TD++I+ ++   + IVF+LWG  AQ+K  ++D   H+++
Sbjct: 124 TVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSSHIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            + HPSPLSAS GFFG + FSK N  L   G+  ++WQ+P
Sbjct: 184 TSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLP 223


>gi|302561848|ref|ZP_07314190.1| uracil-DNA glycosylase [Streptomyces griseoflavus Tu4000]
 gi|302479466|gb|EFL42559.1| uracil-DNA glycosylase [Streptomyces griseoflavus Tu4000]
          Length = 227

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+  G  ++P     F A D TPF+KVKV++LG
Sbjct: 7   LPESWRGVLGDELQQPYFKELTEFVEEERANGP-VYPPREEVFAALDATPFDKVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+RIPPSL N+YKE+  ++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVRIPPSLRNIYKEMHTELGTPVPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+GRGWE+FTD+VI  ++N     VF+LWG  AQKK  ++D  RH+V+
Sbjct: 126 AVLTVRAGEANSHKGRGWERFTDAVIRAVANRPDPAVFVLWGNYAQKKLPLIDETRHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +  HG   ++W +P
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAAHGHEPIDWTVP 224


>gi|259907665|ref|YP_002648021.1| Uracil-DNA-glycosylase [Erwinia pyrifoliae Ep1/96]
 gi|224963287|emb|CAX54772.1| Uracil-DNA-glycosylase [Erwinia pyrifoliae Ep1/96]
 gi|283477513|emb|CAY73429.1| uracil-DNA-glycosylase [Erwinia pyrifoliae DSM 12163]
 gi|310764830|gb|ADP09780.1| Uracil-DNA-glycosylase [Erwinia sp. Ejp617]
          Length = 227

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 146/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  + R+    + +E+  GK +FP     F AF +T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKEKPYFRDTLAMVAAERASGKTVFPPQKDVFNAFRLTELGAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+ +PPSLVN+YKEL  D+  F  P HGFLE W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLAFSVLPGVAVPPSLVNIYKELLTDIPGFERPNHGFLESWARQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD+VI  I+ + + +VF+LWG+ AQKK  ++D KRH VL+A
Sbjct: 126 LTVEAGQAHSHAKFGWETFTDNVIAAINQHREGVVFLLWGSHAQKKGSIIDRKRHHVLQA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFG  HFSK NR+L E G+T ++W   L+
Sbjct: 186 PHPSPLSAHRGFFGSAHFSKTNRWLSEQGETPIDWMPQLT 225


>gi|194437652|ref|ZP_03069748.1| uracil-DNA glycosylase [Escherichia coli 101-1]
 gi|253772520|ref|YP_003035351.1| uracil-DNA glycosylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162555|ref|YP_003045663.1| uracil-DNA glycosylase [Escherichia coli B str. REL606]
 gi|300920748|ref|ZP_07137154.1| uracil-DNA glycosylase [Escherichia coli MS 115-1]
 gi|300927707|ref|ZP_07143275.1| uracil-DNA glycosylase [Escherichia coli MS 187-1]
 gi|6435761|pdb|1EUG|A Chain A, Crystal Structure Of Escherichia Coli Uracil Dna
           Glycosylase And Its Complexes With Uracil And Glycerol:
           Structure And Glycosylase Mechanism Revisited
 gi|194423458|gb|EDX39449.1| uracil-DNA glycosylase [Escherichia coli 101-1]
 gi|242378180|emb|CAQ32955.1| uracil-DNA glycosylase [Escherichia coli BL21(DE3)]
 gi|253323564|gb|ACT28166.1| uracil-DNA glycosylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974456|gb|ACT40127.1| uracil-DNA glycosylase [Escherichia coli B str. REL606]
 gi|253978623|gb|ACT44293.1| uracil-DNA glycosylase [Escherichia coli BL21(DE3)]
 gi|300412319|gb|EFJ95629.1| uracil-DNA glycosylase [Escherichia coli MS 115-1]
 gi|300464260|gb|EFK27753.1| uracil-DNA glycosylase [Escherichia coli MS 187-1]
 gi|323941157|gb|EGB37342.1| uracil-DNA glycosylase [Escherichia coli E482]
 gi|323961195|gb|EGB56808.1| uracil-DNA glycosylase [Escherichia coli H489]
 gi|323971093|gb|EGB66340.1| uracil-DNA glycosylase [Escherichia coli TA007]
          Length = 229

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220


>gi|218128637|ref|ZP_03457441.1| hypothetical protein BACEGG_00207 [Bacteroides eggerthii DSM 20697]
 gi|317475566|ref|ZP_07934828.1| uracil-DNA glycosylase [Bacteroides eggerthii 1_2_48FAA]
 gi|217989092|gb|EEC55407.1| hypothetical protein BACEGG_00207 [Bacteroides eggerthii DSM 20697]
 gi|316908270|gb|EFV29962.1| uracil-DNA glycosylase [Bacteroides eggerthii 1_2_48FAA]
          Length = 220

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I +SWK+ L+  F  ++   L  F+  E  K   I+P G   F AF++ PF+KVKVVI
Sbjct: 3   VQIEDSWKTHLQPEFDKDYFYKLTNFVREEYGK-NTIYPPGKLIFNAFNLCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSLVN++KE++ D     P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLVNIFKEIKADTGADAPPTGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+  GWE FTD+ I +++   +++VF+LWGA AQ+K   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQNHGWETFTDAAIRILAEEREHLVFILWGAYAQRKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA +GFFG +HFSKAN YL+ HG+  + W
Sbjct: 182 VLTSAHPSPLSAYNGFFGNKHFSKANDYLRAHGEEEIKW 220


>gi|255280228|ref|ZP_05344783.1| uracil-DNA glycosylase [Bryantella formatexigens DSM 14469]
 gi|255269319|gb|EET62524.1| uracil-DNA glycosylase [Bryantella formatexigens DSM 14469]
          Length = 224

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W + L+  F   + + L +  ++E+ +   IFP     F AF +TP ++VKVVILG
Sbjct: 4   ISNDWLAPLKPEFSKPYYKKLYQ-TVNEEYRTHLIFPPADDIFNAFALTPLSEVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV   + IPPSLVN+YKELQ+D     P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGDGQAHGLCFSVKPDVEIPPSLVNIYKELQDDCGCYIPNNGYLTKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRILNEQDRPIVFILWGKPAQMKKAMLNNPQHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N++LQ+HG   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSRTNKFLQQHGIEPIDWQI 221


>gi|194468191|ref|ZP_03074177.1| uracil-DNA glycosylase [Lactobacillus reuteri 100-23]
 gi|194453044|gb|EDX41942.1| uracil-DNA glycosylase [Lactobacillus reuteri 100-23]
          Length = 229

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 5   IHNDWWEVLKPQFESAYYVQLHNFL-KEEYTHQTIYPEMHHIFEAFEWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCTPVNHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SHRG GWEQ TD+ I  +S   + +VF+LWG +A+ K+ +++ K ++VL
Sbjct: 124 SVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFILWGRAARNKKQLINTKTNIVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG R FSK N  LQ  G+  ++WQ+P
Sbjct: 184 ESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQLP 223


>gi|149192226|ref|ZP_01870441.1| uracil-DNA glycosylase [Vibrio shilonii AK1]
 gi|148833928|gb|EDL50950.1| uracil-DNA glycosylase [Vibrio shilonii AK1]
          Length = 224

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q E+ +    ++ +++ +GK IFP     F AF  T F+ V VV+LGQDP
Sbjct: 5   TWHDVIGNEKQQEYFQQTMAYVEAQRTQGKVIFPPAQDVFNAFRFTEFSDVNVVMLGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVL+LN V
Sbjct: 65  YHGPNQAHGLCFSVLPGVKTPPSLVNMYKELAQDIEGFEIPAHGYLKSWAEQGVLMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ ++ N + IVF+LWG+ AQKK  ++D  +H VL A
Sbjct: 125 LTVEQGQAHSHAKLGWETFTDRVIEALNQNGEGIVFLLWGSHAQKKGKMIDRSKHHVLTA 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GFFG  HFSK N+ LQ  GK  V+WQ
Sbjct: 185 PHPSPLSAHRGFFGSGHFSKTNQILQSMGKRPVDWQ 220


>gi|119470505|ref|ZP_01613208.1| uracil-DNA glycosylase [Alteromonadales bacterium TW-7]
 gi|119446206|gb|EAW27483.1| uracil-DNA glycosylase [Alteromonadales bacterium TW-7]
          Length = 220

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 148/218 (67%), Gaps = 2/218 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W + L+N  Q  +M+     + + + +G  ++P  S+ F AF+ TP N ++VVILGQDP
Sbjct: 3   DWDTFLQNELQHPYMQQTLNAVKNRRAEGIVVYPPESNVFNAFNATPLNNIRVVILGQDP 62

Query: 69  YHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           YH  GQAHGLCFSV P   ++PPSL N+YKEL  D+  F+ P HG+L+ W  +GV LLN 
Sbjct: 63  YHGEGQAHGLCFSVMPEVKKLPPSLKNMYKELATDIEGFVIPEHGYLQSWAEQGVFLLNT 122

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH+  GWEQFTD+VI  I+ + + +VF+LWGA AQKK   +D  RH +L 
Sbjct: 123 VLTVEQGQAHSHKHLGWEQFTDNVIAHINEHCEGVVFILWGAHAQKKGKGIDSTRHSILS 182

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPSPLSA  GFFGC+HFSK N  L   GK  +NWQ+
Sbjct: 183 GPHPSPLSAHRGFFGCKHFSKTNELLLAQGKKPINWQV 220


>gi|208779533|ref|ZP_03246878.1| uracil-DNA glycosylase [Francisella novicida FTG]
 gi|208744494|gb|EDZ90793.1| uracil-DNA glycosylase [Francisella novicida FTG]
          Length = 220

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + EFL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQQPYFKQILEFLACESAKGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  +HLVL++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISENKHNVVFMLWGSHARKKKVLIDSSKHLVLES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKSQKIDWNL 218


>gi|123441348|ref|YP_001005335.1| uracil-DNA glycosylase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166225570|sp|A1JKI8|UNG_YERE8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|122088309|emb|CAL11100.1| putative uracil-DNA glycosylase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 228

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 145/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + +    ++ +E+  GK I+P     F AF +T  ++VKVVILGQDP
Sbjct: 6   TWHDVIGQEKEQPYFKETLAYVAAERNAGKTIYPAQHDVFNAFRLTELDQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVLPGVPAPPSLVNIYKELATDIPGFQRPNHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G A SH   GWE FTD VI  ++ +   ++FMLWGA AQKK  ++D +RH +LKA
Sbjct: 126 LTVEAGNAHSHANLGWETFTDKVIAALNEHRDGVIFMLWGAHAQKKGRIIDTQRHFILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+AN+ LQ+HG+  ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLQQHGQQPIDWQ 221


>gi|167761620|ref|ZP_02433747.1| hypothetical protein CLOSCI_04032 [Clostridium scindens ATCC 35704]
 gi|167660763|gb|EDS04893.1| hypothetical protein CLOSCI_04032 [Clostridium scindens ATCC 35704]
          Length = 222

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L + F+  + + L    ++++ K + IFP     F AF +TP +KVKVVILG
Sbjct: 4   INNDWLEALNDEFKKPYYKKLFA-TVNQEYKTRLIFPPADDVFNAFHLTPLHKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ IPPSLVN+Y+EL +D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNNGQAHGLCFSVKKGVEIPPSLVNIYQELHDDLGCAIPEHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + IVF+LWG+ AQ+K  +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIMALNGQDRPIVFILWGSPAQQKAKMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLSA  GFFG R F K N +L+ HG   ++WQI
Sbjct: 183 KAPHPSPLSAFRGFFGSRPFGKTNAFLEAHGIEPIDWQI 221


>gi|29654303|ref|NP_819995.1| uracil-DNA glycosylase [Coxiella burnetii RSA 493]
 gi|45593581|sp|Q83CW4|UNG_COXBU RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|29541570|gb|AAO90509.1| uracil-DNA glycosylase [Coxiella burnetii RSA 493]
          Length = 229

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 149/217 (68%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+++L    Q  + + + +F+  E++ GK I+P     F A  +TP+  +KVVILGQD
Sbjct: 8   QTWQTVLGEEKQEPYFQEILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAIKVVILGQD 67

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGL FSV  G+  PPSL N++KEL  D+    P+HGFLE W  +GVLLLNA 
Sbjct: 68  PYHGPNQAHGLAFSVRPGVPAPPSLQNIFKELHADLGVSIPSHGFLEKWAKQGVLLLNAA 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+  SH   GW +FTD VI+ ++++ + IVF+LWG+ AQKK  ++ + RH +LKA
Sbjct: 128 LTVEAGKPQSHANIGWHRFTDKVIESLNDHPEGIVFLLWGSYAQKKSQLITNLRHRILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA+ GF GCRHFSKAN+ L E G+  ++W +
Sbjct: 188 PHPSPLSAARGFLGCRHFSKANQLLHEMGRGEIDWAL 224


>gi|153855187|ref|ZP_01996371.1| hypothetical protein DORLON_02385 [Dorea longicatena DSM 13814]
 gi|149752356|gb|EDM62287.1| hypothetical protein DORLON_02385 [Dorea longicatena DSM 13814]
          Length = 222

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L+  F+  + + L E  ++E+ + ++IFP     F AF +TP + VK VILG
Sbjct: 4   INNDWLDALKGEFKKPYYKKLFE-TVNEEYRTRQIFPPADDIFNAFHLTPLHNVKAVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ IPPSLVN+YKEL +D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNVGQAHGLCFSVKKGVDIPPSLVNIYKELHDDLGCTIPNHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SH+  GWE+FTD+ I  +++  + IVF+LWGA AQ+K  +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHKDIGWEEFTDAAIMALNSQDRPIVFILWGAPAQRKARMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLSA  GFFG + FS+ N YL+ HG   ++WQI
Sbjct: 183 KAPHPSPLSAYRGFFGSKPFSQTNDYLRAHGVEPIDWQI 221


>gi|294628206|ref|ZP_06706766.1| uracil-DNA glycosylase [Streptomyces sp. e14]
 gi|292831539|gb|EFF89888.1| uracil-DNA glycosylase [Streptomyces sp. e14]
          Length = 227

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+ KG  ++P     F A D TP+ KVKV++LG
Sbjct: 7   LPESWRGVLGDELQQPYFKELTEFVEEERAKGP-VYPPREEVFAALDATPYEKVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+RIPPSL N+YKE+ E++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVRIPPSLRNIYKEMHEELGTPVPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+GRGWE+FTD+VI  +++     VF+LWG  AQKK  ++D  RH+V+
Sbjct: 126 AVLTVRAGEANSHKGRGWEKFTDAVIRAVASRPDPAVFVLWGNYAQKKLPLIDESRHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVARQGHEPIDWRIP 224


>gi|163803372|ref|ZP_02197248.1| uracil-DNA glycosylase [Vibrio sp. AND4]
 gi|159172834|gb|EDP57676.1| uracil-DNA glycosylase [Vibrio sp. AND4]
          Length = 226

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW  ++    Q  +  +  +F+ +E+  GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 6   SWHDVIGEEKQQSYFVDTLDFVQAERAAGKAIYPPAKDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G + PPSL N+YKEL +D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGTKPPPSLANMYKELAQDIEGFQIPQHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+ +A SH   GWE FTD VI+ I+ + + +VF+LWGA AQKK   +D  +H VL A
Sbjct: 126 LTVEQSKAHSHSKTGWETFTDRVIEAINQHQEGVVFLLWGAHAQKKGRFIDRNKHHVLTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFG + FS+AN+ L + GK ++NW +P+
Sbjct: 186 PHPSPLSAHRGFFGSKPFSQANQILVQQGKESINWHLPM 224


>gi|313668336|ref|YP_004048620.1| lipoprotein [Neisseria lactamica ST-640]
 gi|313005798|emb|CBN87252.1| putative lipoprotein [Neisseria lactamica 020-06]
          Length = 219

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L    +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQDP
Sbjct: 3   TWHDALGGEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN V
Sbjct: 63  YHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L A
Sbjct: 123 LTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 183 PHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWKL 219


>gi|242240214|ref|YP_002988395.1| uracil-DNA glycosylase [Dickeya dadantii Ech703]
 gi|242132271|gb|ACS86573.1| uracil-DNA glycosylase [Dickeya dadantii Ech703]
          Length = 228

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +      F+  E+  GK I+P     F AF  T F+ VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQPYFTQTMTFVHQERAAGKVIYPPQKDVFNAFRFTEFHAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNIYKELANDIPGFTTPDHGFLQSWAQQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI+ ++ + + IVF+LWG+ AQKK  ++D KRH VLKA
Sbjct: 126 LTVEAGKAHSHANLGWETFTDKVIETLNAHREGIVFLLWGSHAQKKGSMIDPKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GCRHFS+AN  L++ G T ++W
Sbjct: 186 PHPSPLSAHRGFLGCRHFSQANALLEQQGDTPIDW 220


>gi|261379207|ref|ZP_05983780.1| uracil-DNA glycosylase [Neisseria cinerea ATCC 14685]
 gi|269144312|gb|EEZ70730.1| uracil-DNA glycosylase [Neisseria cinerea ATCC 14685]
          Length = 219

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L    +  + + +   +  E+  G+ I+P     F AF +T F++VKVVILGQDP
Sbjct: 3   TWHDALGGEKRQPYFQEILNAVRQERLSGQIIYPPAEDVFNAFRLTAFDRVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN V
Sbjct: 63  YHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L A
Sbjct: 123 LTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFS+AN YL +HG   +NW++
Sbjct: 183 PHPSPLSAYRGFFGCRHFSQANSYLSQHGIDPINWKL 219


>gi|87201268|ref|YP_498525.1| uracil-DNA glycosylase [Novosphingobium aromaticivorans DSM 12444]
 gi|87136949|gb|ABD27691.1| Uracil-DNA glycosylase [Novosphingobium aromaticivorans DSM 12444]
          Length = 226

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 147/224 (65%), Gaps = 3/224 (1%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +   W++ LE    S  +R L +FL +E+R GK I+P  +    A ++TP + V++VI
Sbjct: 3   LSLPADWRASLEPLLASPPLRALGDFLDAEERAGKTIYPPATQRLAALEMTPLDNVRIVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+++PPSL N+YKEL+ D+    P HG L  W  +GVLL
Sbjct: 63  LGQDPYHGPGQAHGLAFSVQDGVKVPPSLANIYKELEADLGLPRPPHGNLARWARQGVLL 122

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQ---DVLDHK 180
           LN+ LTVE   A SH+G+GWE  TD+ I  ++      VFMLWG+ AQKK      L   
Sbjct: 123 LNSALTVEAASAGSHQGKGWEALTDAAIAAVAARDVPTVFMLWGSHAQKKAARVARLASG 182

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HLVL+A HPSPLSA  GF GCRHFSKAN +L+ HG+  V+W+I
Sbjct: 183 PHLVLEAPHPSPLSAHKGFLGCRHFSKANAFLEAHGRRAVDWRI 226


>gi|188533125|ref|YP_001906922.1| Uracil-DNA-glycosylase [Erwinia tasmaniensis Et1/99]
 gi|238689732|sp|B2VEC7|UNG_ERWT9 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|188028167|emb|CAO96025.1| Uracil-DNA-glycosylase [Erwinia tasmaniensis Et1/99]
          Length = 227

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 149/220 (67%), Gaps = 3/220 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  + RN    + +E+  GK ++P  +  F AF +T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKEKPYFRNTLARVAAERAAGKTVYPPQTDVFNAFRLTELGGVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+ +PPSLVN+YKEL  D+  F  P HGFLE W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLAFSVLPGVPVPPSLVNMYKELVTDIPGFERPNHGFLESWARQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD+VI  I+ + + +VF+LWGA AQKK  ++D KRH VL A
Sbjct: 126 LTVEAGQAHSHVKFGWETFTDNVIAAINQHREGVVFLLWGAHAQKKGSIIDRKRHHVLHA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW--QIP 225
            HPSPLSA  GFFG  HFS+ANR+L EHG++ ++W  Q+P
Sbjct: 186 PHPSPLSAHRGFFGSAHFSQANRWLTEHGESAIDWMPQLP 225


>gi|239993594|ref|ZP_04714118.1| uracil-DNA glycosylase [Alteromonas macleodii ATCC 27126]
          Length = 223

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 145/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+S L +  Q ++   L E +   +  G  I+P  S  F A   TP ++VKVVILGQDP
Sbjct: 7   TWQSALGDEKQKDYFVTLLERVKHAREAGSVIYPPQSDVFNALKYTPLDEVKVVILGQDP 66

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSL N+YKEL  D+  F  P HG L  W  +GVLLLN V
Sbjct: 67  YHGPNQAHGLCFSVKAGVKTPPSLKNMYKELLSDIEGFTEPNHGTLTSWAEQGVLLLNTV 126

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VID+++ + QN+VF+LWG+ AQKK   ++ ++H VL A
Sbjct: 127 LTVEQGKAHSHAKWGWETFTDKVIDVVNEHCQNVVFLLWGSHAQKKGKHINREKHHVLHA 186

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC+HFS+ N YL   GK  +NWQ+
Sbjct: 187 PHPSPLSAHRGFLGCKHFSQTNEYLIAKGKEPINWQV 223


>gi|218264468|ref|ZP_03478301.1| hypothetical protein PRABACTJOHN_04001 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221961|gb|EEC94611.1| hypothetical protein PRABACTJOHN_04001 [Parabacteroides johnsonii
           DSM 18315]
          Length = 220

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SWK  L + F+  +   L  F+  E R+ + I+P G + F AF+  PF+KVKVVI
Sbjct: 3   VKIEQSWKERLSSEFEKNYFSQLITFVKEEYRQ-RTIYPPGPYIFSAFEHCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G   PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  LGQDPYHEPGQAHGLCFSVQDGTPFPPSLVNIFKEIESDLGKPVPQTGNLLRWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+VI  ++    +IV++LWG+ AQ+K   +D  R+L
Sbjct: 122 LNATLTVRAHQAGSHQNKGWEEFTDAVIHRLTEERSHIVYILWGSYAQRKGAFIDASRNL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LK+AHPSPLSA  GFFG +HFSKAN YL   G+T + W
Sbjct: 182 ILKSAHPSPLSAYRGFFGNKHFSKANDYLIATGQTPIEW 220


>gi|238784175|ref|ZP_04628188.1| Uracil-DNA glycosylase [Yersinia bercovieri ATCC 43970]
 gi|238714884|gb|EEQ06883.1| Uracil-DNA glycosylase [Yersinia bercovieri ATCC 43970]
          Length = 230

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 148/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +  SW  ++    +  + ++   ++ SE+  GK I+P+    F AF +T  ++VKVVI
Sbjct: 3   MSVSLSWHDVIGQEKELPYFKDTLAYVASERNAGKIIYPQQKDVFNAFRLTELDQVKVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVL
Sbjct: 63  LGQDPYHGPNQAHGLSFSVLPGVPAPPSLVNMYKELATDIPGFQRPNHGFLQSWAEQGVL 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTVE G A SH   GWE FTD VI  ++ + + ++FMLWGA AQKK  ++D +RH
Sbjct: 123 LLNTVLTVEAGNAHSHANLGWETFTDKVIAALNEHREGVIFMLWGAHAQKKGRIIDTQRH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            +LKA HPSPLSA  GF GC+HFS+AN+ LQ+ G   ++WQ
Sbjct: 183 FILKAPHPSPLSAHRGFLGCKHFSQANQLLQQQGLAPIDWQ 223


>gi|237739965|ref|ZP_04570446.1| uracil-DNA glycosylase [Fusobacterium sp. 2_1_31]
 gi|229421982|gb|EEO37029.1| uracil-DNA glycosylase [Fusobacterium sp. 2_1_31]
          Length = 225

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 150/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  FQ ++   LK  +L ++ +   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFQKDYFVELKS-ILEKEYENYTVYPLKKDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSL+N+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLLNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTSLTVRDSEANSHSKIGWQTFTDNVIKKLNEREKPIIFILWGNNAKAKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK AHPSPLSA+ GFFGC+HFS+ NR L+E  +  ++WQI
Sbjct: 182 LKGAHPSPLSANRGFFGCKHFSEVNRILKELKEKEIDWQI 221


>gi|209363953|ref|YP_001424430.2| uracil-DNA glycosylase [Coxiella burnetii Dugway 5J108-111]
 gi|238687227|sp|A9KCD5|UNG_COXBN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|207081886|gb|ABS78469.2| uracil-DNA glycosylase [Coxiella burnetii Dugway 5J108-111]
          Length = 225

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 149/217 (68%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+++L    Q  + + + +F+  E++ GK I+P     F A  +TP+  VKVVILGQD
Sbjct: 8   QTWQTVLGEEKQEPYFQEILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAVKVVILGQD 67

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGL FSV  G+  PPSL N++KEL  D+    P+HGFLE W  +GVLLLNA 
Sbjct: 68  PYHGPNQAHGLAFSVRPGVPAPPSLQNIFKELHADLGVSIPSHGFLEKWAKQGVLLLNAA 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+  SH   GW +FTD VI+ ++++ + IVF+LWG+ AQKK  ++ + RH +LKA
Sbjct: 128 LTVEAGKPQSHANIGWHRFTDKVIESLNDHPEVIVFLLWGSYAQKKSQLITNLRHRILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA+ GF GCRHFSKAN+ L E G+  ++W +
Sbjct: 188 PHPSPLSAARGFLGCRHFSKANQLLHEMGRGEIDWAL 224


>gi|325128239|gb|EGC51124.1| uracil-DNA glycosylase [Neisseria meningitidis N1568]
          Length = 219

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VK VILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPEADVFNAFRLTAFDRVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGCRHFS+AN YL  HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCRHFSQANSYLSRHGIDPINWKL 219


>gi|225425065|ref|XP_002271878.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 328

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +W   L   FQ  + + L  FL  E    G  I+P     F A + TPF++VK VI+GQD
Sbjct: 112 TWLDALPGEFQKPYAKTLCRFLEREVCGSGVPIYPPQHLIFNALNSTPFDRVKAVIIGQD 171

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH  GQA GL FSVP G+++P SLVN++KELQ+D+    P+HG LE W  +GVLLLNAV
Sbjct: 172 PYHGPGQAMGLSFSVPEGVKVPSSLVNIFKELQQDLGCSIPSHGNLEKWAVQGVLLLNAV 231

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV   +A SH  +GWEQFTDSVI  IS   + +VF+LWG SAQ+K  ++D  +H +LKA
Sbjct: 232 LTVRSHQANSHAKKGWEQFTDSVIRTISQKQRGVVFLLWGNSAQEKSRLIDDTKHHILKA 291

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPS LSA+ GFFGCRHFS+ N+ L++ G   ++WQ+
Sbjct: 292 AHPSGLSANRGFFGCRHFSRTNKILEQKGVPPIDWQL 328


>gi|169640263|gb|ACA61185.1| uracil-DNA glycosylase [Campylobacter coli]
 gi|169640270|gb|ACA61191.1| uracil-DNA glycosylase [Campylobacter coli]
          Length = 231

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E +KI+  WK  L+  F   +   +K+  +        I+P  +  F AF++TP +++K
Sbjct: 8   IEDIKINNDWKEFLKEEFSKSYFLEIKKRYIQALNNKAIIYPPSNLTFNAFNLTPLSELK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           +V+LGQDPYH   QA GL FSVP G++IPPSL+N+YKEL+ D+N  P   G L  W  +G
Sbjct: 68  IVLLGQDPYHQPNQAMGLSFSVPCGVKIPPSLLNIYKELKADLNIEPSKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE G+ ASH   GW++F+D++I  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEAGKPASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKSKEILIDNA 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++  K  ++W+I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANEFLKKVDKIPIDWKI 230


>gi|154491807|ref|ZP_02031433.1| hypothetical protein PARMER_01428 [Parabacteroides merdae ATCC
           43184]
 gi|154088048|gb|EDN87093.1| hypothetical protein PARMER_01428 [Parabacteroides merdae ATCC
           43184]
          Length = 220

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/219 (51%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI +SWK  L + F+ ++   L  F+  E R+ + ++P G   F AF+  PF+KVKVVI
Sbjct: 3   VKIEQSWKERLSSEFEKDYFSQLITFVKEEYRQ-RTVYPPGPCIFSAFEHCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G   PPSLVN++KE++ D+    P  G L  W  +GVLL
Sbjct: 62  LGQDPYHEPGQAHGLCFSVQDGTPFPPSLVNIFKEIESDLGKPMPQTGNLLRWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+VI  ++    +IV++LWG+ AQ+K   +D  R+L
Sbjct: 122 LNATLTVRAHQAGSHQNKGWEEFTDAVIHRLTEERSHIVYILWGSYAQRKGAFIDASRNL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +LK+AHPSPLSA  GFFG +HFSKAN YL   G+T ++W
Sbjct: 182 ILKSAHPSPLSAYRGFFGNKHFSKANDYLIATGQTPIDW 220


>gi|90580591|ref|ZP_01236396.1| uracil-DNA glycosylase [Vibrio angustum S14]
 gi|90438249|gb|EAS63435.1| uracil-DNA glycosylase [Photobacterium angustum S14]
          Length = 220

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW + +E      +   +++ + + +  GK +FP     + AF  TP  + KVVILGQDP
Sbjct: 4   SWSTFIEQQRAQAYFSEIEQAVDAARASGKVVFPPQEDIYNAFISTPLEQTKVVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G++ PPSL N+YKEL  D+  F+ P HG+L+ W  +GVLLLN V
Sbjct: 64  YHGPKQAHGLSFSVLPGVKTPPSLANMYKELANDIEGFVVPEHGYLQPWAEQGVLLLNTV 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FT+  I+ I++N + ++F+LWGA AQKK   +D +RH VL +
Sbjct: 124 LTVEQGNAHSHAKIGWETFTERAIEYINDNTEGVIFLLWGAHAQKKGKKIDTERHHVLHS 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSA  GFFGC+HFSK N+ L E GK+ +NWQ+
Sbjct: 184 AHPSPLSAYRGFFGCQHFSKTNQLLAEMGKSAINWQL 220


>gi|297531621|ref|YP_003672896.1| uracil-DNA glycosylase [Geobacillus sp. C56-T3]
 gi|297254873|gb|ADI28319.1| uracil-DNA glycosylase [Geobacillus sp. C56-T3]
          Length = 229

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  FQ  +   L+EFL  E R  + I+P     F A   TP+  VKVV+LG
Sbjct: 4   LKNDWAPLLEEEFQKPYYLKLREFLKVEYRT-RTIYPDMHDIFNALHYTPYANVKVVLLG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPVPPSLVNIFKELHDDLGCYIPDNGYLVKWAEQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWE FTD VI+L++     +VF+LWG +AQ+K++ + + RHL++
Sbjct: 123 TVLTVRRGQANSHRGKGWEYFTDRVIELVNEKDDPVVFLLWGRNAQEKKERITNPRHLII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+ N +L +HG+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRTNAFLTKHGREPIDWQI 221


>gi|329941504|ref|ZP_08290769.1| uracil-DNA glycosylase [Streptomyces griseoaurantiacus M045]
 gi|329299221|gb|EGG43121.1| uracil-DNA glycosylase [Streptomyces griseoaurantiacus M045]
          Length = 227

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+ +G  ++P     F A D TP++KVKV++LG
Sbjct: 7   LPESWQGVLGDELQQPYFKELTEFVEEERARGP-VYPPREEVFAALDATPYDKVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+R PPSL N+YKE+Q ++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVRTPPSLRNIYKEMQAELGTPIPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+GRGWE+FTD+VI  ++      VF+LWG  AQKK  ++D  RH V+
Sbjct: 126 AVLTVRAGEANSHKGRGWEKFTDAVIRAVAGRPDPAVFVLWGNYAQKKLPLIDESRHTVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G T ++W IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHTPIDWTIP 224


>gi|254458190|ref|ZP_05071616.1| uracil-DNA glycosylase [Campylobacterales bacterium GD 1]
 gi|207085026|gb|EDZ62312.1| uracil-DNA glycosylase [Campylobacterales bacterium GD 1]
          Length = 221

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 151/217 (69%), Gaps = 1/217 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W +L  +  Q E+   L+EF+ +E  K   IFP   + FRAF++    +VKVVILG
Sbjct: 3   LNNEWSALFASEMQKEYFIKLQEFVEAE-YKAVTIFPEYENIFRAFNLVTPEQVKVVILG 61

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QA+GL FSV    +IPPSL+N++KEL +D     P  G L  W  +GVLL+N
Sbjct: 62  QDPYHGERQANGLAFSVCDECKIPPSLINIFKELVDDEGCKKPASGNLTSWAEQGVLLIN 121

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTVE+ +A SH+GRGWE+F+D VI  +S+ ++NIVF+LWG  +QKK++++D   HLVL
Sbjct: 122 SVLTVEQAKANSHKGRGWEKFSDFVIKKLSSEYENIVFILWGGPSQKKENLIDASTHLVL 181

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           KA HPSPLS+  GFFG + FSK+N YL+ HGK  +NW
Sbjct: 182 KAPHPSPLSSYRGFFGSKPFSKSNEYLKAHGKKEINW 218


>gi|268610852|ref|ZP_06144579.1| uracil-DNA glycosylase [Ruminococcus flavefaciens FD-1]
          Length = 223

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 148/222 (66%), Gaps = 2/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V     W  LL+  F  E+   L++ L++E R  + I+P     + A  +T +N VK VI
Sbjct: 2   VNFGNDWDQLLDGEFDKEYYLKLRQTLINEYRT-QTIYPNMYDIYNAMKLTSYNDVKCVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIP-PTHGFLEHWGHEGVL 122
           +GQDPYH  GQAHGL FSV  GI  PPSLVN++KE+++DV       HG L  W   GVL
Sbjct: 61  IGQDPYHGAGQAHGLSFSVRKGIAPPPSLVNIFKEIRDDVGIDNLGKHGELTKWAESGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN+VLTV   +A SHRG GWE FT  VI L++   + +VFMLWG  A+ KQ  + +K+H
Sbjct: 121 LLNSVLTVRADQARSHRGLGWEYFTTDVIKLLNEREKPMVFMLWGGDAKAKQQFITNKQH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L+LKAAHPSPLSA +GFFGCRHFSKAN +L+EHG + ++W I
Sbjct: 181 LILKAAHPSPLSAYNGFFGCRHFSKANAFLREHGMSEIDWSI 222


>gi|227891150|ref|ZP_04008955.1| uracil-DNA glycosylase [Lactobacillus salivarius ATCC 11741]
 gi|227867024|gb|EEJ74445.1| uracil-DNA glycosylase [Lactobacillus salivarius ATCC 11741]
          Length = 232

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +L   F+  +   L  FL +E  K + I P   H + AF+ TPF+KVKVVILG
Sbjct: 6   IHNDWQEVLGPEFEKPYYTELHNFLKNE-YKTQYIHPDMYHIYEAFEWTPFSKVKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+YKEL  D+   P  HG+LE W  +GVL+LN
Sbjct: 65  QDPYHGPNQAHGLSFSVLPGVAIPPSLRNIYKELYSDLGIKPVNHGYLEKWAKQGVLMLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWE+ TD  I  +S     +VF+LWGA+A+KK  ++D K+++++
Sbjct: 125 SVLTVRNGQAFSHQGKGWEKLTDEAIKKLSERPMPVVFILWGAAARKKSALIDRKKNIII 184

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSA+ GFFG R FSK N  L+  G+T ++WQ+P
Sbjct: 185 ESPHPSPLSANRGFFGSRPFSKTNAALEALGETPIDWQLP 224


>gi|86147393|ref|ZP_01065706.1| uracil-DNA glycosylase [Vibrio sp. MED222]
 gi|85834821|gb|EAQ52966.1| uracil-DNA glycosylase [Vibrio sp. MED222]
          Length = 226

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+S++ +    E+ +++  F+  ++  GK ++P     F AFD+TPF  V+VVILGQD
Sbjct: 5   KTWESIINDERDKEYFQSVLAFVEQQRNSGKTVYPPQELVFSAFDMTPFESVRVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  G++IPPSL N+YKEL +D+  F  P+HG+L+ W  +GVL+LN 
Sbjct: 65  PYHGANQAHGLAFSVLPGVKIPPSLRNMYKELAQDIEGFEIPSHGYLDTWASQGVLMLNT 124

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVEE +A SH   GWE FTD++I  ++   + I+F+LWGA AQKK   +D  +H VL 
Sbjct: 125 VLTVEEAKAHSHAKCGWETFTDAIIAELNQRSEPIIFLLWGAHAQKKGQAIDADKHHVLV 184

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           A HPSPLSA  GFFGC+HFS  N  L    +  ++W +PL+
Sbjct: 185 APHPSPLSARRGFFGCQHFSMTNELLSSINQQPIDWTLPLA 225


>gi|150019699|ref|YP_001311953.1| uracil-DNA glycosylase [Clostridium beijerinckii NCIMB 8052]
 gi|189037435|sp|A6M317|UNG_CLOB8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|149906164|gb|ABR36997.1| uracil-DNA glycosylase [Clostridium beijerinckii NCIMB 8052]
          Length = 225

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   WK+ L++ FQ ++  NL++FL++E    K I+P     F A   TP+NKVKVVILG
Sbjct: 5   LKNDWKNYLQSEFQKDYYINLRKFLINE-YNSKTIYPNMYDLFNALHFTPYNKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G++ PPSL+N+YKEL  D+    P +G+L  W  +GVLLLN
Sbjct: 64  QDPYHGPGQAHGLSFSVNPGVKTPPSLINIYKELHTDLGCYIPNNGYLRKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G A SH+ +GWE+FT+ VI +++     IVF+LWG +A  K D + + +HL++
Sbjct: 124 TVLTVRAGEANSHKNKGWEEFTNEVIKVLNKKETPIVFILWGNNAISKTDFITNPKHLII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           K+ HPSPLSAS GFFG + FSK N +L    +  ++WQI
Sbjct: 184 KSVHPSPLSASRGFFGSKPFSKTNNFLISTNQEPIDWQI 222


>gi|227514416|ref|ZP_03944465.1| uracil-DNA glycosylase [Lactobacillus fermentum ATCC 14931]
 gi|227087282|gb|EEI22594.1| uracil-DNA glycosylase [Lactobacillus fermentum ATCC 14931]
          Length = 232

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W  +L+  F++ + + L  FL+ E    ++++P   H F AF+ TPF+KVKVVILG
Sbjct: 8   INNDWWPVLKPQFETANYQQLHNFLVDEYGH-QQVYPEMHHIFEAFNWTPFSKVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L  W  +GVLLLN
Sbjct: 67  QDPYHGPGQAHGCSFSVLPGVAVPPSLQNIYKELQADLGCPPVKHGYLRSWAEQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G GWEQ TD+ I  +S     +VF+LWG +A+ K+ ++D KR+ V+
Sbjct: 127 SVLTVRAGQAYSHQGHGWEQLTDAAIVALSKRPTPVVFILWGRAARDKKRLIDLKRNFVV 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG R FSK N++L+  G+  +NWQ+P
Sbjct: 187 ESAHPSPLSAYRGFFGSRPFSKTNQFLEMTGQAPINWQLP 226


>gi|157376820|ref|YP_001475420.1| uracil-DNA glycosylase [Shewanella sediminis HAW-EB3]
 gi|157319194|gb|ABV38292.1| uracil-DNA glycosylase [Shewanella sediminis HAW-EB3]
          Length = 222

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 7   HESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQ 66
           H +W S +E     ++   L+ F+ +E+ +GK IFP     F AF++TP ++V+VVI+GQ
Sbjct: 4   HSNWDSFIEAEKLQDYFTQLQAFVSAERAQGKAIFPPQDEVFSAFELTPLDRVRVVIIGQ 63

Query: 67  DPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLN 125
           DPYH   QAHGLCFSV  GI+ PPSLVN+YKEL +D++ F+ P HG L  W  +GVL+LN
Sbjct: 64  DPYHGPEQAHGLCFSVKHGIKTPPSLVNMYKELVDDIDGFVTPNHGHLSSWAEQGVLMLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE+G+A SH   GWE FT   ++L++     IVF+LWGA A KK  V+   +H +L
Sbjct: 124 TVLTVEQGKAHSHAKSGWETFTTHALELLNRQTTPIVFILWGAHAIKKGKVITAPQHHIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
              HPSPLSA  GFFGC+HFSK N  L+  G   + WQ+
Sbjct: 184 SGPHPSPLSAYRGFFGCKHFSKTNDLLELDGSDPITWQV 222


>gi|184154849|ref|YP_001843189.1| uracil-DNA glycosylase [Lactobacillus fermentum IFO 3956]
 gi|260663121|ref|ZP_05864013.1| uracil-DNA glycosylase [Lactobacillus fermentum 28-3-CHN]
 gi|238692950|sp|B2GAM7|UNG_LACF3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|183226193|dbj|BAG26709.1| uracil-DNA glycosylase [Lactobacillus fermentum IFO 3956]
 gi|260552313|gb|EEX25364.1| uracil-DNA glycosylase [Lactobacillus fermentum 28-3-CHN]
          Length = 229

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W  +L+  F++ + + L  FL+ E    ++++P   H F AF+ TPF+KVKVVILG
Sbjct: 5   INNDWWPVLKPQFETANYQQLHNFLVDEYGH-QQVYPEMHHIFEAFNWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHG  FSV  G+ +PPSL N+YKELQ D+   P  HG+L  W  +GVLLLN
Sbjct: 64  QDPYHGPGQAHGCSFSVLPGVAVPPSLQNIYKELQADLGCPPVKHGYLRSWAEQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G GWEQ TD+ I  +S     +VF+LWG +A+ K+ ++D KR+ V+
Sbjct: 124 SVLTVRAGQAYSHQGHGWEQLTDAAIVALSKRPTPVVFILWGRAARDKKRLIDLKRNFVV 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG R FSK N++L+  G+  +NWQ+P
Sbjct: 184 ESAHPSPLSAYRGFFGSRPFSKTNQFLEMTGQAPINWQLP 223


>gi|297738247|emb|CBI27448.3| unnamed protein product [Vitis vinifera]
          Length = 321

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +W   L   FQ  + + L  FL  E    G  I+P     F A + TPF++VK VI+GQD
Sbjct: 105 TWLDALPGEFQKPYAKTLCRFLEREVCGSGVPIYPPQHLIFNALNSTPFDRVKAVIIGQD 164

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH  GQA GL FSVP G+++P SLVN++KELQ+D+    P+HG LE W  +GVLLLNAV
Sbjct: 165 PYHGPGQAMGLSFSVPEGVKVPSSLVNIFKELQQDLGCSIPSHGNLEKWAVQGVLLLNAV 224

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV   +A SH  +GWEQFTDSVI  IS   + +VF+LWG SAQ+K  ++D  +H +LKA
Sbjct: 225 LTVRSHQANSHAKKGWEQFTDSVIRTISQKQRGVVFLLWGNSAQEKSRLIDDTKHHILKA 284

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPS LSA+ GFFGCRHFS+ N+ L++ G   ++WQ+
Sbjct: 285 AHPSGLSANRGFFGCRHFSRTNKILEQKGVPPIDWQL 321


>gi|90962127|ref|YP_536043.1| uracil-DNA glycosylase [Lactobacillus salivarius UCC118]
 gi|90821321|gb|ABD99960.1| Uracil-DNA glycosylase [Lactobacillus salivarius UCC118]
 gi|300214812|gb|ADJ79228.1| Uracil-DNA glycosylase [Lactobacillus salivarius CECT 5713]
          Length = 232

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +L   F+  +   L  FL +E  K + I P   H + AF+ TPF+KVKVVILG
Sbjct: 6   IHNDWQEVLGPEFEKPYYTELHNFLKNE-YKTQYIHPDMYHIYEAFEWTPFSKVKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+YKEL  D+   P  HG+LE W  +GVL+LN
Sbjct: 65  QDPYHGPNQAHGLSFSVLPGVAIPPSLRNIYKELYSDLGIKPVNHGYLEKWAKQGVLMLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWE+ TD  I  +S     +VF+LWGA+A+KK  ++D K+++++
Sbjct: 125 SVLTVRNGQAFSHQGKGWEKLTDEAIKKLSERPMPVVFILWGAAARKKAALIDRKKNIII 184

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSA+ GFFG R FSK N  L+  G+T ++WQ+P
Sbjct: 185 ESPHPSPLSANRGFFGSRPFSKTNAALEALGETPIDWQLP 224


>gi|225027209|ref|ZP_03716401.1| hypothetical protein EUBHAL_01465 [Eubacterium hallii DSM 3353]
 gi|224955469|gb|EEG36678.1| hypothetical protein EUBHAL_01465 [Eubacterium hallii DSM 3353]
          Length = 224

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L+  ++  + R L +  ++E+ + + IFP     F AF +TP   VKVVILG
Sbjct: 4   INNDWAEALKEEYRKPYYRELYK-KINEEYRTREIFPPSDEIFSAFHLTPLKNVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGL FSV  G+ IPPSLVN+YKEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHNNGQAHGLSFSVKPGVDIPPSLVNIYKELHDDLGCYIPNNGYLVKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + +VF+LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRVLNAQDRPLVFLLWGRPAQNKKPMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFGCRHFS+AN +L+ H    ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGCRHFSQANEFLRFHELEPIDWQI 221


>gi|212710678|ref|ZP_03318806.1| hypothetical protein PROVALCAL_01744 [Providencia alcalifaciens DSM
           30120]
 gi|212686759|gb|EEB46287.1| hypothetical protein PROVALCAL_01744 [Providencia alcalifaciens DSM
           30120]
          Length = 222

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 146/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++       + ++   F+  E+  GK I+P     F AF  T    +KVVILGQDP
Sbjct: 2   TWHDVIGAEKSQPYFKDTLAFVAKERENGKVIYPPQEDVFNAFRYTELGDIKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI+ PPSLVN+YKEL++D+  F+ P HG+L  W  +GVLLLN V
Sbjct: 62  YHGPGQAHGLSFSVRPGIKAPPSLVNMYKELEKDIPGFVRPDHGYLLSWAQQGVLLLNTV 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI  I+++ + ++F+LWG+ AQKK  ++D KRH VLKA
Sbjct: 122 LTVEQGHAHSHAHLGWEAFTDKVIQAINDHTEGVIFLLWGSHAQKKGRIIDTKRHHVLKA 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFSKAN+ L++ G+T +NW
Sbjct: 182 PHPSPLSAHRGFLGCGHFSKANQLLEQQGRTPINW 216


>gi|161526034|ref|YP_001581046.1| uracil-DNA glycosylase [Burkholderia multivorans ATCC 17616]
 gi|189349249|ref|YP_001944877.1| uracil-DNA glycosylase [Burkholderia multivorans ATCC 17616]
 gi|28812252|dbj|BAC65127.1| uracil-DNA glycosylase [Burkholderia multivorans]
 gi|160343463|gb|ABX16549.1| uracil-DNA glycosylase [Burkholderia multivorans ATCC 17616]
 gi|189333271|dbj|BAG42341.1| uracil-DNA glycosylase [Burkholderia multivorans ATCC 17616]
          Length = 301

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 145/220 (65%), Gaps = 6/220 (2%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L+    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDPY
Sbjct: 77  WRDVLKPFIDSDAYAPLCRFVDDERAAGKTIYP--TDVFRALRLTSPDDVKVVILGQDPY 134

Query: 70  HN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           H       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLLN
Sbjct: 135 HGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEISANFGHDTPRHGCLDTWARQGVLLLN 194

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H VL
Sbjct: 195 TVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCVL 254

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GF GCRHF+ AN YL EHG+T ++W++P
Sbjct: 255 EAPHPSPLSAHRGFLGCRHFALANDYLVEHGRTPIDWRLP 294


>gi|323138230|ref|ZP_08073302.1| uracil-DNA glycosylase [Methylocystis sp. ATCC 49242]
 gi|322396482|gb|EFX99011.1| uracil-DNA glycosylase [Methylocystis sp. ATCC 49242]
          Length = 222

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESWK  L + F+  +   L+EF+  E   G  ++P  +  FRAFD  PF+ VKVVI
Sbjct: 5   VRIDESWKKHLASEFEKPYFAELREFVRGEYASGA-VYPPAAQIFRAFDECPFDSVKVVI 63

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCF+V   +  PPSL N++KE++ D+         L  W  +GVLL
Sbjct: 64  LGQDPYHGPGQANGLCFAVHSNVPPPPSLQNIFKEIEADLGHPVSRDPDLSRWARQGVLL 123

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWEQFTD+ +  +S     +VFMLWG+ A++K   +D K+HL
Sbjct: 124 LNATLTVRAAQAGSHQNKGWEQFTDAAVHTLSRERDGLVFMLWGSYARRKGAGIDRKKHL 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL+ AHPSPLSA +GFFGC+HFS+AN YL   GKT + W
Sbjct: 184 VLECAHPSPLSAHNGFFGCKHFSRANDYLAAQGKTPIEW 222


>gi|221213309|ref|ZP_03586284.1| uracil-DNA glycosylase [Burkholderia multivorans CGD1]
 gi|221166761|gb|EED99232.1| uracil-DNA glycosylase [Burkholderia multivorans CGD1]
          Length = 298

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 145/220 (65%), Gaps = 6/220 (2%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L+    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDPY
Sbjct: 74  WRDVLKPFIDSDAYAPLCRFVDDERAAGKTIYP--TDVFRALRLTSPDDVKVVILGQDPY 131

Query: 70  HN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           H       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLLN
Sbjct: 132 HGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLLN 191

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H VL
Sbjct: 192 TVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCVL 251

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GF GCRHF+ AN YL EHG+T ++W++P
Sbjct: 252 EAPHPSPLSAHRGFLGCRHFALANDYLVEHGRTPIDWRLP 291


>gi|221201745|ref|ZP_03574783.1| uracil-DNA glycosylase [Burkholderia multivorans CGD2M]
 gi|221207180|ref|ZP_03580190.1| uracil-DNA glycosylase [Burkholderia multivorans CGD2]
 gi|221172768|gb|EEE05205.1| uracil-DNA glycosylase [Burkholderia multivorans CGD2]
 gi|221178561|gb|EEE10970.1| uracil-DNA glycosylase [Burkholderia multivorans CGD2M]
          Length = 298

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 145/220 (65%), Gaps = 6/220 (2%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L+    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDPY
Sbjct: 74  WRDVLKPFIDSDAYAPLCRFVDDERAAGKTIYP--TDVFRALRLTSPDDVKVVILGQDPY 131

Query: 70  HN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           H       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLLN
Sbjct: 132 HGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLLN 191

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H VL
Sbjct: 192 TVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCVL 251

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GF GCRHF+ AN YL EHG+T ++W++P
Sbjct: 252 EAPHPSPLSAHRGFLGCRHFALANDYLVEHGRTPIDWRLP 291


>gi|319760663|ref|YP_004124601.1| uracil-DNA glycosylase [Candidatus Blochmannia vafer str. BVAF]
 gi|318039377|gb|ADV33927.1| uracil-DNA glycosylase [Candidatus Blochmannia vafer str. BVAF]
          Length = 222

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 148/217 (68%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +WK LL    +  + + +   L  + + G  I+P+ +  F AF  T F  VKVVILGQDP
Sbjct: 6   TWKLLLSKETKLPYFKKIFNILNQKNKLGITIYPKSTDIFNAFRFTEFESVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI  PPSL N+YKEL  D+ +FI P HG+L  W  EGVLLLN++
Sbjct: 66  YHRPNQAHGLAFSVSPGITPPPSLKNIYKELSTDISDFITPKHGYLLSWAKEGVLLLNSI 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G++ SH   GWE+FTD +I +++   +NIVF+LWG  A++K  +++ ++H +L A
Sbjct: 126 LTVEQGKSCSHAYIGWEKFTDKIIHILNIYQKNIVFLLWGNYAKRKGKIINTQKHYILSA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           AHPSPLSA +GF GC+HFSK N  L +H K T+NW++
Sbjct: 186 AHPSPLSAHYGFLGCKHFSKTNALLLKHNKNTINWKL 222


>gi|261420832|ref|YP_003254514.1| uracil-DNA glycosylase [Geobacillus sp. Y412MC61]
 gi|319768501|ref|YP_004134002.1| uracil-DNA glycosylase [Geobacillus sp. Y412MC52]
 gi|261377289|gb|ACX80032.1| uracil-DNA glycosylase [Geobacillus sp. Y412MC61]
 gi|317113367|gb|ADU95859.1| uracil-DNA glycosylase [Geobacillus sp. Y412MC52]
          Length = 229

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  FQ  +   L+EFL  E R  + I+P     F A   TP+  VKVV+LG
Sbjct: 4   LKNDWAPLLEEEFQKPYYLKLREFLKVEYRT-RTIYPDMHDIFNALHYTPYANVKVVLLG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPVPPSLVNIFKELHDDLGCYIPDNGYLVKWAEQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWEQFTD VI+L++     +VF+LWG +AQ+K++ + + RHL++
Sbjct: 123 TVLTVRRGQANSHRGKGWEQFTDRVIELVNEKDDPVVFLLWGRNAQEKKERITNPRHLII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+ N +L + G+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRTNAFLMKCGREPIDWQI 221


>gi|331654043|ref|ZP_08355044.1| uracil-DNA glycosylase [Escherichia coli M718]
 gi|331048892|gb|EGI20968.1| uracil-DNA glycosylase [Escherichia coli M718]
          Length = 229

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220


>gi|302387701|ref|YP_003823523.1| uracil-DNA glycosylase [Clostridium saccharolyticum WM1]
 gi|302198329|gb|ADL05900.1| uracil-DNA glycosylase [Clostridium saccharolyticum WM1]
          Length = 224

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L   F+  + R L + +  E      +FP  +  F AF  TP +KVK VILG
Sbjct: 4   IENDWLDPLSGEFKKPYYRELYQKVKHEYETA-LVFPDPNDIFNAFQFTPLSKVKAVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV   + IPPSLVN+Y+EL+ED+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHNNGQAHGLCFSVKPDVDIPPSLVNIYQELKEDLGCEIPNNGYLKKWADQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SH+G GWE FTD+ I +++   + +VF+LWG  AQ K+ +L + RHL+L
Sbjct: 123 TVLTVRAHAANSHQGMGWEAFTDAAIKILNEQDRPMVFLLWGRPAQSKKAMLTNPRHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFGCRHFS+ N YL+++G   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGCRHFSRTNAYLKDNGLEPIDWQI 221


>gi|15803107|ref|NP_289138.1| uracil-DNA glycosylase [Escherichia coli O157:H7 EDL933]
 gi|82778008|ref|YP_404357.1| uracil-DNA glycosylase [Shigella dysenteriae Sd197]
 gi|168757755|ref|ZP_02782762.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4401]
 gi|168765026|ref|ZP_02790033.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4501]
 gi|168768685|ref|ZP_02793692.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4486]
 gi|168773491|ref|ZP_02798498.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4196]
 gi|168778559|ref|ZP_02803566.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4076]
 gi|168790381|ref|ZP_02815388.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC869]
 gi|168801699|ref|ZP_02826706.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC508]
 gi|195936728|ref|ZP_03082110.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4024]
 gi|208806480|ref|ZP_03248817.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4206]
 gi|208813886|ref|ZP_03255215.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4045]
 gi|208819089|ref|ZP_03259409.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4042]
 gi|209398327|ref|YP_002272055.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4115]
 gi|217327894|ref|ZP_03443977.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. TW14588]
 gi|218706085|ref|YP_002413604.1| uracil-DNA glycosylase [Escherichia coli UMN026]
 gi|254794531|ref|YP_003079368.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. TW14359]
 gi|261222984|ref|ZP_05937265.1| uracil-DNA-glycosylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259466|ref|ZP_05951999.1| uracil-DNA-glycosylase [Escherichia coli O157:H7 str. FRIK966]
 gi|291283856|ref|YP_003500674.1| Uracil-DNA glycosylase [Escherichia coli O55:H7 str. CB9615]
 gi|293406023|ref|ZP_06650015.1| uracil-DNA glycosylase [Escherichia coli FVEC1412]
 gi|293415849|ref|ZP_06658492.1| uracil-DNA glycosylase [Escherichia coli B185]
 gi|298381823|ref|ZP_06991422.1| uracil-DNA glycosylase [Escherichia coli FVEC1302]
 gi|300895648|ref|ZP_07114248.1| uracil-DNA glycosylase [Escherichia coli MS 198-1]
 gi|309784598|ref|ZP_07679233.1| uracil-DNA glycosylase [Shigella dysenteriae 1617]
 gi|25009526|sp|Q8X444|UNG_ECO57 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|123561850|sp|Q32CT9|UNG_SHIDS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725942|sp|B7N6H1|UNG_ECOLU RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238058165|sp|B5Z154|UNG_ECO5E RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|12517001|gb|AAG57696.1|AE005488_7 uracil-DNA-glycosylase [Escherichia coli O157:H7 str. EDL933]
 gi|81242156|gb|ABB62866.1| uracil-DNA-glycosylase [Shigella dysenteriae Sd197]
 gi|187770722|gb|EDU34566.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4196]
 gi|189003330|gb|EDU72316.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4076]
 gi|189355281|gb|EDU73700.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4401]
 gi|189362222|gb|EDU80641.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4486]
 gi|189365092|gb|EDU83508.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4501]
 gi|189370147|gb|EDU88563.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC869]
 gi|189376162|gb|EDU94578.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC508]
 gi|208726281|gb|EDZ75882.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4206]
 gi|208735163|gb|EDZ83850.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4045]
 gi|208739212|gb|EDZ86894.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4042]
 gi|209159727|gb|ACI37160.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. EC4115]
 gi|217320261|gb|EEC28686.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. TW14588]
 gi|218433182|emb|CAR14080.1| uracil-DNA-glycosylase [Escherichia coli UMN026]
 gi|254593931|gb|ACT73292.1| uracil-DNA-glycosylase [Escherichia coli O157:H7 str. TW14359]
 gi|290763729|gb|ADD57690.1| Uracil-DNA glycosylase [Escherichia coli O55:H7 str. CB9615]
 gi|291428231|gb|EFF01258.1| uracil-DNA glycosylase [Escherichia coli FVEC1412]
 gi|291433497|gb|EFF06476.1| uracil-DNA glycosylase [Escherichia coli B185]
 gi|298279265|gb|EFI20779.1| uracil-DNA glycosylase [Escherichia coli FVEC1302]
 gi|300360408|gb|EFJ76278.1| uracil-DNA glycosylase [Escherichia coli MS 198-1]
 gi|308927495|gb|EFP72967.1| uracil-DNA glycosylase [Shigella dysenteriae 1617]
 gi|320188921|gb|EFW63580.1| Uracil-DNA glycosylase, family 1 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320640829|gb|EFX10323.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. G5101]
 gi|320646175|gb|EFX15115.1| uracil-DNA glycosylase [Escherichia coli O157:H- str. 493-89]
 gi|320651470|gb|EFX19866.1| uracil-DNA glycosylase [Escherichia coli O157:H- str. H 2687]
 gi|320657072|gb|EFX24891.1| uracil-DNA glycosylase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662737|gb|EFX30076.1| uracil-DNA glycosylase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667557|gb|EFX34477.1| uracil-DNA glycosylase [Escherichia coli O157:H7 str. LSU-61]
 gi|326340386|gb|EGD64190.1| Uracil-DNA glycosylase, family 1 [Escherichia coli O157:H7 str.
           1125]
 gi|326345069|gb|EGD68813.1| Uracil-DNA glycosylase, family 1 [Escherichia coli O157:H7 str.
           1044]
          Length = 229

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220


>gi|308810014|ref|XP_003082316.1| uracil-DNA glycosylase-like protein (ISS) [Ostreococcus tauri]
 gi|116060784|emb|CAL57262.1| uracil-DNA glycosylase-like protein (ISS) [Ostreococcus tauri]
          Length = 297

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/218 (49%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ESW  +L   F   + + L++FL SE++   ++FP     FRAFD    + VKVVI+GQD
Sbjct: 74  ESWLDVLRPEFAKPYWKTLEKFLESEEKASAKVFPPKELVFRAFDSCAMSGVKVVIIGQD 133

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH+ GQA GLCFSVP G+R+P SL N+YKEL+ D+N   P HG L  W  +GVLLLN  
Sbjct: 134 PYHDVGQAMGLCFSVPKGVRVPSSLHNIYKELRTDLNCKIPQHGDLTQWAEQGVLLLNVS 193

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR-HLVLK 186
           LTV   +A SH  +GWE FTD+ I  ++ N + +VF+LWG +AQ K+ ++     HL+LK
Sbjct: 194 LTVRAHQANSHSKKGWENFTDAAIRELAKNRKGLVFLLWGKNAQDKEKLISKANDHLILK 253

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            AHPS LSA  GFFGC+HFS+ N +++++G T ++WQI
Sbjct: 254 CAHPSGLSAHRGFFGCKHFSQCNAFIEKNGGTPIDWQI 291


>gi|161831557|ref|YP_001596724.1| uracil-DNA glycosylase [Coxiella burnetii RSA 331]
 gi|161763424|gb|ABX79066.1| uracil-DNA glycosylase [Coxiella burnetii RSA 331]
          Length = 225

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 150/217 (69%), Gaps = 1/217 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+++L    Q  + + + +F+  E++ GK I+P     F A  +TP+  +KVVILGQD
Sbjct: 5   QTWQTVLGEEKQEPYFQEILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAIKVVILGQD 64

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGL FSV  G+  PPSL N++KEL  D+  IP +HGFLE W  +GVLLLNA 
Sbjct: 65  PYHGPNQAHGLAFSVRPGVPAPPSLQNIFKELHADLGSIP-SHGFLEKWAKQGVLLLNAA 123

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+  SH   GW +FTD VI+ ++++ + IVF+LWG+ AQKK  ++ + RH +LKA
Sbjct: 124 LTVEAGKPQSHANIGWHRFTDKVIESLNDHPEGIVFLLWGSYAQKKSQLITNLRHRILKA 183

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA+ GF GCRHFSKAN+ L E G+  ++W +
Sbjct: 184 PHPSPLSAARGFLGCRHFSKANQLLHEMGRGEIDWAL 220


>gi|302824596|ref|XP_002993940.1| hypothetical protein SELMODRAFT_46637 [Selaginella moellendorffii]
 gi|300138212|gb|EFJ04987.1| hypothetical protein SELMODRAFT_46637 [Selaginella moellendorffii]
          Length = 280

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/224 (49%), Positives = 147/224 (65%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E + +  SW  +L++ F+  +M NL+ F+  +      ++P  +  F AF+  PF++VK
Sbjct: 57  LEKLLVEPSWVEVLQDEFKKPYMENLQTFVKQQAAGKVPVYPPAAKVFNAFNSCPFDRVK 116

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VV+LGQDPYH  GQA GL FSVP GIRIP SL+N+YKE+  DV    P HG LE W ++G
Sbjct: 117 VVLLGQDPYHGPGQAMGLSFSVPEGIRIPSSLLNMYKEIHSDVGCRVPLHGNLEKWAYQG 176

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV E +A SH  +GWE FTD+ I  IS     +VF+LWG  AQ+K  +++  
Sbjct: 177 VLLLNTVLTVREQQANSHAKKGWEPFTDAAIRAISKRKTGVVFLLWGNCAQEKIRLINPN 236

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            H VLKAAHPS LSA  GFFGCRHFSK N  L+      ++WQ+
Sbjct: 237 EHHVLKAAHPSGLSAHKGFFGCRHFSKTNELLESANILPIDWQV 280


>gi|301301273|ref|ZP_07207428.1| uracil-DNA glycosylase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851149|gb|EFK78878.1| uracil-DNA glycosylase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 232

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +L   F+  +   L  FL +E  K + I P   H + AF+ TPF+KVKVVILG
Sbjct: 6   IHNDWQEVLGPEFEKPYYTELHNFLKNE-YKMQYIHPDMYHIYEAFEWTPFSKVKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+YKEL  D+   P  HG+LE W  +GVL+LN
Sbjct: 65  QDPYHGPNQAHGLSFSVLPGVAIPPSLRNIYKELYSDLGIKPVNHGYLEKWAKQGVLMLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G+GWE+ TD  I  +S     +VF+LWGA+A+KK  ++D K+++++
Sbjct: 125 SVLTVRNGQAFSHQGKGWEKLTDEAIKKLSERPMPVVFILWGAAARKKAALIDRKKNIII 184

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSA+ GFFG R FSK N  L+  G+T ++WQ+P
Sbjct: 185 ESPHPSPLSANRGFFGSRPFSKTNAALEALGETPIDWQLP 224


>gi|283955427|ref|ZP_06372925.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 414]
 gi|283793054|gb|EFC31825.1| uracil-DNA glycosylase [Campylobacter jejuni subsp. jejuni 414]
          Length = 231

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ +KI++ WK  L++ FQ ++   +K+  L+   +   I+P  +  F AF++ P  +VK
Sbjct: 8   IDKIKINDDWKEFLKDEFQKKYFLEIKKQYLNAINQHITIYPPANLTFNAFNLCPLKEVK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           +VILGQDPYH   QA GL FSVP  ++IPPSL N++KELQ D+N  P   G L  W  +G
Sbjct: 68  IVILGQDPYHQPNQAMGLSFSVPKDVKIPPSLDNIFKELQNDLNITPAKSGDLSPWARQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  +AASH   GW++F+D+VI  +SN    +VFMLWG  A+ K+ ++D+ 
Sbjct: 128 VLLLNSILSVEANKAASHSSWGWQEFSDAVIHKLSNEKSGLVFMLWGNYAKSKEILIDNT 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKAAHPSPL A  GF GC+HFSKAN +L++  K  ++W I
Sbjct: 188 KHLILKAAHPSPL-ARTGFLGCKHFSKANNFLKKMDKFPIDWNI 230


>gi|296113085|ref|YP_003627023.1| uracil-DNA glycosylase [Moraxella catarrhalis RH4]
 gi|295920779|gb|ADG61130.1| uracil-DNA glycosylase [Moraxella catarrhalis RH4]
 gi|326560078|gb|EGE10468.1| uracil-DNA glycosylase [Moraxella catarrhalis 46P47B1]
 gi|326560461|gb|EGE10843.1| uracil-DNA glycosylase [Moraxella catarrhalis 7169]
 gi|326561664|gb|EGE12001.1| uracil-DNA glycosylase [Moraxella catarrhalis 103P14B1]
 gi|326564208|gb|EGE14444.1| uracil-DNA glycosylase [Moraxella catarrhalis 12P80B1]
 gi|326571143|gb|EGE21167.1| uracil-DNA glycosylase [Moraxella catarrhalis BC7]
 gi|326577133|gb|EGE27027.1| uracil-DNA glycosylase [Moraxella catarrhalis O35E]
          Length = 235

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 149/226 (65%), Gaps = 1/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E V++   WK  L     SE+M  L++FL  +  + K I+P  +  F AF +TP ++VK
Sbjct: 9   LERVQLPNDWKQALAPALISENMDKLRDFLKMQYHQQKNIYPPKNQIFNAFHLTPLSQVK 68

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP  I  PPSL N+ KEL  D+      HG L  W  +G
Sbjct: 69  VVILGQDPYHGIGQAMGLSFSVPKLIPKPPSLQNILKELSNDLGVPISRHGDLSFWAKQG 128

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTVE G A SH+ +GWE+FTD+VI+ I+N     VF+LWG+ A+ K   +D  
Sbjct: 129 VLLLNATLTVEAGLAGSHQKQGWEEFTDAVIEAINNYTDQTVFILWGSYAKHKGRFIDTS 188

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HLVL A+HPSPL+A+  GFFG R FS+ N YLQ HGKT +NW +P
Sbjct: 189 KHLVLTASHPSPLAANRGGFFGTRPFSRTNEYLQRHGKTPINWALP 234


>gi|260440547|ref|ZP_05794363.1| uracil-DNA glycosylase [Neisseria gonorrhoeae DGI2]
 gi|291043849|ref|ZP_06569565.1| uracil-DNA glycosylase [Neisseria gonorrhoeae DGI2]
 gi|291012312|gb|EFE04301.1| uracil-DNA glycosylase [Neisseria gonorrhoeae DGI2]
          Length = 219

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +   +  E+  G+ I+P  +  F AF +T F++VKVVILGQD
Sbjct: 2   DTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPEADVFNAFRLTAFDRVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  G+RIPPSL+N+YKEL+ D+  F  P HG L  W  +G+LLLN 
Sbjct: 62  PYHGVGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSIPAHGCLTAWAEQGILLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G+A SH   GWE+FTD+VI  ++ + +++VFMLWG  AQ+K  ++D + HL+L 
Sbjct: 122 VLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC HFS+AN YL +HG   +NW++
Sbjct: 182 APHPSPLSAYRGFFGCCHFSQANSYLSQHGIEPINWKL 219


>gi|198424133|ref|XP_002130552.1| PREDICTED: similar to uracil-DNA glycosylase [Ciona intestinalis]
          Length = 287

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 145/219 (66%), Gaps = 2/219 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           K+  SW+  L+      +   + +F+ SE+ K K ++P     F          +KVVIL
Sbjct: 67  KMGPSWRIALQAELTKPYYIKVTDFVKSERTKHK-VYPPEQQVFAWTQHCKIEDIKVVIL 125

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLL 123
           GQDPYH  GQAHGLCFSV  GIR PPSL N++KEL+ DV  F  P HG L  W  +GVLL
Sbjct: 126 GQDPYHGPGQAHGLCFSVQKGIRTPPSLKNMFKELESDVEGFNTPDHGDLTGWADQGVLL 185

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV +G   SH+ +GWE+ TDSVI  IS N   +VFMLWG+ A KK   +D +RHL
Sbjct: 186 LNAVLTVRDGEPNSHKDKGWEELTDSVISWISTNLNGVVFMLWGSYAHKKGAKIDQQRHL 245

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLKA HPSPLSA  G+FGC+HFSKAN+YL++ GK+ + W
Sbjct: 246 VLKAVHPSPLSAHRGYFGCKHFSKANKYLKKQGKSEIEW 284


>gi|254373412|ref|ZP_04988900.1| uracil DNA glycosylase [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|151571138|gb|EDN36792.1| uracil DNA glycosylase [Francisella novicida GA99-3549]
          Length = 220

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQQPYFKQILDFLACESAKGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  +HL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISQNKHNVVFMLWGSHARKKKVLIDSSKHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKSQKIDWNL 218


>gi|332184601|gb|AEE26855.1| Uracil-DNA glycosylase [Francisella cf. novicida 3523]
          Length = 220

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQKPYFKQILDFLACEISKGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFEIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  +HL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISENKHNVVFMLWGSHARKKKALIDSSKHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLVEKKDQKIDWSL 218


>gi|56421956|ref|YP_149274.1| uracil-DNA glycosylase [Geobacillus kaustophilus HTA426]
 gi|73920174|sp|Q5KUD0|UNG_GEOKA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|56381798|dbj|BAD77706.1| uracil-DNA glycosylase [Geobacillus kaustophilus HTA426]
          Length = 229

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  FQ  +   L+EFL  E R  + I+P     F A   TP+  VKVV+LG
Sbjct: 4   LKNDWAPLLEEEFQKPYYLKLREFLKEEYRT-RTIYPDMHDIFNALHYTPYANVKVVLLG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSL N++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPVPPSLANIFKELHDDLGCYIPDNGYLVKWAEQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWE FTD VI+L++     +VF+LWG +AQ+K++ + + RHL++
Sbjct: 123 TVLTVRRGQANSHRGKGWEYFTDRVIELVNEKDDPVVFLLWGRNAQEKKERITNPRHLII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+ N +L +HG+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRTNAFLTKHGREPIDWQI 221


>gi|254374875|ref|ZP_04990356.1| uracil-DNA glycosylase [Francisella novicida GA99-3548]
 gi|151572594|gb|EDN38248.1| uracil-DNA glycosylase [Francisella novicida GA99-3548]
          Length = 220

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQKPYFKQILDFLACESAKGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  +HL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISENKHNVVFMLWGSHARKKKVLIDSSKHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNL 218


>gi|238796724|ref|ZP_04640230.1| Uracil-DNA glycosylase [Yersinia mollaretii ATCC 43969]
 gi|238719455|gb|EEQ11265.1| Uracil-DNA glycosylase [Yersinia mollaretii ATCC 43969]
          Length = 230

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +  SW  ++    +  + ++   ++ +E+  GK I+P+    F AF +T  ++VKVVI
Sbjct: 3   MSVSLSWHDVIGQEKELPYFKDTLAYVAAERNAGKTIYPQQKDVFNAFRLTELDQVKVVI 62

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVL
Sbjct: 63  LGQDPYHGPNQAHGLSFSVLPGVPAPPSLVNMYKELATDIPGFQRPNHGFLQSWAEQGVL 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTVE G A SH   GWE FTD VI  ++ +   ++FMLWGA AQKK  ++D +RH
Sbjct: 123 LLNTVLTVEAGNAHSHANLGWETFTDKVIAALNEHRDGVIFMLWGAHAQKKGRIIDTQRH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            +LKA HPSPLSA  GF GC+HFS+AN+ LQ+ G   ++WQ
Sbjct: 183 FILKAPHPSPLSAHRGFLGCKHFSQANQLLQQQGLPPIDWQ 223


>gi|167627414|ref|YP_001677914.1| uracil-DNA glycosylase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189037439|sp|B0TXF5|UNG_FRAP2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|167597415|gb|ABZ87413.1| uracil-DNA glycosylase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 218

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + EFL +E   GK IFP  ++ F AF  T  + +KVVILGQDP
Sbjct: 2   NWSDILAEEKQKPYFKKILEFLANEALVGKTIFPTKANIFNAFKYTRLDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL+  +  F  P HG L +W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQQGVDIPPSLRNIYKELERSITEFKIPEHGCLINWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  ISNN  N+VFMLWG+ A+KK++++D  +HLVL++
Sbjct: 122 LTVEAHKANSHKDIGWEIFTDAVIQKISNNKPNVVFMLWGSHARKKKNLIDTAKHLVLES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HPSPLS   GF GC HF KAN+YL       ++W++
Sbjct: 182 SHPSPLSVYRGFDGCDHFVKANQYLTSKDLDIIDWRL 218


>gi|224534839|ref|ZP_03675408.1| uracil-DNA glycosylase [Borrelia spielmanii A14S]
 gi|224513779|gb|EEF84104.1| uracil-DNA glycosylase [Borrelia spielmanii A14S]
          Length = 223

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 151/221 (68%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +   P  +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSKIKIPPSLQNIFKEIEKSLKIKPIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKDIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKKLIDPTKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSSALEYLKKHNKNKINFQ 223


>gi|40062759|gb|AAR37653.1| uracil-DNA glycosylase [uncultured marine bacterium 439]
          Length = 222

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 107/216 (49%), Positives = 144/216 (66%), Gaps = 2/216 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W  LL    + ++ ++L  FL     + K I+P   ++++AF+ + F   KV+I+GQDPY
Sbjct: 8   WSELLATEREMDYFKSLYSFLYD--NQSKEIYPTKENWYKAFEYSSFTNTKVIIIGQDPY 65

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H+  QA GL FSVP GI IPPSL N+Y EL+ DV    P HG L HW  +GVLLLN+VLT
Sbjct: 66  HSINQAEGLSFSVPEGIPIPPSLRNIYIELESDVGTTIPHHGHLSHWAKQGVLLLNSVLT 125

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           V +   ASH  +GWE FTD+VI L++    N+VF+LWGA A KK +++D  +HL+L A H
Sbjct: 126 VAKNSPASHANQGWETFTDNVIKLLNEKKHNLVFLLWGAYAGKKAELIDSDKHLILSAPH 185

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           PSP SA  GFFGC+HFSK N YL+ + +  +NW IP
Sbjct: 186 PSPFSAHKGFFGCKHFSKTNHYLESNKQQPINWSIP 221


>gi|224024151|ref|ZP_03642517.1| hypothetical protein BACCOPRO_00873 [Bacteroides coprophilus DSM
           18228]
 gi|224017373|gb|EEF75385.1| hypothetical protein BACCOPRO_00873 [Bacteroides coprophilus DSM
           18228]
          Length = 220

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I E+WK +L   F+ ++   L +F+  E +    ++P G   F AF++ P+NKVKVVI
Sbjct: 3   VQIEETWKEVLAPEFEKDYFIRLTDFVRQEYQT-TTVYPPGKLIFNAFNLCPYNKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+ +D+    P  G L  W  +GVL+
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIHDDLGTPIPATGNLTRWAEQGVLM 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE+FTD+ I  ++   +++VF+LWG+ AQKK   +D  +HL
Sbjct: 122 LNATLTVRAHQAGSHQRKGWEEFTDAAIRALAEKRKHLVFILWGSYAQKKGAFIDRNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA +GFFG RHFS+AN YL +HG+T + W
Sbjct: 182 VLTSVHPSPLSAYNGFFGNRHFSRANEYLIQHGETPIVW 220


>gi|5822568|pdb|4EUG|A Chain A, Crystallographic And Enzymatic Studies Of An Active Site
           Variant H187q Of Escherichia Coli Uracil Dna
           Glycosylase: Crystal Structures Of Mutant H187q And Its
           Uracil Complex
 gi|5822576|pdb|5EUG|A Chain A, Crystallographic And Enzymatic Studies Of An Active Site
           Variant H187q Of Escherichia Coli Uracil Dna
           Glycosylase: Crystal Structures Of Mutant H187q And Its
           Uracil Complex
          Length = 229

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
             PSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PQPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220


>gi|146312706|ref|YP_001177780.1| uracil-DNA glycosylase [Enterobacter sp. 638]
 gi|167011639|sp|A4WDE9|UNG_ENT38 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|145319582|gb|ABP61729.1| Uracil-DNA glycosylase [Enterobacter sp. 638]
          Length = 229

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N    + +E++ G+ I+P     F AF  T  N VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFVNTLNTVAAERQSGQTIYPPQKDVFNAFRYTELNNVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F+ P HG+LE W H+GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELEGSLPGFVRPAHGYLESWAHQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWGA AQKK  ++D KRH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINEHREGVVFLLWGAHAQKKGAIIDPKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF   N +L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLTNEWLEKRGEKPIDW 220


>gi|54307763|ref|YP_128783.1| uracil-DNA glycosylase [Photobacterium profundum SS9]
 gi|46912186|emb|CAG18981.1| putative uracil-DNA-glycosylase [Photobacterium profundum SS9]
          Length = 227

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ ++    Q  + +++++F+ + +  GK IFP     F AF+ TP  +VKVVILGQDP
Sbjct: 6   TWQDIINQEKQQPYFQDIEQFVSTARSNGKVIFPPEQDVFNAFNSTPLAQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI+ PPSL N+YKEL  D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGANQAHGLSFSVLPGIKTPPSLANMYKELATDIPGFQIPLHGYLQSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+ +A SH   GWE FTD +ID++      IVF+LWGA AQKK   ++  +H VLK+
Sbjct: 126 LTVEQSKAHSHAKIGWETFTDKIIDVLDQQSAGIVFVLWGAHAQKKGKTINTDKHHVLKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           AHPSPLSA  GFFGC+HFS+ N+ L +  ++ ++WQ
Sbjct: 186 AHPSPLSAYRGFFGCKHFSQVNQLLCDMNQSPIDWQ 221


>gi|213962475|ref|ZP_03390737.1| uracil-DNA glycosylase [Capnocytophaga sputigena Capno]
 gi|213954801|gb|EEB66121.1| uracil-DNA glycosylase [Capnocytophaga sputigena Capno]
          Length = 221

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SWK++LE+ F   +   L E++  ++      +P+G   F AF+  P NKVKVVI
Sbjct: 3   VQIDSSWKAVLEDEFSKPYFNKLTEYV-KQQYAENICYPKGKQIFSAFNHCPLNKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  GI  PPSLVN+++E+ +D+    P  G LE W  +GVLL
Sbjct: 62  IGQDPYHGEGQANGLCFSVHDGIAHPPSLVNIFREITQDLGVPYPISGNLERWASQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV    A SH+ +GWE FTD+VI  +S +  N+VFMLWG+ A+KK  ++D  +H 
Sbjct: 122 LNATLTVRANEAGSHQNQGWETFTDAVIKAVSTHCNNVVFMLWGSYAKKKASLIDSSKHC 181

Query: 184 VLKAAHPSPLSASHG-FFGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G +FG +HFSKAN YL   GK T+NW
Sbjct: 182 ILTSGHPSPLSANRGHWFGNKHFSKANVYLTSVGKETINW 221


>gi|225076067|ref|ZP_03719266.1| hypothetical protein NEIFLAOT_01099 [Neisseria flavescens
           NRL30031/H210]
 gi|224952627|gb|EEG33836.1| hypothetical protein NEIFLAOT_01099 [Neisseria flavescens
           NRL30031/H210]
          Length = 219

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 142/218 (65%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   +    +  + + + E +  E++ G  ++P     F AF  T F  VKVVILGQD
Sbjct: 2   QTWHEAIGAEKEKAYFQTILEKVRHERQAGITVYPPERDVFNAFRTTEFGNVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV   I +PPSLVN+YKEL  D+  F  P HG+L+HW  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVQPEIAVPPSLVNIYKELATDIEGFQIPQHGYLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G A SH   GWE FTD VI  +    +++VFMLWG+ AQKK   +D  RHLVL 
Sbjct: 122 VLTVRAGLAHSHATFGWEAFTDEVIRQLDKEREHLVFMLWGSHAQKKGAFIDRSRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YLQ HG   ++WQ+
Sbjct: 182 APHPSPLSAYRGFFGCKHFSQANAYLQAHGLEPIDWQV 219


>gi|304386201|ref|ZP_07368534.1| uracil-DNA glycosylase [Pediococcus acidilactici DSM 20284]
 gi|304327558|gb|EFL94785.1| uracil-DNA glycosylase [Pediococcus acidilactici DSM 20284]
          Length = 230

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +LE+ F+ ++  NL +FL  E    + I P   H F+AF+ TPF++VKVVILG
Sbjct: 5   IHNDWQKVLESEFEKDYYANLHQFLKQE-YATQNIHPDMYHIFQAFEWTPFSEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ +PPSL N+YKELQ+D+   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGLSFSVRPGVPVPPSLQNIYKELQDDLGVKPVQHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G GWE+ TD+ I  +S   + ++F+LWG +A+ K  ++D  R++++
Sbjct: 124 SVLTVRNGQAFSHQGHGWERLTDTAIKRLSEREKPVIFILWGRAARDKIKLIDQSRNIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG + FSK N  L+  G+  ++WQ+P
Sbjct: 184 QSAHPSPLSAYRGFFGSKPFSKTNAALEAMGEKPIDWQLP 223


>gi|89255936|ref|YP_513298.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314420|ref|YP_763143.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156501928|ref|YP_001427993.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009157|ref|ZP_02274088.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254367293|ref|ZP_04983320.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           257]
 gi|290954616|ref|ZP_06559237.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295311959|ref|ZP_06802783.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122325553|sp|Q0BN28|UNG_FRATO RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|122501073|sp|Q2A4Q4|UNG_FRATH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166200311|sp|A7NAN4|UNG_FRATF RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|89143767|emb|CAJ78969.1| Uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129319|gb|ABI82506.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134253110|gb|EBA52204.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           257]
 gi|156252531|gb|ABU61037.1| uracil-DNA glycosylase [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 220

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQKPYFKQILDFLACESAKGKVIFPTKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV   + IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKWVDIPPSLQNIYKELARSIPKFKTPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI+ IS N  N+VFMLWG+ A+KK+ ++D  RHL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLWGSHARKKKVLIDSSRHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNL 218


>gi|330997797|ref|ZP_08321632.1| uracil-DNA glycosylase [Paraprevotella xylaniphila YIT 11841]
 gi|329569685|gb|EGG51450.1| uracil-DNA glycosylase [Paraprevotella xylaniphila YIT 11841]
          Length = 220

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SWK  L   F+  +   L  F+  E R     +P G   F AF++ P++K KVVI
Sbjct: 3   VQIEPSWKQHLAPEFEKPYFVKLTNFVRQEYRT-TTCYPPGKLIFNAFNLCPYDKAKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGLCFSV  G+  PPSL N++KE+ +D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGPGQAHGLCFSVNDGVPFPPSLQNIFKEIHDDLGVPVPPSGNLARWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE FTD+ I  ++   +++VF+LWGA AQKK   +D  RHL
Sbjct: 122 LNATLTVRAHQAGSHQRQGWEAFTDAAIKALAEGREHLVFILWGAYAQKKGAFIDRSRHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSPLSA HGFFG RHFS AN YL++HG+  +NW
Sbjct: 182 VLASAHPSPLSAYHGFFGNRHFSLANAYLEQHGEIPINW 220


>gi|325663522|ref|ZP_08151932.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325470421|gb|EGC73652.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 225

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I  +W   L+  F+  + + L E +  E R  ++IFP     F AF +TP N+VKVVILG
Sbjct: 4   ISGAWLEALKGEFKKPYYKKLFETVNQEYRT-RQIFPPADDVFNAFHLTPLNEVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P HG+L  W  +GVL+LN
Sbjct: 63  QDPYHNVGQAHGLCFSVKPEVDIPPSLVNIYQELHDDLGCEIPNHGYLVKWAKQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRVLNEQDRPIVFILWGRPAQTKKAMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N +L+ +G   V+WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSQTNAFLKANGVEPVDWQI 221


>gi|294670471|ref|ZP_06735351.1| hypothetical protein NEIELOOT_02188 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307750|gb|EFE48993.1| hypothetical protein NEIELOOT_02188 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 219

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + R++ + + +E+  G+ ++P  +  F AF  T F++VK VILGQD
Sbjct: 2   QTWTEALGKEKQQPYFRHIIDTVKAERESGQTVYPPAADVFNAFKATEFSQVKAVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV  GI IPPSL N+YKEL +D+  F  P HG L+HW  +GVLLLN 
Sbjct: 62  PYHGEGQAHGLAFSVRPGIDIPPSLQNIYKELADDIPGFRIPNHGCLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV   +A SH   GWE FTD+VI  ++   +++VF+LWG+ AQKK   +D  RHLVL 
Sbjct: 122 VLTVRARQAHSHAALGWETFTDTVIRRLAEQREHLVFILWGSHAQKKGAFIDRGRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFG + FS+ N YLQ+HG+T ++WQ+
Sbjct: 182 SPHPSPLSAYRGFFGSKPFSQTNAYLQKHGQTPIDWQV 219


>gi|255078432|ref|XP_002502796.1| predicted protein [Micromonas sp. RCC299]
 gi|226518062|gb|ACO64054.1| predicted protein [Micromonas sp. RCC299]
          Length = 241

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ + + E+W+  L+  F  E+  +LK+FL  E   G ++FP   + FRAF+  P  +VK
Sbjct: 16  LDDLLVEETWRGALDGEFGKEYWSSLKKFLAKEYGSGAKVFPAPGNIFRAFNTCPMERVK 75

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH+ GQA GL FSVP G ++P SL+N+YKEL  D+    PTHG L+ W  +G
Sbjct: 76  VVILGQDPYHDDGQAMGLSFSVPKGWKVPSSLINIYKELGTDLGCKKPTHGDLDKWSTQG 135

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VL+LNA LTV   +A SH  +GWE FTD+ I  ++   + +VF+LWG +AQ+K+ ++   
Sbjct: 136 VLMLNASLTVRAHQANSHSKKGWESFTDAAIRTLAKQRKGLVFLLWGKNAQEKERLIAKD 195

Query: 181 R-HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HL+LK+ HPS LSA  GF+GC+HFS+AN +++++G   ++WQI
Sbjct: 196 AGHLILKSPHPSGLSAHRGFYGCKHFSQANNFIEKNGGVPIDWQI 240


>gi|241758705|ref|ZP_04756818.1| uracil-DNA glycosylase [Neisseria flavescens SK114]
 gi|241320913|gb|EER57126.1| uracil-DNA glycosylase [Neisseria flavescens SK114]
          Length = 219

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 142/218 (65%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   +    +  + + + E +  E++ G  ++P     F AF  T F  VKVVILGQD
Sbjct: 2   QTWHEAIGAEKEKAYFQTILEKVRHERQAGITVYPPERDVFNAFRTTEFGNVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV   I +PPSLVN+YKEL  D+  F  P HG+L+HW  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVQPEIAVPPSLVNIYKELATDIEGFQIPQHGYLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G A SH   GWE FTD VI  +    +++VFMLWG+ AQKK   +D  RHLVL 
Sbjct: 122 VLTVRAGLAHSHATFGWEAFTDEVIRQLDKEREHLVFMLWGSHAQKKGAFIDRNRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YLQ HG   ++WQ+
Sbjct: 182 APHPSPLSAYRGFFGCKHFSQANAYLQAHGLEPIDWQV 219


>gi|167838037|ref|ZP_02464896.1| uracil-DNA glycosylase [Burkholderia thailandensis MSMB43]
          Length = 262

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  + PP HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYEPPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERSSAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDPREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|313624049|gb|EFR94133.1| uracil-DNA glycosylase [Listeria innocua FSL J1-023]
          Length = 224

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 151/222 (68%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL +E +  KR+FP     F A   T +  VKVVI
Sbjct: 2   IKLENDWDELLKDEFNQPYYLKLRQFLKNEYQT-KRVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQKGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   +++VF+LWG +A++K  +L + +H+
Sbjct: 121 LNTVLTVRAGQANSHRGQGWELLTNRIIEMINQKEESVVFLLWGNNAKEKLQLLTNPKHI 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GCRHFSK N +L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCRHFSKTNHFLEQNGIKPIDWQIP 222


>gi|240948611|ref|ZP_04752984.1| uracil-DNA glycosylase [Actinobacillus minor NM305]
 gi|240297119|gb|EER47690.1| uracil-DNA glycosylase [Actinobacillus minor NM305]
          Length = 223

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++WK  L    Q  + +++ + +  E+  GK ++P  +  F AF +T F  VKVVILGQD
Sbjct: 2   KTWKEALGEEKQQPYFQHILQQVHHERMSGKIVYPPQNEVFSAFSLTEFCDVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   +  PPSLVN+YKEL +D+  F  P HG+L  W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELSQDIEGFQIPQHGYLVDWAKQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV++G A SH   GWE FTD VI  ++ + +NIVF+LWG+ AQKK   +D  RH VL 
Sbjct: 122 VLTVQQGMAHSHAKLGWETFTDKVIAQLNEHRENIVFLLWGSHAQKKGQFIDRSRHCVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           A HPSPLSA  GFFGC+HFSKAN YL+E G   ++WQ+PL+
Sbjct: 182 APHPSPLSAHRGFFGCKHFSKANTYLREKGIPEIHWQLPLN 222


>gi|5542225|pdb|1EUI|A Chain A, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|5542226|pdb|1EUI|B Chain B, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
          Length = 228

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 5   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 65  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 125 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 185 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 219


>gi|260828019|ref|XP_002608961.1| hypothetical protein BRAFLDRAFT_287104 [Branchiostoma floridae]
 gi|229294315|gb|EEN64971.1| hypothetical protein BRAFLDRAFT_287104 [Branchiostoma floridae]
          Length = 303

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 144/220 (65%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
            ++ E+W+  L+  F   +   L  F+ SE R  + ++P  +  F    +    +VKVVI
Sbjct: 81  AEMGETWRRALDQQFSKPYWLKLMSFVQSE-RASRTVYPPANQVFTWTQMCTIQEVKVVI 139

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH  GQAHGLCFSV   +  PPSLVN+YKELQ+DV  F  P HG L  W  +GVL
Sbjct: 140 LGQDPYHGPGQAHGLCFSVQRPVPPPPSLVNMYKELQKDVEGFEIPKHGDLTGWAKQGVL 199

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNAVLTV +  A SH+G+GWE+FTD+VI  ++ N   IVFMLWG+ AQKK   ++ K+H
Sbjct: 200 LLNAVLTVRKQEANSHKGKGWEEFTDAVITWLNKNGDGIVFMLWGSYAQKKGSCINKKKH 259

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            VLKA HPSPLSA  GF GC HFSK N  L   GKT +NW
Sbjct: 260 HVLKAPHPSPLSAHRGFLGCGHFSKTNELLTSAGKTPINW 299


>gi|118498057|ref|YP_899107.1| uracil-DNA glycosylase [Francisella tularensis subsp. novicida
           U112]
 gi|194323282|ref|ZP_03057066.1| uracil-DNA glycosylase [Francisella tularensis subsp. novicida FTE]
 gi|166200398|sp|A0Q7Y8|UNG_FRATN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|118423963|gb|ABK90353.1| uracil DNA glycosylase [Francisella novicida U112]
 gi|194322646|gb|EDX20126.1| uracil-DNA glycosylase [Francisella tularensis subsp. novicida FTE]
          Length = 220

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 139/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E   GK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQQPYFKQILDFLACESANGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  RHL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISENKHNVVFMLWGSHARKKKVLIDSSRHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKSQKIDWNL 218


>gi|293401616|ref|ZP_06645758.1| uracil-DNA glycosylase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304874|gb|EFE46121.1| uracil-DNA glycosylase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 222

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I   W  +L++ F  E+ +N+++FL+ E      ++P     F A   TP++ VKVVI
Sbjct: 2   VQIGNDWDEILKDEFAKEYYQNIRKFLVYEYNH-HPVYPSMYDIFNALKYTPYHCVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL N+++EL+ DV    PTHG L  W  +GVLL
Sbjct: 61  LGQDPYHGKGQAHGLCFSVKKGVTPPPSLQNIFQELKNDVGCNIPTHGELTKWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SH   GWEQ TD++I  ++   + IVF+LWG +A+ K  ++ +  HL
Sbjct: 121 LNTVLTVRGGQANSHANHGWEQLTDAIIQKLNEREEPIVFLLWGRNAKNKMALITNPAHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L  AHPSP SA +GFFGCRHFSK N +L++H +T ++WQI
Sbjct: 181 ILSCAHPSPFSADYGFFGCRHFSKTNDFLKQHRQTPIDWQI 221


>gi|320182095|gb|EFW56999.1| Uracil-DNA glycosylase, family 1 [Shigella boydii ATCC 9905]
          Length = 229

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  FI P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFIRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|326790788|ref|YP_004308609.1| uracil-DNA glycosylase [Clostridium lentocellum DSM 5427]
 gi|326541552|gb|ADZ83411.1| uracil-DNA glycosylase [Clostridium lentocellum DSM 5427]
          Length = 224

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 146/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V  + SW   L++ F+  + + L EFL  E  K + I+P     F A   T ++ VKVVI
Sbjct: 2   VTFNNSWDEQLKDEFEKPYYKALHEFLKDE-YKTQTIYPNMYDIFNALKTTSYDDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHG+ FSV  G+++PPSLVN+YKELQ  +    P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGEGQAHGMAFSVKPGVKVPPSLVNIYKELQATLGCYIPNNGYLMKWAEQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+  SH+G+GWE FTD +I L++     ++F+LWGA A+KK +++    H 
Sbjct: 121 LNTVLTVRAGKPQSHKGKGWEVFTDRIISLLNERKDPVIFILWGAPAKKKAELITAPWHK 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L AAHPSPLSA +GFFGC HF K N YL   GKT +++QI
Sbjct: 181 ILTAAHPSPLSAYNGFFGCNHFQKVNEYLIAMGKTPIDFQI 221


>gi|16130505|ref|NP_417075.1| uracil-DNA-glycosylase [Escherichia coli str. K-12 substr. MG1655]
 gi|74313143|ref|YP_311562.1| uracil-DNA glycosylase [Shigella sonnei Ss046]
 gi|82545035|ref|YP_408982.1| uracil-DNA glycosylase [Shigella boydii Sb227]
 gi|89109386|ref|AP_003166.1| uracil-DNA-glycosylase [Escherichia coli str. K-12 substr. W3110]
 gi|157162061|ref|YP_001459379.1| uracil-DNA glycosylase [Escherichia coli HS]
 gi|170019137|ref|YP_001724091.1| uracil-DNA glycosylase [Escherichia coli ATCC 8739]
 gi|170082189|ref|YP_001731509.1| uracil-DNA-glycosylase [Escherichia coli str. K-12 substr. DH10B]
 gi|187733936|ref|YP_001881369.1| uracil-DNA glycosylase [Shigella boydii CDC 3083-94]
 gi|188495118|ref|ZP_03002388.1| uracil-DNA glycosylase [Escherichia coli 53638]
 gi|193064073|ref|ZP_03045158.1| uracil-DNA glycosylase [Escherichia coli E22]
 gi|194429267|ref|ZP_03061794.1| uracil-DNA glycosylase [Escherichia coli B171]
 gi|209920060|ref|YP_002294144.1| uracil-DNA glycosylase [Escherichia coli SE11]
 gi|218555163|ref|YP_002388076.1| uracil-DNA glycosylase [Escherichia coli IAI1]
 gi|218696208|ref|YP_002403875.1| uracil-DNA glycosylase [Escherichia coli 55989]
 gi|238901745|ref|YP_002927541.1| uracil-DNA-glycosylase [Escherichia coli BW2952]
 gi|256017270|ref|ZP_05431135.1| uracil-DNA glycosylase [Shigella sp. D9]
 gi|256021733|ref|ZP_05435598.1| uracil-DNA glycosylase [Escherichia sp. 4_1_40B]
 gi|260845266|ref|YP_003223044.1| uracil-DNA-glycosylase [Escherichia coli O103:H2 str. 12009]
 gi|260856674|ref|YP_003230565.1| uracil-DNA-glycosylase [Escherichia coli O26:H11 str. 11368]
 gi|260869266|ref|YP_003235668.1| uracil-DNA-glycosylase [Escherichia coli O111:H- str. 11128]
 gi|293446935|ref|ZP_06663357.1| uracil-DNA glycosylase [Escherichia coli B088]
 gi|300817643|ref|ZP_07097858.1| uracil-DNA glycosylase [Escherichia coli MS 107-1]
 gi|300904236|ref|ZP_07122095.1| uracil-DNA glycosylase [Escherichia coli MS 84-1]
 gi|300951700|ref|ZP_07165520.1| uracil-DNA glycosylase [Escherichia coli MS 116-1]
 gi|300958778|ref|ZP_07170891.1| uracil-DNA glycosylase [Escherichia coli MS 175-1]
 gi|301021933|ref|ZP_07185892.1| uracil-DNA glycosylase [Escherichia coli MS 196-1]
 gi|301302947|ref|ZP_07209075.1| uracil-DNA glycosylase [Escherichia coli MS 124-1]
 gi|301648345|ref|ZP_07248085.1| uracil-DNA glycosylase [Escherichia coli MS 146-1]
 gi|307139218|ref|ZP_07498574.1| uracil-DNA glycosylase [Escherichia coli H736]
 gi|312973174|ref|ZP_07787346.1| uracil-DNA glycosylase [Escherichia coli 1827-70]
 gi|331643204|ref|ZP_08344339.1| uracil-DNA glycosylase [Escherichia coli H736]
 gi|332278262|ref|ZP_08390675.1| uracil-DNA-glycosylase [Shigella sp. D9]
 gi|137035|sp|P12295|UNG_ECOLI RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|123558961|sp|Q31XQ4|UNG_SHIBS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|123616455|sp|Q3YYT5|UNG_SHISS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|167011638|sp|A8A392|UNG_ECOHS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|189037437|sp|B1IVP7|UNG_ECOLC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725941|sp|B7M8J5|UNG_ECO8A RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|229557925|sp|B1XBQ7|UNG_ECODH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238058169|sp|B6I5F5|UNG_ECOSE RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238691731|sp|B2TYK1|UNG_SHIB3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|254790578|sp|B7LDH3|UNG_ECO55 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|259563556|sp|C4ZYK3|UNG_ECOBW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|4699665|pdb|1UUG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex
           With Wild-Type Udg And Wild-Type Ugi
 gi|4699667|pdb|1UUG|C Chain C, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex
           With Wild-Type Udg And Wild-Type Ugi
 gi|27065412|pdb|1LQG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065413|pdb|1LQG|B Chain B, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065418|pdb|1LQJ|A Chain A, Escherichia Coli Uracil-Dna Glycosylase
 gi|27065419|pdb|1LQJ|B Chain B, Escherichia Coli Uracil-Dna Glycosylase
 gi|27065420|pdb|1LQJ|C Chain C, Escherichia Coli Uracil-Dna Glycosylase
 gi|27065421|pdb|1LQJ|D Chain D, Escherichia Coli Uracil-Dna Glycosylase
 gi|27065424|pdb|1LQM|A Chain A, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065426|pdb|1LQM|C Chain C, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065428|pdb|1LQM|E Chain E, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065430|pdb|1LQM|G Chain G, Escherichia Coli Uracil-Dna Glycosylase Complex With
           Uracil- Dna Glycosylase Inhibitor Protein
 gi|148149|gb|AAA24743.1| uracil DNA glycosylase [Escherichia coli]
 gi|285778|dbj|BAA02448.1| uracil DNA glycosylase [Escherichia coli]
 gi|987651|dbj|BAA10923.1| uracil DNA glycosylase [Escherichia coli K-12]
 gi|1788934|gb|AAC75633.1| uracil-DNA-glycosylase [Escherichia coli str. K-12 substr. MG1655]
 gi|1799984|dbj|BAA16466.1| uracil-DNA-glycosylase [Escherichia coli str. K12 substr. W3110]
 gi|73856620|gb|AAZ89327.1| uracil-DNA-glycosylase [Shigella sonnei Ss046]
 gi|81246446|gb|ABB67154.1| uracil-DNA-glycosylase [Shigella boydii Sb227]
 gi|157067741|gb|ABV06996.1| uracil-DNA glycosylase [Escherichia coli HS]
 gi|169754065|gb|ACA76764.1| uracil-DNA glycosylase [Escherichia coli ATCC 8739]
 gi|169890024|gb|ACB03731.1| uracil-DNA-glycosylase [Escherichia coli str. K-12 substr. DH10B]
 gi|187430928|gb|ACD10202.1| uracil-DNA glycosylase [Shigella boydii CDC 3083-94]
 gi|188490317|gb|EDU65420.1| uracil-DNA glycosylase [Escherichia coli 53638]
 gi|192929308|gb|EDV82917.1| uracil-DNA glycosylase [Escherichia coli E22]
 gi|194412675|gb|EDX28970.1| uracil-DNA glycosylase [Escherichia coli B171]
 gi|209913319|dbj|BAG78393.1| uracil-DNA-glycosylase [Escherichia coli SE11]
 gi|218352940|emb|CAU98739.1| uracil-DNA-glycosylase [Escherichia coli 55989]
 gi|218361931|emb|CAQ99532.1| uracil-DNA-glycosylase [Escherichia coli IAI1]
 gi|238863767|gb|ACR65765.1| uracil-DNA-glycosylase [Escherichia coli BW2952]
 gi|257755323|dbj|BAI26825.1| uracil-DNA-glycosylase [Escherichia coli O26:H11 str. 11368]
 gi|257760413|dbj|BAI31910.1| uracil-DNA-glycosylase [Escherichia coli O103:H2 str. 12009]
 gi|257765622|dbj|BAI37117.1| uracil-DNA-glycosylase [Escherichia coli O111:H- str. 11128]
 gi|260448340|gb|ACX38762.1| uracil-DNA glycosylase [Escherichia coli DH1]
 gi|291323765|gb|EFE63193.1| uracil-DNA glycosylase [Escherichia coli B088]
 gi|299881400|gb|EFI89611.1| uracil-DNA glycosylase [Escherichia coli MS 196-1]
 gi|300314586|gb|EFJ64370.1| uracil-DNA glycosylase [Escherichia coli MS 175-1]
 gi|300403769|gb|EFJ87307.1| uracil-DNA glycosylase [Escherichia coli MS 84-1]
 gi|300449062|gb|EFK12682.1| uracil-DNA glycosylase [Escherichia coli MS 116-1]
 gi|300529631|gb|EFK50693.1| uracil-DNA glycosylase [Escherichia coli MS 107-1]
 gi|300841882|gb|EFK69642.1| uracil-DNA glycosylase [Escherichia coli MS 124-1]
 gi|301073621|gb|EFK88427.1| uracil-DNA glycosylase [Escherichia coli MS 146-1]
 gi|309702966|emb|CBJ02297.1| uracil-DNA glycosylase [Escherichia coli ETEC H10407]
 gi|310331769|gb|EFP99004.1| uracil-DNA glycosylase [Escherichia coli 1827-70]
 gi|315137204|dbj|BAJ44363.1| uracil-DNA glycosylase [Escherichia coli DH1]
 gi|315256608|gb|EFU36576.1| uracil-DNA glycosylase [Escherichia coli MS 85-1]
 gi|315615842|gb|EFU96474.1| uracil-DNA glycosylase [Escherichia coli 3431]
 gi|320186383|gb|EFW61117.1| Uracil-DNA glycosylase, family 1 [Shigella flexneri CDC 796-83]
 gi|323156240|gb|EFZ42399.1| uracil-DNA glycosylase [Escherichia coli EPECa14]
 gi|323159153|gb|EFZ45144.1| uracil-DNA glycosylase [Escherichia coli E128010]
 gi|323173101|gb|EFZ58732.1| uracil-DNA glycosylase [Escherichia coli LT-68]
 gi|323177289|gb|EFZ62877.1| uracil-DNA glycosylase [Escherichia coli 1180]
 gi|323936320|gb|EGB32611.1| uracil-DNA glycosylase [Escherichia coli E1520]
 gi|324020039|gb|EGB89258.1| uracil-DNA glycosylase [Escherichia coli MS 117-3]
 gi|331040002|gb|EGI12222.1| uracil-DNA glycosylase [Escherichia coli H736]
 gi|332092578|gb|EGI97650.1| uracil-DNA glycosylase [Shigella boydii 3594-74]
 gi|332100614|gb|EGJ03960.1| uracil-DNA-glycosylase [Shigella sp. D9]
 gi|333000440|gb|EGK20022.1| uracil-DNA glycosylase [Shigella flexneri VA-6]
 gi|333001673|gb|EGK21240.1| uracil-DNA glycosylase [Shigella flexneri K-272]
 gi|333015949|gb|EGK35284.1| uracil-DNA glycosylase [Shigella flexneri K-227]
          Length = 229

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|238759667|ref|ZP_04620827.1| Uracil-DNA glycosylase [Yersinia aldovae ATCC 35236]
 gi|238702095|gb|EEP94652.1| Uracil-DNA glycosylase [Yersinia aldovae ATCC 35236]
          Length = 228

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + ++   F+ +E+  GK I+P     F AF +T  ++VKVVILGQDP
Sbjct: 6   NWHDVIGLEKEQPYFKDTLAFVTAERSVGKIIYPPQKDVFNAFRLTELDQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVLPGVPAPPSLVNMYKELTTDIPGFQRPNHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++ +   ++FMLWGA AQKK  +++ +RH +LKA
Sbjct: 126 LTVEAGKAHSHANLGWETFTDKVIAALNEHRDGVIFMLWGAHAQKKGRIINTQRHFILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+AN+ LQ+HG+  ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLQQHGQQPIDWQ 221


>gi|270290677|ref|ZP_06196901.1| uracil-DNA glycosylase [Pediococcus acidilactici 7_4]
 gi|270280737|gb|EFA26571.1| uracil-DNA glycosylase [Pediococcus acidilactici 7_4]
          Length = 230

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+ +LE+ F+ ++  NL +FL  E    + I P   H F+AF+ TPF++VKVVILG
Sbjct: 5   IHNDWQKVLESEFEKDYYANLHQFLKQE-YATQNIHPDMYHIFQAFEWTPFSEVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ +PPSL N+YKELQ+D+   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGLSFSVRPGVPVPPSLQNIYKELQDDLGVKPVQHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G GWE+ TD+ I  +S   + ++F+LWG +A+ K  ++D  R++++
Sbjct: 124 SVLTVRNGQAFSHQGHGWERLTDTAIKRLSGREKPVIFILWGRAARDKIKLIDQSRNIII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA  GFFG + FSK N  L+  G+  ++WQ+P
Sbjct: 184 QSAHPSPLSAYRGFFGSKPFSKTNAALEAMGEKPIDWQLP 223


>gi|212212576|ref|YP_002303512.1| uracil-DNA glycosylase [Coxiella burnetii CbuG_Q212]
 gi|238058164|sp|B6J089|UNG_COXB2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|212010986|gb|ACJ18367.1| uracil-DNA glycosylase [Coxiella burnetii CbuG_Q212]
          Length = 229

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 148/217 (68%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W+++L    Q  + + + +F+  E++ GK I+P     F A  +TP+  VKVVILGQD
Sbjct: 8   QTWQTVLGEEKQEPYFQEILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAVKVVILGQD 67

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGL FSV  G+  PPSL N++KEL  D+    P+HGFLE W  +GVLLLNA 
Sbjct: 68  PYHGPNQAHGLAFSVRPGVPAPPSLQNIFKELHADLGVSIPSHGFLEKWAKQGVLLLNAA 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+  SH    W +FTD VI+ ++++ + IVF+LWG+ AQKK  ++ + RH +LKA
Sbjct: 128 LTVEAGKPQSHANIEWHRFTDKVIESLNDHPEGIVFLLWGSYAQKKSQLITNLRHRILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA+ GF GCRHFSKAN+ L E G+  ++W +
Sbjct: 188 PHPSPLSAARGFLGCRHFSKANQLLHEMGRGEIDWAL 224


>gi|332678779|gb|AEE87908.1| Uracil-DNA glycosylase [Francisella cf. novicida Fx1]
          Length = 220

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 140/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + +FL  E  KGK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   TWSDILAEEKQQPYFKQILDFLACESAKGKVIFPAKENIFNAFKYTELDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P HG+L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKIPNHGYLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS N  N+VFMLWG+ A+KK+ ++D  +HL+L++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVISKISENKHNVVFMLWGSHARKKKVLIDSLKHLILES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF   N+YL E     ++W +
Sbjct: 182 THPSPLSAHRGFLGCNHFVDCNKYLIEKKSQKIDWNL 218


>gi|284922532|emb|CBG35619.1| uracil-DNA glycosylase [Escherichia coli 042]
          Length = 229

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF +AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVQANQWLEQRGETPIDW 220


>gi|224531935|ref|ZP_03672567.1| uracil-DNA glycosylase [Borrelia valaisiana VS116]
 gi|224511400|gb|EEF81806.1| uracil-DNA glycosylase [Borrelia valaisiana VS116]
          Length = 223

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L  F+  E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKKVLNNEFNKEYFKKLVRFIKHEYKTKKGKIFPPPKLIFNAFDSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +N     +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSKIKIPPSLQNIFKEIEKSLNIKTIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D   H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNFARSKKKLIDPSNH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K+ +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSAALHYLKKHNKSKINFQ 223


>gi|331087047|ref|ZP_08336121.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330409327|gb|EGG88774.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 225

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I  +W   L+  F+  + + L E +  E R  ++IFP     F AF +TP N+VKVVILG
Sbjct: 4   ISGAWLEALKGEFKKPYYKKLFETVNQEYRT-RQIFPPADDVFNAFHLTPLNEVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P HG+L  W  +GVL+LN
Sbjct: 63  QDPYHNVGQAHGLCFSVKPEVDIPPSLVNIYQELHDDLGCEIPNHGYLVKWAKQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRVLNEQDRPIVFILWGRPAQTKKAMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N +L  +G   V+WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSQTNAFLMANGVEPVDWQI 221


>gi|289422338|ref|ZP_06424188.1| uracil-DNA glycosylase [Peptostreptococcus anaerobius 653-L]
 gi|289157283|gb|EFD05898.1| uracil-DNA glycosylase [Peptostreptococcus anaerobius 653-L]
          Length = 224

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 148/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +  +  W  +LE+ F+ ++   L+EFL  E    + IFP     F AF  T +  VKV+I
Sbjct: 2   ITFNNEWDRILEDEFKKDYYLKLREFLKKEYYT-QTIFPDMYDIFNAFKYTDYKDVKVLI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH+ GQAHGL FSV  GI+ PPSL+N+YKEL+E++    P +G+L+ W  +G++L
Sbjct: 61  LGQDPYHDDGQAHGLAFSVQPGIKTPPSLLNMYKELKEEMGLYIPNNGYLKSWADQGIML 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV   +A SHR  GWE FTD+VI  +++    I+F+LWGA+A++K+D +D  RH 
Sbjct: 121 LNTALTVRAHQANSHRNMGWEIFTDNVIKYLNDRQDPIIFVLWGANARRKKDFIDQTRHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           VL+A HPSPLSA  GFFGC HF K N  L+  GK  ++WQI
Sbjct: 181 VLEAPHPSPLSAHRGFFGCGHFLKINEILENLGKDKIDWQI 221


>gi|225570798|ref|ZP_03779821.1| hypothetical protein CLOHYLEM_06901 [Clostridium hylemonae DSM
           15053]
 gi|225160260|gb|EEG72879.1| hypothetical protein CLOHYLEM_06901 [Clostridium hylemonae DSM
           15053]
          Length = 222

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L   F+  + + L +  ++E+ K + IFP     F AF +TP   VKVVILG
Sbjct: 4   INNDWLEALRGEFKKPYYKELFQ-KVNEEYKTRLIFPPADDVFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGLCFSV  G+ +PPSLVN+Y+EL +D+    P HG L  W  +GVLLLN
Sbjct: 63  QDPYHNNGQAHGLCFSVKKGVEVPPSLVNIYQELHDDLGCTIPNHGCLTKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + IVF+LWG  AQ+K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIAALNAQDRPIVFILWGGPAQRKKAMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           ++ HPSPL+A  GFFG R FS+ N +L+E+G   ++WQI
Sbjct: 183 ESPHPSPLAAYRGFFGSRPFSRTNEFLKENGLEPIDWQI 221


>gi|183220228|ref|YP_001838224.1| uracil-DNA glycosylase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189910346|ref|YP_001961901.1| uracil DNA glycosylase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167775022|gb|ABZ93323.1| Uracil DNA glycosylase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167778650|gb|ABZ96948.1| Uracil-DNA glycosylase (UDG) [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 218

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           ++I  SWK +L++ F+  +   L+E++  E+ K   ++P     F AFD+ PF+ VKVVI
Sbjct: 1   MQIESSWKEVLKDEFKKPYFTELREWV-RERYKSTIVYPPAKQIFNAFDLCPFDNVKVVI 59

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+  PPSL N++KE+Q+D+    P  G L +   +GV L
Sbjct: 60  LGQDPYHGPGQAHGLCFSVLEGVPFPPSLQNIFKEIQDDLKKPIPKSGNLSYLAKQGVFL 119

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTVE+ +A SH+ +GWE FTD+VI  ++    N+VF+LWG+ A KK+ ++   +HL
Sbjct: 120 LNATLTVEKDKAGSHQNKGWEIFTDAVISTLAEKKSNLVFLLWGSFAGKKEILIPPNKHL 179

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK+AHPSPLSA  GF G +HFSK N YL   GK +++W
Sbjct: 180 VLKSAHPSPLSAYRGFLGNKHFSKTNEYLISAGKQSIDW 218


>gi|34762972|ref|ZP_00143950.1| Uracil-DNA glycosylase [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27887360|gb|EAA24452.1| Uracil-DNA glycosylase [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 226

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE  L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFEKEYFVKLKE-TLEEEYKNYTVYPPKRDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N +LTV + +A SH G GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTILTVRDSQANSHSGLGWQTFTDNVIKSLNEREKPIIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANRGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|30063981|ref|NP_838152.1| uracil-DNA glycosylase [Shigella flexneri 2a str. 2457T]
 gi|110806524|ref|YP_690044.1| uracil-DNA glycosylase [Shigella flexneri 5 str. 8401]
 gi|123146807|sp|Q0T1S6|UNG_SHIF8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|30042237|gb|AAP17962.1| uracil-DNA-glycosylase [Shigella flexneri 2a str. 2457T]
 gi|110616072|gb|ABF04739.1| uracil-DNA-glycosylase [Shigella flexneri 5 str. 8401]
 gi|281601992|gb|ADA74976.1| Uracil-DNA glycosylase [Shigella flexneri 2002017]
 gi|313648259|gb|EFS12703.1| uracil-DNA glycosylase [Shigella flexneri 2a str. 2457T]
 gi|332753990|gb|EGJ84364.1| uracil-DNA glycosylase [Shigella flexneri 4343-70]
 gi|332755805|gb|EGJ86163.1| uracil-DNA glycosylase [Shigella flexneri 2747-71]
 gi|332761974|gb|EGJ92247.1| uracil-DNA glycosylase [Shigella flexneri K-671]
 gi|332766582|gb|EGJ96787.1| uracil-DNA glycosylase [Shigella flexneri 2930-71]
 gi|333000835|gb|EGK20407.1| uracil-DNA glycosylase [Shigella flexneri K-218]
 gi|333016799|gb|EGK36125.1| uracil-DNA glycosylase [Shigella flexneri K-304]
          Length = 229

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|254385904|ref|ZP_05001222.1| uracil-DNA glycosylase 2 [Streptomyces sp. Mg1]
 gi|194344767|gb|EDX25733.1| uracil-DNA glycosylase 2 [Streptomyces sp. Mg1]
          Length = 225

 Score =  230 bits (587), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW  +L    +  + + L EF+  E+  G  ++P     F A D TPF+KVKV++LG
Sbjct: 5   LPESWLPVLGGELEQPYFKELTEFVEKERANGP-VYPPREQVFAALDATPFDKVKVLVLG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  GI+ PPSL N+YKE++E++    P +G+L  W  +GVLLLN
Sbjct: 64  QDPYHGAGQGHGLCFSVRPGIKTPPSLRNIYKEMKEELGLPVPDNGYLMPWAEQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV E    SH+G+GWE+FTD+VI  +S     +VF+LWGA AQKK  ++D +RH+++
Sbjct: 124 AVLTVREAEPNSHKGKGWEKFTDAVIRAVSERPDPVVFVLWGAYAQKKIPLIDEERHVIV 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 184 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHEPIDWRIP 222


>gi|241667986|ref|ZP_04755564.1| uracil-DNA glycosylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876520|ref|ZP_05249230.1| uracil-DNA glycosylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842541|gb|EET20955.1| uracil-DNA glycosylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 218

 Score =  230 bits (587), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 144/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  + + + EFL +E   GK IFP   + F AF  T  + +KVVILGQDP
Sbjct: 2   NWSDILAEEKQKPYFKKILEFLANEALVGKTIFPTKENIFNAFKYTRLDNLKVVILGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YHNY QAHGL FSV  G+ IPPSL N+YKEL   +  F  P+HG L  W  +GV LLN  
Sbjct: 62  YHNYNQAHGLAFSVQQGVDIPPSLRNIYKELARSILGFEIPSHGCLVDWAKQGVFLLNTT 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH+  GWE FTD+VI  IS+N  N+VFMLWG+ A+KK++++D  +HLVL++
Sbjct: 122 LTVEAHKANSHKDIGWETFTDTVIQKISDNKTNVVFMLWGSHARKKKNLIDTAKHLVLES 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HPSPLS   GF GC HF KAN+YL       ++W++
Sbjct: 182 SHPSPLSVYRGFEGCDHFVKANQYLTSKDLDIIDWRL 218


>gi|295707268|ref|YP_003600343.1| uracil-DNA glycosylase [Bacillus megaterium DSM 319]
 gi|294804927|gb|ADF41993.1| uracil-DNA glycosylase [Bacillus megaterium DSM 319]
          Length = 224

 Score =  230 bits (587), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 148/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W  LLE  FQ ++   L+EFL+ E      I+P     F A   T +  VKVVILGQDP
Sbjct: 7   DWAPLLEEEFQKDYYIQLREFLVDEYNH-HTIYPDKYDIFNALHYTDYKNVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH   QAHGL FSV  G++ PPSLVN+YKEL+ ++++  P +G+L  W  +GVLLLN VL
Sbjct: 66  YHGPNQAHGLSFSVQPGVKTPPSLVNIYKELKNEMDYHIPNNGYLVKWAEQGVLLLNTVL 125

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV +G A SH+G+GWEQ TD +I+L++   + +VF+LWG  AQ K++++ H  HL+L++ 
Sbjct: 126 TVRKGEANSHKGKGWEQLTDRIIELVAQKEEPVVFLLWGKHAQAKKELIHHSHHLILESP 185

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSP SA+ GFFG  HF +AN +L +HG+ +++WQI
Sbjct: 186 HPSPFSANRGFFGNNHFQRANEFLLQHGRQSIDWQI 221


>gi|127514001|ref|YP_001095198.1| uracil-DNA glycosylase [Shewanella loihica PV-4]
 gi|126639296|gb|ABO24939.1| Uracil-DNA glycosylase [Shewanella loihica PV-4]
          Length = 222

 Score =  230 bits (587), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+  ++   +  +   L+ F+  E+  GK I+P     F AF++TP +KV+VV++GQDPY
Sbjct: 7   WQDFIDQEAKQAYFGQLQAFVQGERDAGKAIYPEKDQVFSAFELTPLDKVRVVLIGQDPY 66

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVL 128
           H  GQAHGLCFSV  G+++PPSLVN+YKEL  D++ F  P HG+L  W  +GVL+LN VL
Sbjct: 67  HGEGQAHGLCFSVQPGVKVPPSLVNMYKELASDIDGFEIPDHGYLAKWAEQGVLMLNTVL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVE+G+A SH   GWE FTD+ +  ++   + I+F+LWG  A KK  ++  ++H ++   
Sbjct: 127 TVEQGKAHSHAKAGWETFTDNALRQLNEQERPIIFVLWGGHAMKKSKLIQAEQHHLVSGP 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGC+HFSK N  L+  G+  ++WQ+
Sbjct: 187 HPSPLSAYRGFFGCKHFSKINELLKASGEAPIDWQV 222


>gi|197248557|ref|YP_002147551.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|238690030|sp|B5F228|UNG_SALA4 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|197212260|gb|ACH49657.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
          Length = 229

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N    +  E++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSLVN+YKEL+  +  F+ P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAPPPSLVNIYKELEASIPGFVRPAHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDPQRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF+  N++L++HG+ T++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFALTNQWLEQHGEKTIDW 220


>gi|323486277|ref|ZP_08091603.1| uracil-DNA glycosylase [Clostridium symbiosum WAL-14163]
 gi|323400387|gb|EGA92759.1| uracil-DNA glycosylase [Clostridium symbiosum WAL-14163]
          Length = 224

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W + L   F+  + + L E  + ++ + + ++P  +  F AFD TP +KVKVVILG
Sbjct: 4   ISNDWLAPLGAEFKKPYYKKLYE-TVKQEYQTRAVYPDANDIFNAFDFTPLSKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHGPGQAHGLCFSVKPDVEIPPSLVNIYQELHDDLGCFIPNNGYLKKWAEQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + +VF+LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRILAGQDRPMVFILWGRPAQMKKPMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FSK N YL+ +G   V+WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSKTNEYLEANGLEPVDWQI 221


>gi|262040313|ref|ZP_06013564.1| uracil-DNA glycosylase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330007675|ref|ZP_08306015.1| uracil-DNA glycosylase [Klebsiella sp. MS 92-3]
 gi|259042422|gb|EEW43442.1| uracil-DNA glycosylase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328535398|gb|EGF61879.1| uracil-DNA glycosylase [Klebsiella sp. MS 92-3]
          Length = 237

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N  + +  E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 14  TWHDVLADEKQQPYFLNTLKTVAEERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 73

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+ IPPSL+N+YKEL+  +  F  PTHG+LE W  +GVLLLN V
Sbjct: 74  YHGPGQAHGLAFSVRPGVAIPPSLLNMYKELEATIPGFTRPTHGYLESWARQGVLLLNTV 133

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 134 LTVRAGQAHSHASLGWETFTDKVIALINEHCEGVVFLLWGSHAQKKGAIIDRQRHCVLKA 193

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF + N++L + G+T ++W
Sbjct: 194 PHPSPLSAHRGFFGCNHFVQTNQWLVDRGETPIDW 228


>gi|28377657|ref|NP_784549.1| uracil-DNA glycosylase [Lactobacillus plantarum WCFS1]
 gi|308179817|ref|YP_003923945.1| uracil-DNA glycosylase [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|32171736|sp|Q88YG1|UNG_LACPL RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|28270490|emb|CAD63392.1| uracil-DNA glycosylase [Lactobacillus plantarum WCFS1]
 gi|308045308|gb|ADN97851.1| uracil-DNA glycosylase [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 230

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+  +   L EFL +E R  K I P   + F+AF+ TPF   KVVILG
Sbjct: 5   IHTDWWDVLKPEFEKPYYHQLHEFLKNEYRT-KNIHPDMYNIFQAFEWTPFADTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN+YKELQ+DV   P  HG+LE W  +GVLLLN
Sbjct: 64  QDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQDDVGCTPVNHGYLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV+ G A SH G+GWE+ TD  I  +S     +VF+LWG +A+ K  ++D + ++VL
Sbjct: 124 SVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFILWGKAARSKIKLIDTQTNVVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 184 QAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQLP 223


>gi|29833553|ref|NP_828187.1| uracil-DNA glycosylase [Streptomyces avermitilis MA-4680]
 gi|45593585|sp|Q827B3|UNG2_STRAW RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|29610676|dbj|BAC74722.1| putative uracil-DNA glycosylase [Streptomyces avermitilis MA-4680]
          Length = 227

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+ +G  ++P     F A   TP+ +VKV++LG
Sbjct: 7   LPESWRGVLGDELQQPYFKELTEFVEEERARGP-VYPPREEVFAALAATPYERVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE++E++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMKEELGTPIPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+G+GWE+FTD+VI  +++     VF+LWG  AQKK  ++D +RH+V+
Sbjct: 126 AVLTVRSGEANSHKGKGWEKFTDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEERHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  + E G T ++W IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAEQGHTPIDWTIP 224


>gi|57168766|ref|ZP_00367897.1| uracil-DNA glycosylase [Campylobacter coli RM2228]
 gi|305432493|ref|ZP_07401655.1| uracil-DNA glycosylase [Campylobacter coli JV20]
 gi|57019813|gb|EAL56496.1| uracil-DNA glycosylase [Campylobacter coli RM2228]
 gi|169640256|gb|ACA61179.1| uracil-DNA glycosylase [Campylobacter coli]
 gi|304444532|gb|EFM37183.1| uracil-DNA glycosylase [Campylobacter coli JV20]
          Length = 231

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 103/224 (45%), Positives = 150/224 (66%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E +KI+  WK  L+  F   +   +K+  +        I+P  +  F AF++TP +++K
Sbjct: 8   IEDIKINNDWKEFLKEEFSKSYFLEIKKRYIQALNNKAIIYPPSNLTFNAFNLTPLSELK 67

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           +V+LGQDPYH   QA GL FSVP G++IPPSL+N+YKEL+ D+N  P   G L  W  +G
Sbjct: 68  IVLLGQDPYHQPNQAMGLSFSVPCGVKIPPSLLNIYKELKADLNIEPSKSGDLSSWAKQG 127

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE G+ ASH   GW++F+D+VI  +S     ++F+LWG  A+ K+ ++D K
Sbjct: 128 VLLLNSILSVEAGKPASHSSWGWQEFSDAVISKLSLEKSGLIFILWGNYAKSKKALIDTK 187

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H +L+AAHPSPL A  GF GC+HFSKAN  L+  GK  +NWQ+
Sbjct: 188 KHFILEAAHPSPL-ARTGFLGCKHFSKANEILKNLGKKPINWQL 230


>gi|297198166|ref|ZP_06915563.1| uracil-DNA glycosylase [Streptomyces sviceus ATCC 29083]
 gi|197714690|gb|EDY58724.1| uracil-DNA glycosylase [Streptomyces sviceus ATCC 29083]
          Length = 227

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+ +G  ++P     F A D TP+++VKV+ILG
Sbjct: 7   LPESWRGVLGDELQQPYFKELTEFVEDERARGP-VYPPREEVFAALDATPYDRVKVLILG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE++E++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMKEELGLEIPDNGYLMPWAQQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+G+GWE+FTD+VI  ++      VF+LWG  AQKK  ++D  RH+V+
Sbjct: 126 AVLTVRSGEANSHKGKGWEKFTDAVIRAVAERPDPAVFVLWGNYAQKKLPLIDESRHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  + + G   ++W IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAQQGHEPIDWTIP 224


>gi|77377731|gb|ABA70606.1| Ung [Neisseria gonorrhoeae]
          Length = 200

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 141/193 (73%), Gaps = 1/193 (0%)

Query: 33  EKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSL 92
           E+  G+ I+P  +  F AF +T F++VKVVILGQDPYH  GQAHGL FSV  G+R+PPSL
Sbjct: 8   ERLSGQIIYPPEADVFNAFRLTAFDRVKVVILGQDPYHGVGQAHGLAFSVRQGVRVPPSL 67

Query: 93  VNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVI 151
           +N+YKEL+ D+  F  P HG L  W  +G+LLLN VLTV  G+A SH   GWE+FTD+VI
Sbjct: 68  LNIYKELETDIEGFSIPAHGCLTAWAEQGILLLNTVLTVRAGQAHSHALLGWERFTDTVI 127

Query: 152 DLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRY 211
             ++ + +++VFMLWG  AQ+K  ++D + HL+L A HPSPLSA  GFFGCRHFS+AN Y
Sbjct: 128 RQLATHRKHLVFMLWGGYAQQKGRLIDSQNHLILTAPHPSPLSAYRGFFGCRHFSQANSY 187

Query: 212 LQEHGKTTVNWQI 224
           L +HG   +NW++
Sbjct: 188 LSQHGIEPINWKL 200


>gi|33152195|ref|NP_873548.1| uracil-DNA glycosylase [Haemophilus ducreyi 35000HP]
 gi|45477231|sp|Q7VMC0|UNG_HAEDU RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|33148417|gb|AAP95937.1| uracil-DNA glycosylase [Haemophilus ducreyi 35000HP]
          Length = 223

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 144/219 (65%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW   +       + + L + +   +  GK I+P     F AF +T F  VKVVILGQDP
Sbjct: 3   SWTEAIGEEKVQPYFQQLLQQVYQARASGKIIYPPQHEVFSAFALTDFKAVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV   +  PPSLVN+YKEL +D+  F  P+HG+L  W  +GVLLLN V
Sbjct: 63  YHGPNQAHGLAFSVKPSVVPPPSLVNIYKELAQDIAGFQVPSHGYLIDWAKQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV++G A SH   GWE FTD VI  ++++ +N+VF+LWG+ AQKK   ++  RH VL A
Sbjct: 123 LTVQQGMAHSHATLGWEIFTDKVIAQLNDHRENLVFLLWGSHAQKKGQFINRSRHCVLTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGC+HFSKAN YLQ  G  T+NWQ+PL
Sbjct: 183 PHPSPLSAHRGFFGCQHFSKANAYLQSKGIATINWQLPL 221


>gi|282895970|ref|ZP_06304001.1| hypothetical protein CRD_00871 [Raphidiopsis brookii D9]
 gi|281199080|gb|EFA73950.1| hypothetical protein CRD_00871 [Raphidiopsis brookii D9]
          Length = 235

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 153/222 (68%), Gaps = 1/222 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +  +K+   W S+L + FQ  + + L EFL+ E+R  + I+P  S  F AF++TP+ +V 
Sbjct: 13  ISDLKVPGEWGSVLSDEFQKPYWKQLGEFLVQERR-SQTIYPPESEVFSAFELTPYQQVN 71

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           V++LGQDPYH   QAHGLCFSV  G++ PPSL N+Y+ELQ+D+ F    HG+L +W  +G
Sbjct: 72  VLLLGQDPYHQRNQAHGLCFSVKPGVKPPPSLKNIYQELQQDLGFPIANHGYLANWAKQG 131

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           +L+LNAVLTV EG+  SH+ +GWE FTD VI  ++   + ++F+LWG  A+KK  ++D  
Sbjct: 132 ILMLNAVLTVREGQPNSHKNQGWELFTDKVIRKVNEKPEPVIFVLWGGYARKKIKLIDTN 191

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           RHLV+++AHPSPLSA +GFFG + FS  N  L+   K  ++W
Sbjct: 192 RHLVIESAHPSPLSAYNGFFGSKPFSAINSALRIQDKPEIDW 233


>gi|291522161|emb|CBK80454.1| Uracil-DNA glycosylase [Coprococcus catus GD/7]
          Length = 224

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  F   +   L +  + E+    +IFP     F AF++TP   VKVVILG
Sbjct: 4   IANDWLEPLKPEFAKPYYAQLYK-KVKEEYTTHQIFPPSDMIFHAFEVTPLEDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV   + IPPSL N+YKELQ+D+    P +G+LE W  +GVLLLN
Sbjct: 63  QDPYHGDGQAHGLCFSVQPQVAIPPSLENIYKELQDDLGCYIPNNGYLEKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWEQFTD+ I +++   + IVF+LWG  AQ+K+ +L++  HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEQFTDAAIKILNQQDRPIVFILWGRPAQQKKAMLNNPHHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG + FS+ NR+L+EHG   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSKPFSQTNRFLEEHGVAPIDWQI 221


>gi|188994206|ref|YP_001928458.1| uracil-DNA glycosylase [Porphyromonas gingivalis ATCC 33277]
 gi|238691461|sp|B2RHL6|UNG_PORG3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|188593886|dbj|BAG32861.1| putative uracil-DNA glycosylase [Porphyromonas gingivalis ATCC
           33277]
          Length = 222

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 150/225 (66%), Gaps = 6/225 (2%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M+ V+I   WK +L+  F   +   L +F+  E R+   I+P     FRAFD  PF++VK
Sbjct: 1   MKEVQIEAGWKKVLQEEFDKFYFEKLTDFVREEYRQSP-IYPPARFIFRAFDTCPFDRVK 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTH---GFLEHWG 117
           VVILGQDPYH  GQA GL FSVP GI IPPSL N+ +E++ D     P H   G L  W 
Sbjct: 60  VVILGQDPYHEPGQAEGLAFSVPTGIPIPPSLRNICEEIRTDTG--QPAHIDGGSLLPWV 117

Query: 118 HEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL 177
            +GVLLLNA LTV   +A SH+G GWE FTD+ I+ ++   +++VF+LWG+ A++K  ++
Sbjct: 118 EQGVLLLNATLTVRASQAGSHQGHGWETFTDAAIEALAKRREHLVFLLWGSYARRKSAMI 177

Query: 178 DHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           D +RHL+L+A HPSPLSA  GFFGC+HFS+ N YL++HG   + W
Sbjct: 178 DPRRHLILEAPHPSPLSAHRGFFGCKHFSRTNAYLRQHGIAPIVW 222


>gi|331092173|ref|ZP_08341003.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330401945|gb|EGG81519.1| uracil-DNA glycosylase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 224

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L++ F+  +   L + +L E+     IFP     F AF +TP   VKVVILG
Sbjct: 4   INNDWLDALKDEFRKPYYAELHKKVL-EEYHTHLIFPPADDIFNAFHLTPLKNVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QAHGLCFSV   + IPPSLVN+YKEL +D+  + P HG+L  W  +GVL+LN
Sbjct: 63  QDPYHNVNQAHGLCFSVKPEVEIPPSLVNIYKELHDDLGCVIPNHGYLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + IV++LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRAVNTQDRPIVYILWGKPAQAKKSMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG + FSK N +L+EHG   ++WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSKPFSKTNAFLEEHGVEPIDWQI 221


>gi|152971434|ref|YP_001336543.1| uracil-DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238896029|ref|YP_002920765.1| uracil-DNA glycosylase [Klebsiella pneumoniae NTUH-K2044]
 gi|166200403|sp|A6TCJ2|UNG_KLEP7 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|150956283|gb|ABR78313.1| uracil-DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238548347|dbj|BAH64698.1| uracil-DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 229

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N  + +  E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFLNTLKTVAEERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+ IPPSL+N+YKEL+  +  F  PTHG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGVAIPPSLLNMYKELEATIPGFTRPTHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVIALINEHCEGVVFLLWGSHAQKKGAIIDRQRHCVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF + N++L + G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVQTNQWLVDRGETPIDW 220


>gi|323184540|gb|EFZ69914.1| uracil-DNA glycosylase [Escherichia coli 1357]
          Length = 229

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGHAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|317491006|ref|ZP_07949442.1| uracil-DNA glycosylase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920553|gb|EFV41876.1| uracil-DNA glycosylase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 231

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 143/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +   F+ +E++ GK I+P     F AF  T FN VKVVILGQDP
Sbjct: 6   NWHDVIGAEKEKPYFHDTLAFVAAERQAGKTIYPPQKDVFNAFRFTEFNDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI  PPSL+N+YKELQ D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGIPAPPSLMNMYKELQTDIEGFQIPNHGYLKSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD V+  ++ +   IVF+LWGA AQKK  ++D +RH VLKA
Sbjct: 126 LTVERGQAHSHAKLGWETFTDKVVAALNEHRSGIVFLLWGAHAQKKGSIIDTQRHRVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC HFS+ NR L E G T ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCHHFSQTNRLLIEQGLTPIDWQ 221


>gi|23099584|ref|NP_693050.1| uracil-DNA glycosylase [Oceanobacillus iheyensis HTE831]
 gi|32171758|sp|Q8EPH6|UNG_OCEIH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|22777814|dbj|BAC14085.1| uracil-DNA glycosylase [Oceanobacillus iheyensis HTE831]
          Length = 229

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 148/222 (66%), Gaps = 1/222 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W  LLE+ F+ ++   L+ FL  E  + ++I P     F A   TPF+KVKVVILG
Sbjct: 5   LYNDWSLLLEDEFKKDYYLRLRSFLKKEYTE-EKIHPAMEDIFNALHFTPFHKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  GI IPPSL N++KEL  +     PTHG L HW  +GVLLLN
Sbjct: 64  QDPYHGPDQAHGLSFSVQPGITIPPSLKNIFKELTHEFGMSMPTHGHLTHWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV EG+A SHRG+GWE FTD VI  ++     +VF+LWG +AQKK +++D  +H++L
Sbjct: 124 NVLTVREGKAHSHRGQGWEVFTDKVIQTLNQKDHPVVFLLWGGAAQKKGELIDTNKHIIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           KA HPSPLSA  GFF   HFSKAN+ L ++    ++W +P S
Sbjct: 184 KAPHPSPLSAYRGFFESNHFSKANQILHKNNVEEIDWTLPES 225


>gi|323693932|ref|ZP_08108119.1| uracil-DNA glycosylase [Clostridium symbiosum WAL-14673]
 gi|323502029|gb|EGB17904.1| uracil-DNA glycosylase [Clostridium symbiosum WAL-14673]
          Length = 224

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W + L   F+  + + L E  + ++ + + ++P  +  F AFD TP +KVKVVILG
Sbjct: 4   ISNDWLAPLGAEFKKPYYKKLYE-TVKQEYQTRAVYPDANDIFNAFDFTPLSKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV   + IPPSLVN+Y+EL +D+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHGPGQAHGLCFSVKPDVEIPPSLVNIYQELHDDLGCFIPNNGYLKKWAEQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + +VF+LWG  AQ K+ +L + +HL++
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRILAGQDRPMVFILWGRPAQMKKPMLTNPKHLIM 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FSK N YL+ +G   V+WQI
Sbjct: 183 EAPHPSPLSAYRGFFGSRPFSKTNEYLEANGLEPVDWQI 221


>gi|326335384|ref|ZP_08201572.1| uracil-DNA glycosylase [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325692449|gb|EGD34400.1| uracil-DNA glycosylase [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 222

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 145/221 (65%), Gaps = 2/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I+ SWK LL N F+  + R L  F+  E  +    +P+G   F AFD  P   VKVV+
Sbjct: 3   VNINSSWKPLLNNEFEKSYFRELTSFVKQEYSQ-YTCYPKGKEIFAAFDHCPVQNVKVVL 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQA+GLCFSV  GI  PPSLVN++KE++ED+    P  G L  W  +GVLL
Sbjct: 62  LGQDPYHGQGQANGLCFSVNDGIAHPPSLVNIFKEIEEDLKLPYPESGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+  GWE FTD+VI  IS+N   IVF+LWG  A+KK  ++D ++H 
Sbjct: 122 LNATLTVRANQAGSHQNHGWETFTDAVIKAISDNCSQIVFLLWGGFAKKKITLIDTQKHY 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNWQ 223
           +L + HPSPLSA+ G+ FG +HFSK N YL   GK  +NW+
Sbjct: 182 ILTSGHPSPLSANRGYWFGNKHFSKTNNYLLSIGKEAINWK 222


>gi|256845499|ref|ZP_05550957.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_36A2]
 gi|294785200|ref|ZP_06750488.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_27]
 gi|256719058|gb|EEU32613.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_36A2]
 gi|294486914|gb|EFG34276.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_27]
          Length = 226

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 152/220 (69%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE  L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFEKEYFVKLKE-TLEEEYKNYTVYPPKRDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV + +A SH G GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSQANSHSGLGWQTFTDNVIKSLNEREKPIIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANRGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|116872598|ref|YP_849379.1| uracil-DNA glycosylase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741476|emb|CAK20600.1| uracil-DNA glycosylase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 224

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 149/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL  E +  K++FP     F A   T +  VKVVI
Sbjct: 2   IKLENDWDELLKDEFNQSYYLKLRQFLKIEYQT-KKVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+ IPPSL N+Y EL +D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQKGVPIPPSLQNIYTELHQDLNCEIPNNGYLIPWAEQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T  +I++I+   + +VF+LWG +A++K  +L + +H+
Sbjct: 121 LNTVLTVRAGQANSHRGQGWETLTTRIIEMINQKEEPVVFLLWGNNAKEKLPLLTNPKHI 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSASHGF GC+HFSK N++L ++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASHGFMGCKHFSKTNQFLAQNGIKPIDWQIP 222


>gi|85059775|ref|YP_455477.1| uracil-DNA glycosylase [Sodalis glossinidius str. 'morsitans']
 gi|123519053|sp|Q2NS03|UNG_SODGM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|84780295|dbj|BAE75072.1| uracil-DNA glycosylase [Sodalis glossinidius str. 'morsitans']
          Length = 227

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 139/215 (64%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+  L       + +    F+  E+  G  ++P     F AF  T  N VKVVILGQDP
Sbjct: 6   TWRDALAQEKTLPYFQETLAFVARERAAGMTVYPPAKDVFNAFRFTELNAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F+ P HG L+ W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLSFSVKPGVPAPPSLVNIYKELASDIPGFVIPNHGCLQSWAQQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI +++   + IVF+LWG+ AQKK  ++D KRH VLKA
Sbjct: 126 LTVEAGKAHSHASLGWETFTDKVIKVLNAQREGIVFLLWGSHAQKKGTIIDPKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GCRHFS+AN  L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFLGCRHFSRANALLEQQGQQPIDW 220


>gi|256820859|ref|YP_003142138.1| uracil-DNA glycosylase [Capnocytophaga ochracea DSM 7271]
 gi|256582442|gb|ACU93577.1| uracil-DNA glycosylase [Capnocytophaga ochracea DSM 7271]
          Length = 221

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V IH SWKS+L+  F   +   L +F+  E  +    +P+G   F AFD  P ++VKVVI
Sbjct: 3   VNIHPSWKSVLQEEFNKPYFSQLTDFVKKEYAE-NICYPKGKQIFSAFDHCPLDRVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  GI  PPSL+N+++E+ +D+    P  G LE W  +GVLL
Sbjct: 62  IGQDPYHGEGQANGLCFSVHDGIAHPPSLINIFREIGQDLGTSYPISGNLERWASQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV    A SH+ +GWE FTD+VI  +S +  NIVFMLWG  A+KK  ++D  +H 
Sbjct: 122 LNATLTVRANEAGSHQNKGWETFTDAVIKAVSAHCNNIVFMLWGGYAKKKTSLIDPTKHC 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG +HFSKAN YL   GK  +NW
Sbjct: 182 ILTSGHPSPLSANKGYWFGNKHFSKANAYLTSVGKEAINW 221


>gi|163816326|ref|ZP_02207692.1| hypothetical protein COPEUT_02513 [Coprococcus eutactus ATCC 27759]
 gi|158448323|gb|EDP25318.1| hypothetical protein COPEUT_02513 [Coprococcus eutactus ATCC 27759]
          Length = 224

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  +  E+ R+L  F+  +    + ++P     F AF  TP +KVK VI+G
Sbjct: 4   ITNDWAEYLKPEYSKEYYRDLFNFV-GQAYATQTVYPPADDIFNAFHNTPLSKVKCVIIG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ IPPSLVN+Y+EL +D+    P +G+LE W  +GVL+LN
Sbjct: 63  QDPYHEPGQAHGLSFSVKPGVAIPPSLVNIYQELHDDLGCKIPNNGYLEKWADQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV+  RA SH+GRGWE+FTD+ I +++   + IVF+LWGA AQKK   L++  HL+L
Sbjct: 123 AVLTVQAHRAGSHQGRGWEKFTDAAIRILNKQDKPIVFILWGAYAQKKAAFLNNPHHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           K+AHPSPLS   GF+G R FSK N +L  HG   ++WQI
Sbjct: 183 KSAHPSPLSVYRGFWGSRPFSKTNDFLTAHGVEPIDWQI 221


>gi|119775963|ref|YP_928703.1| uracil-DNA glycosylase [Shewanella amazonensis SB2B]
 gi|119768463|gb|ABM01034.1| Uracil-DNA glycosylase [Shewanella amazonensis SB2B]
          Length = 221

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+  +    +  + ++L EF+ +E++ GK IFP  +  F AF+ TP +KV+VV++GQDP
Sbjct: 5   CWQDFIAAESEKPYFKSLTEFVAAERQSGKTIFPPEAEVFAAFEHTPLDKVRVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGLCFSV  GI+ PPSLVN+YKEL  D+ +F  P+HG+L  W  +GVL+LN V
Sbjct: 65  YHGAGQAHGLCFSVKPGIKPPPSLVNMYKELSADIPDFETPSHGYLLPWARQGVLMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVEEG+A SH   GWE FT + + L++     I+F+LWG+ A KK   +   +H VL  
Sbjct: 125 LTVEEGKAHSHAKAGWETFTAAALKLLNERDTPIIFVLWGSHAIKKGKGITAPQHQVLSG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFSK N  L+ HG   ++W++
Sbjct: 185 VHPSPLSAYRGFFGCGHFSKINELLKAHGGEPIDWRL 221


>gi|329943324|ref|ZP_08292098.1| uracil-DNA glycosylase [Chlamydophila psittaci Cal10]
 gi|332287900|ref|YP_004422801.1| uracil-DNA glycosylase [Chlamydophila psittaci 6BC]
 gi|313848472|emb|CBY17476.1| uracil-DNA glycosylase [Chlamydophila psittaci RD1]
 gi|325506898|gb|ADZ18536.1| uracil-DNA glycosylase [Chlamydophila psittaci 6BC]
 gi|328814871|gb|EGF84861.1| uracil-DNA glycosylase [Chlamydophila psittaci Cal10]
 gi|328915164|gb|AEB55997.1| uracil-DNA glycosylase [Chlamydophila psittaci 6BC]
          Length = 229

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 4/219 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW+  LEN +   +M  L+EFL SE  + K I+P   + F A   TPF+ V+VVILGQDP
Sbjct: 13  SWQEQLENEWSQPYMYKLREFLQSEYSQ-KTIYPAKDNIFTALKSTPFDSVRVVILGQDP 71

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           Y   GQAHGL FSVP G+R+PPSLVN++KEL  D+  +  T G L+ W ++G+LLLN VL
Sbjct: 72  YPGEGQAHGLSFSVPQGVRLPPSLVNIFKELHTDLG-VQNTTGCLQAWANQGILLLNTVL 130

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL--DHKRHLVLK 186
           TV  G   SH GRGWEQFTD+++  +  N  +++F+LWG +A+KK D+L     +H +L 
Sbjct: 131 TVRAGSPFSHAGRGWEQFTDAIVTKLIENRSHVIFVLWGNAARKKCDLLFRSTHKHAILA 190

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +AHPSPLSA  GFFGC HFSK N  L++  K  +NW++P
Sbjct: 191 SAHPSPLSAHRGFFGCSHFSKINYLLKKLNKPMINWKLP 229


>gi|300767626|ref|ZP_07077536.1| uracil-DNA glycosylase [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300494611|gb|EFK29769.1| uracil-DNA glycosylase [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 255

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 146/220 (66%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+  +   L EFL +E R  K I P   + F+AF+ TPF   KVVILG
Sbjct: 30  IHTDWWDVLKPEFEKPYYHQLHEFLKNEYRT-KNIHPDMYNIFQAFEWTPFADTKVVILG 88

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN+YKELQ DV   P  HG+LE W  +GVLLLN
Sbjct: 89  QDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQNDVGCTPVNHGYLESWAKQGVLLLN 148

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV+ G A SH G+GWE+ TD  I  +S     +VF+LWG +A+ K  ++D + ++VL
Sbjct: 149 SVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFILWGKAARSKIKLIDTQTNVVL 208

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 209 QAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQLP 248


>gi|167564229|ref|ZP_02357145.1| uracil-DNA glycosylase [Burkholderia oklahomensis EO147]
          Length = 259

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+++LE    S+    L  F+  E+  GK ++P  +  FRA  +T  + VKVVILGQDP
Sbjct: 34  DWRAILEPFIASDAYAPLCRFVDGERAAGKAVYP--TDVFRALRLTHPDDVKVVILGQDP 91

Query: 69  YH----NYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G++ PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 92  YHGEDHEIPQAHGLAFSVPPGVKPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 151

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TDS+I  ++  H+++VFMLWGA AQ K+ + D  +H V
Sbjct: 152 NTVLTVERSSAASHAKRGWEKCTDSLIHELATRHRHLVFMLWGAHAQAKRALFDASKHCV 211

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL++HG+  ++W++P
Sbjct: 212 LEAPHPSPLSAHRGFLGCRHFALANDYLKQHGRAPIDWRLP 252


>gi|16761505|ref|NP_457122.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16765967|ref|NP_461582.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29140798|ref|NP_804140.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56412530|ref|YP_149605.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62181222|ref|YP_217639.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161612633|ref|YP_001586598.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167553665|ref|ZP_02347412.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167994860|ref|ZP_02575950.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168232175|ref|ZP_02657233.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168238342|ref|ZP_02663400.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245089|ref|ZP_02670021.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168261351|ref|ZP_02683324.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168468061|ref|ZP_02701898.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168823164|ref|ZP_02835164.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194442686|ref|YP_002041914.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194448456|ref|YP_002046656.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194471327|ref|ZP_03077311.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194738255|ref|YP_002115659.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197263224|ref|ZP_03163298.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197361465|ref|YP_002141101.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198242907|ref|YP_002216662.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200387690|ref|ZP_03214302.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204929497|ref|ZP_03220571.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205353690|ref|YP_002227491.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858001|ref|YP_002244652.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213161476|ref|ZP_03347186.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213425264|ref|ZP_03358014.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213612387|ref|ZP_03370213.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|224584502|ref|YP_002638300.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238912712|ref|ZP_04656549.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289825486|ref|ZP_06544693.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|54039808|sp|P67074|UNG_SALTI RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|54042032|sp|P67073|UNG_SALTY RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|75505620|sp|Q57L54|UNG_SALCH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|81678084|sp|Q5PLH8|UNG_SALPA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|189037445|sp|A9N0W3|UNG_SALPB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238689914|sp|B5BAR7|UNG_SALPK RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238690362|sp|B5FRD9|UNG_SALDC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238690391|sp|B5QTW1|UNG_SALEP RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238690511|sp|B5RD62|UNG_SALG2 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238690624|sp|B4TE28|UNG_SALHS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238693592|sp|B4T290|UNG_SALNS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238693671|sp|B4TS29|UNG_SALSV RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|254790584|sp|C0PVZ2|UNG_SALPC RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|25289610|pir||AH0830 uracil-DNA glycosylase (EC 3.2.2.-) [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421197|gb|AAL21541.1| uracil-DNA-glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503806|emb|CAD05831.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29136423|gb|AAO67989.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56126787|gb|AAV76293.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62128855|gb|AAX66558.1| uracil-DNA-glycosylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161361997|gb|ABX65765.1| hypothetical protein SPAB_00328 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401349|gb|ACF61571.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194406760|gb|ACF66979.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457691|gb|EDX46530.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194713757|gb|ACF92978.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628873|gb|EDX48287.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197092941|emb|CAR58371.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197241479|gb|EDY24099.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197288845|gb|EDY28218.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937423|gb|ACH74756.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199604788|gb|EDZ03333.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204321216|gb|EDZ06416.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205273471|emb|CAR38448.1| Uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205321930|gb|EDZ09769.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205327340|gb|EDZ14104.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205333642|gb|EDZ20406.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336143|gb|EDZ22907.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205340532|gb|EDZ27296.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205349499|gb|EDZ36130.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206709804|emb|CAR34156.1| Uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224469029|gb|ACN46859.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261247845|emb|CBG25674.1| UDG [Salmonella enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267994788|gb|ACY89673.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159198|emb|CBW18713.1| Uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312913641|dbj|BAJ37615.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320085532|emb|CBY95311.1| uracil-DNA-glycosylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226002|gb|EFX51055.1| Uracil-DNA glycosylase, family 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613364|gb|EFY10306.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620432|gb|EFY17297.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625100|gb|EFY21929.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322629456|gb|EFY26232.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633843|gb|EFY30582.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635449|gb|EFY32160.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639875|gb|EFY36554.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644239|gb|EFY40783.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649931|gb|EFY46351.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654886|gb|EFY51203.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658186|gb|EFY54452.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322661742|gb|EFY57960.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669723|gb|EFY65869.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673270|gb|EFY69375.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322674941|gb|EFY71028.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682964|gb|EFY78982.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685625|gb|EFY81620.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322715710|gb|EFZ07281.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130985|gb|ADX18415.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323191947|gb|EFZ77185.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200420|gb|EFZ85501.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323201319|gb|EFZ86386.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208390|gb|EFZ93330.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211535|gb|EFZ96373.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215966|gb|EGA00698.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221747|gb|EGA06155.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225645|gb|EGA09872.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229363|gb|EGA13487.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235322|gb|EGA19406.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237492|gb|EGA21555.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245247|gb|EGA29248.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323246472|gb|EGA30453.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253997|gb|EGA37819.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259047|gb|EGA42695.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323261970|gb|EGA45535.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267753|gb|EGA51234.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269688|gb|EGA53140.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326624418|gb|EGE30763.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326628795|gb|EGE35138.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332989576|gb|AEF08559.1| uracil-DNA glycosylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 229

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N    +  E++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSLVN+YKEL+  +  F+ P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFVRPAHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDPQRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF+  N++L++HG+ T++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFALTNQWLEQHGEKTIDW 220


>gi|167748677|ref|ZP_02420804.1| hypothetical protein ANACAC_03451 [Anaerostipes caccae DSM 14662]
 gi|317470933|ref|ZP_07930312.1| uracil-DNA glycosylase [Anaerostipes sp. 3_2_56FAA]
 gi|167651991|gb|EDR96120.1| hypothetical protein ANACAC_03451 [Anaerostipes caccae DSM 14662]
 gi|316901584|gb|EFV23519.1| uracil-DNA glycosylase [Anaerostipes sp. 3_2_56FAA]
          Length = 224

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/187 (56%), Positives = 138/187 (73%)

Query: 38  KRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYK 97
           K IFP     F AF +TP ++VKVVILGQDPYHN GQAHGL FSV  G++ PPSLVN+Y+
Sbjct: 35  KNIFPPADDIFNAFHLTPLSRVKVVILGQDPYHNVGQAHGLSFSVKPGVQTPPSLVNIYQ 94

Query: 98  ELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNN 157
           EL ED+    P +G+L  W  +GVLLLN VLTV+  +A SH+  GWE+FTD+ I +++  
Sbjct: 95  ELHEDLGCYIPNNGYLTKWAEQGVLLLNTVLTVQAHKANSHKDIGWEEFTDAAIRILNEQ 154

Query: 158 HQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGK 217
            + IV++LWG +AQ K+ +L + +HLVL+A HPSP SAS GFFGCRHFS+ N +L+EHG 
Sbjct: 155 DRPIVYLLWGRNAQNKKWMLTNPKHLVLEAPHPSPFSASRGFFGCRHFSRTNEFLKEHGI 214

Query: 218 TTVNWQI 224
             V+WQI
Sbjct: 215 EPVDWQI 221


>gi|254555838|ref|YP_003062255.1| uracil-DNA glycosylase [Lactobacillus plantarum JDM1]
 gi|254044765|gb|ACT61558.1| uracil-DNA glycosylase [Lactobacillus plantarum JDM1]
          Length = 230

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 146/220 (66%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+  +   L EFL +E R  K I P   + F+AF+ TPF   KVVILG
Sbjct: 5   IHTDWWDVLKPEFEKPYYHQLHEFLKNEYRT-KNIHPDMYNIFQAFEWTPFADTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN+YKELQ DV   P  HG+LE W  +GVLLLN
Sbjct: 64  QDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQNDVGCTPVNHGYLESWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV+ G A SH G+GWE+ TD  I  +S     +VF+LWG +A+ K  ++D + ++VL
Sbjct: 124 SVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFILWGKAARSKIKLIDTQTNVVL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 184 QAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQLP 223


>gi|241999022|ref|XP_002434154.1| uracil DNA glycosylase, putative [Ixodes scapularis]
 gi|215495913|gb|EEC05554.1| uracil DNA glycosylase, putative [Ixodes scapularis]
          Length = 266

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 142/214 (66%), Gaps = 2/214 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W + LE  F  ++   L  F++ E+R+   ++P     F        +KV VVILGQDPY
Sbjct: 50  WFAALEAEFSKDYFHELSRFVM-EERQRHTVYPAHEDVFAWTRCCDIDKVAVVILGQDPY 108

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVL 128
           HN GQAHGL FSVP G+ +P SL+N+Y+EL+EDV  F  P HG L  W  +GVLLLNA L
Sbjct: 109 HNPGQAHGLAFSVPKGVAVPHSLINMYRELEEDVPGFQKPPHGNLTGWAEQGVLLLNACL 168

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV    A SH+ RGWE+ TD V+  ++    N+ F+LWGA AQKK  ++D KRHLVL+ A
Sbjct: 169 TVRAHAANSHKDRGWEKLTDVVVGCLNKRRSNLAFLLWGAYAQKKGAIIDRKRHLVLQCA 228

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           HPSPLSAS GFFGCRHFSKAN YL  H +  ++W
Sbjct: 229 HPSPLSASRGFFGCRHFSKANDYLARHNRRPIDW 262


>gi|300814749|ref|ZP_07094997.1| uracil-DNA glycosylase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300511136|gb|EFK38388.1| uracil-DNA glycosylase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 222

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W+ LLE+ FQ ++ +NL+E L++E  K  +I+P+ S  F AF+ T +  +KV+ILG
Sbjct: 4   LKNDWQELLEDEFQKDYYKNLRELLINE-YKNYQIYPKASDIFNAFNYTSYKDLKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QAHGL FSV  GI++PPSLVN+YKEL +D+   P   G+L+ W  EG++LLN
Sbjct: 63  QDPYHNPNQAHGLAFSVNKGIKVPPSLVNIYKELHDDLGIGPFKDGYLKSWTQEGIMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
             LTV +    SH   GWE FTD VI++I    + IVF+LWGA A+ K+ ++ +K HLV+
Sbjct: 123 TTLTVRKNAPMSHSKIGWEIFTDRVIEIIDEKKEPIVFILWGAHARSKKKLIKNKNHLVI 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +  HPSPLSA  GFFG + FS+AN++L E G  +  W++
Sbjct: 183 EGPHPSPLSAHRGFFGSKPFSRANKFLMERGIDSPTWEV 221


>gi|283786195|ref|YP_003366060.1| uracil-DNA glycosylase [Citrobacter rodentium ICC168]
 gi|282949649|emb|CBG89268.1| uracil-DNA glycosylase [Citrobacter rodentium ICC168]
          Length = 229

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + +E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFVNTLKTVATERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSLVN+YKEL+  V  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEGSVPGFTRPDHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF+  N +LQ+HG+  V+W
Sbjct: 186 PHPSPLSAHRGFFGCNHFALTNEWLQQHGEKPVDW 220


>gi|319638291|ref|ZP_07993054.1| uracil-DNA glycosylase [Neisseria mucosa C102]
 gi|317400564|gb|EFV81222.1| uracil-DNA glycosylase [Neisseria mucosa C102]
          Length = 219

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 142/218 (65%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   +    +  + + + E +  E++ G  ++P     F AF  T F  VKVVILGQD
Sbjct: 2   QTWHEAIGTEKEKAYFQTILEKVRHERQAGITVYPPERDVFNAFRTTEFGSVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH  GQAHGL FSV   I +PPSLVN+YKEL  D+  F  P HG+L+HW  +GVLLLN 
Sbjct: 62  PYHGAGQAHGLAFSVQPEIAVPPSLVNIYKELATDIEGFQIPQHGYLQHWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV  G A SH   GWE FTD VI  +    +++VFMLWG+ AQKK   +D  RHLVL 
Sbjct: 122 VLTVRAGVAHSHATFGWEAFTDEVIRQLDKEREHLVFMLWGSHAQKKGAFIDRNRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC+HFS+AN YLQ +G   ++WQ+
Sbjct: 182 APHPSPLSAYRGFFGCKHFSQANAYLQANGLEPIDWQV 219


>gi|328771511|gb|EGF81551.1| hypothetical protein BATDEDRAFT_16329 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 286

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/226 (49%), Positives = 150/226 (66%), Gaps = 5/226 (2%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E   + + W +   +  +S +  N+K FL +E+   K IFP   + + +F   P  K+K
Sbjct: 56  LEITTMPDDWFNAFRSEMESAYFLNIKRFLQAERDAKKVIFPLLENIY-SFTQCPLKKIK 114

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN---FIPPTHGFLEHWG 117
           VVI+GQDPYH   QAHG CFSV  G+ IPPSL+N+YKEL+ D+    F  P+HG+L  W 
Sbjct: 115 VVIIGQDPYHGLHQAHGQCFSVQKGVSIPPSLINIYKELESDLGLDVFKRPSHGYLNSWC 174

Query: 118 HEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL 177
            +GVLLLNA LTV +    SH   GW +FTD++I  I+ N+Q +VFMLWG  AQKK  V+
Sbjct: 175 QQGVLLLNASLTVRQSEPNSHAKCGWLKFTDAIIAYINKNNQGVVFMLWGGFAQKKGTVV 234

Query: 178 DHKRHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNW 222
           D K+HLVLKA HPSPL A+  G+FGC+HFSKAN YL+  G+  V+W
Sbjct: 235 DKKKHLVLKATHPSPLGANKGGWFGCKHFSKANEYLKSKGRGVVDW 280


>gi|313619299|gb|EFR91035.1| uracil-DNA glycosylase [Listeria innocua FSL S4-378]
          Length = 224

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL +E +  KR+FP     F A   T +  VKVVI
Sbjct: 2   IKLENDWDELLKDEFNQPYYLKLRQFLKNEYQT-KRVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQKGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H+
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEMLTNRIIEMINQKEEPVVFLLWGNNAKEKLQLLTNPKHI 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N +L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCKHFSKTNHFLEQNGIKPIDWQIP 222


>gi|16800259|ref|NP_470527.1| uracil-DNA glycosylase [Listeria innocua Clip11262]
 gi|25009511|sp|Q92CI1|UNG2_LISIN RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|16413649|emb|CAC96421.1| lin1190 [Listeria innocua Clip11262]
          Length = 224

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL +E +  KRIFP     F A   T +  VKVVI
Sbjct: 2   IKLENDWDELLKDEFNQPYYLKLRQFLKNEYQT-KRIFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQKGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H+
Sbjct: 121 LNTVLTVRAGQANSHRGQGWELLTNRIIEMINQKEEPVVFLLWGNNAKEKLQLLTNPKHI 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N +L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCKHFSKTNHFLEQNGIKPIDWQIP 222


>gi|91211907|ref|YP_541893.1| uracil-DNA glycosylase [Escherichia coli UTI89]
 gi|117624801|ref|YP_853714.1| uracil-DNA glycosylase [Escherichia coli APEC O1]
 gi|157155898|ref|YP_001463904.1| uracil-DNA glycosylase [Escherichia coli E24377A]
 gi|170683958|ref|YP_001744769.1| uracil-DNA glycosylase [Escherichia coli SMS-3-5]
 gi|191167979|ref|ZP_03029781.1| uracil-DNA glycosylase [Escherichia coli B7A]
 gi|194432091|ref|ZP_03064380.1| uracil-DNA glycosylase [Shigella dysenteriae 1012]
 gi|215487923|ref|YP_002330354.1| uracil-DNA glycosylase [Escherichia coli O127:H6 str. E2348/69]
 gi|218559501|ref|YP_002392414.1| uracil-DNA glycosylase [Escherichia coli S88]
 gi|227887616|ref|ZP_04005421.1| uracil-DNA glycosylase [Escherichia coli 83972]
 gi|237705090|ref|ZP_04535571.1| uracil-DNA-glycosylase [Escherichia sp. 3_2_53FAA]
 gi|300820740|ref|ZP_07100890.1| uracil-DNA glycosylase [Escherichia coli MS 119-7]
 gi|300927043|ref|ZP_07142795.1| uracil-DNA glycosylase [Escherichia coli MS 182-1]
 gi|300935714|ref|ZP_07150683.1| uracil-DNA glycosylase [Escherichia coli MS 21-1]
 gi|300982284|ref|ZP_07175995.1| uracil-DNA glycosylase [Escherichia coli MS 45-1]
 gi|301047219|ref|ZP_07194311.1| uracil-DNA glycosylase [Escherichia coli MS 185-1]
 gi|301330318|ref|ZP_07222965.1| uracil-DNA glycosylase [Escherichia coli MS 78-1]
 gi|306814356|ref|ZP_07448518.1| uracil-DNA glycosylase [Escherichia coli NC101]
 gi|307313849|ref|ZP_07593465.1| uracil-DNA glycosylase [Escherichia coli W]
 gi|309794366|ref|ZP_07688789.1| uracil-DNA glycosylase [Escherichia coli MS 145-7]
 gi|312965496|ref|ZP_07779728.1| uracil-DNA glycosylase [Escherichia coli 2362-75]
 gi|331648327|ref|ZP_08349416.1| uracil-DNA glycosylase [Escherichia coli M605]
 gi|331658725|ref|ZP_08359669.1| uracil-DNA glycosylase [Escherichia coli TA206]
 gi|331669331|ref|ZP_08370179.1| uracil-DNA glycosylase [Escherichia coli TA271]
 gi|331678577|ref|ZP_08379252.1| uracil-DNA glycosylase [Escherichia coli H591]
 gi|122422858|sp|Q1R8F2|UNG_ECOUT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|166201519|sp|A1AEB0|UNG_ECOK1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|167011637|sp|A7ZQ25|UNG_ECO24 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725939|sp|B7MIR5|UNG_ECO45 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725943|sp|B1LP93|UNG_ECOSM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|254790577|sp|B7UH19|UNG_ECO27 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|91073481|gb|ABE08362.1| uracil-DNA-glycosylase [Escherichia coli UTI89]
 gi|115513925|gb|ABJ02000.1| uracil-DNA-glycosylase [Escherichia coli APEC O1]
 gi|157077928|gb|ABV17636.1| uracil-DNA glycosylase [Escherichia coli E24377A]
 gi|170521676|gb|ACB19854.1| uracil-DNA glycosylase [Escherichia coli SMS-3-5]
 gi|190901986|gb|EDV61733.1| uracil-DNA glycosylase [Escherichia coli B7A]
 gi|194419620|gb|EDX35700.1| uracil-DNA glycosylase [Shigella dysenteriae 1012]
 gi|215265995|emb|CAS10405.1| uracil-DNA-glycosylase [Escherichia coli O127:H6 str. E2348/69]
 gi|218366270|emb|CAR04017.1| uracil-DNA-glycosylase [Escherichia coli S88]
 gi|222034285|emb|CAP77026.1| Uracil-DNA glycosylase [Escherichia coli LF82]
 gi|226901456|gb|EEH87715.1| uracil-DNA-glycosylase [Escherichia sp. 3_2_53FAA]
 gi|227835966|gb|EEJ46432.1| uracil-DNA glycosylase [Escherichia coli 83972]
 gi|281179629|dbj|BAI55959.1| uracil-DNA-glycosylase [Escherichia coli SE15]
 gi|294491200|gb|ADE89956.1| uracil-DNA glycosylase [Escherichia coli IHE3034]
 gi|300300896|gb|EFJ57281.1| uracil-DNA glycosylase [Escherichia coli MS 185-1]
 gi|300408838|gb|EFJ92376.1| uracil-DNA glycosylase [Escherichia coli MS 45-1]
 gi|300416927|gb|EFK00238.1| uracil-DNA glycosylase [Escherichia coli MS 182-1]
 gi|300459103|gb|EFK22596.1| uracil-DNA glycosylase [Escherichia coli MS 21-1]
 gi|300526493|gb|EFK47562.1| uracil-DNA glycosylase [Escherichia coli MS 119-7]
 gi|300843652|gb|EFK71412.1| uracil-DNA glycosylase [Escherichia coli MS 78-1]
 gi|305851750|gb|EFM52202.1| uracil-DNA glycosylase [Escherichia coli NC101]
 gi|306906350|gb|EFN36865.1| uracil-DNA glycosylase [Escherichia coli W]
 gi|307554599|gb|ADN47374.1| uracil-DNA-glycosylase [Escherichia coli ABU 83972]
 gi|307625871|gb|ADN70175.1| uracil-DNA glycosylase [Escherichia coli UM146]
 gi|308121822|gb|EFO59084.1| uracil-DNA glycosylase [Escherichia coli MS 145-7]
 gi|312289916|gb|EFR17804.1| uracil-DNA glycosylase [Escherichia coli 2362-75]
 gi|312947152|gb|ADR27979.1| uracil-DNA glycosylase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315061899|gb|ADT76226.1| uracil-DNA-glycosylase [Escherichia coli W]
 gi|315287996|gb|EFU47398.1| uracil-DNA glycosylase [Escherichia coli MS 110-3]
 gi|315294537|gb|EFU53885.1| uracil-DNA glycosylase [Escherichia coli MS 153-1]
 gi|315300539|gb|EFU59768.1| uracil-DNA glycosylase [Escherichia coli MS 16-3]
 gi|320200144|gb|EFW74733.1| Uracil-DNA glycosylase, family 1 [Escherichia coli EC4100B]
 gi|323377520|gb|ADX49788.1| uracil-DNA glycosylase [Escherichia coli KO11]
 gi|323944580|gb|EGB40649.1| uracil-DNA glycosylase [Escherichia coli H120]
 gi|323949234|gb|EGB45125.1| uracil-DNA glycosylase [Escherichia coli H252]
 gi|323955816|gb|EGB51574.1| uracil-DNA glycosylase [Escherichia coli H263]
 gi|324008437|gb|EGB77656.1| uracil-DNA glycosylase [Escherichia coli MS 57-2]
 gi|324118210|gb|EGC12106.1| uracil-DNA glycosylase [Escherichia coli E1167]
 gi|330912348|gb|EGH40858.1| uracil-DNA glycosylase, family 1 [Escherichia coli AA86]
 gi|331042876|gb|EGI15017.1| uracil-DNA glycosylase [Escherichia coli M605]
 gi|331054390|gb|EGI26417.1| uracil-DNA glycosylase [Escherichia coli TA206]
 gi|331064525|gb|EGI36436.1| uracil-DNA glycosylase [Escherichia coli TA271]
 gi|331075037|gb|EGI46357.1| uracil-DNA glycosylase [Escherichia coli H591]
 gi|332088092|gb|EGI93217.1| uracil-DNA glycosylase [Shigella boydii 5216-82]
 gi|332089236|gb|EGI94343.1| uracil-DNA glycosylase [Shigella dysenteriae 155-74]
 gi|332344455|gb|AEE57789.1| uracil-DNA glycosylase [Escherichia coli UMNK88]
          Length = 229

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|76811233|ref|YP_334945.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1710b]
 gi|76580686|gb|ABA50161.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1710b]
          Length = 271

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 46  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 103

Query: 69  YH----NYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH    +  QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 104 YHGEDRDIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 163

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 164 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 223

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 224 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 264


>gi|193068327|ref|ZP_03049290.1| uracil-DNA glycosylase [Escherichia coli E110019]
 gi|192958279|gb|EDV88719.1| uracil-DNA glycosylase [Escherichia coli E110019]
          Length = 229

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|156353994|ref|XP_001623190.1| predicted protein [Nematostella vectensis]
 gi|156209863|gb|EDO31090.1| predicted protein [Nematostella vectensis]
          Length = 308

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 142/215 (66%), Gaps = 2/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SWK  L+  F  ++   L +F+ SE+ K K ++P     F     T     KVVI+GQDP
Sbjct: 86  SWKKALKEEFTKDYFERLMKFVESERAK-KTVYPPEKDVFSFTLHTDIKDTKVVIIGQDP 144

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G+ +PPSLVN+YKEL  D++ F  P HG+L  W  +GVLLLNA 
Sbjct: 145 YHGLNQAHGLCFSVQPGVSVPPSLVNIYKELSNDIDGFKHPGHGYLIGWAKQGVLLLNAC 204

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV   +A SH+ +GWEQFTD+VI  I+ N   +VF+LWG+ AQKK   +D K+H +LKA
Sbjct: 205 LTVVASQANSHKEKGWEQFTDAVIRWINRNLSGVVFLLWGSYAQKKGSFIDKKKHCILKA 264

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFSKAN YL + GK  + W
Sbjct: 265 VHPSPLSAHRGFLGCKHFSKANEYLIQRGKKPIEW 299


>gi|251788687|ref|YP_003003408.1| uracil-DNA glycosylase [Dickeya zeae Ech1591]
 gi|247537308|gb|ACT05929.1| uracil-DNA glycosylase [Dickeya zeae Ech1591]
          Length = 228

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  +  N   F+  E+  GK I+P     F AF  T F+ VKVVILGQDP
Sbjct: 6   TWHDMLAQEKEQPYFVNTLSFVHQEREAGKVIYPPQKDVFNAFRFTEFHAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  PTHG+L+ W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNIYKELANDIPGFSIPTHGYLQSWAQQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI+ ++ + + IVF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVEAGKAHSHANLGWETFTDKVIEKLNAHREGIVFLLWGSHAQKKGSIIDTQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFS+ N+ L++ G T ++W
Sbjct: 186 PHPSPLSAHRGFLGCHHFSRTNQLLEQQGDTPIDW 220


>gi|304413656|ref|ZP_07395100.1| Uracil DNA glycosylase [Candidatus Regiella insecticola LSR1]
 gi|304283747|gb|EFL92141.1| Uracil DNA glycosylase [Candidatus Regiella insecticola LSR1]
          Length = 226

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 145/220 (65%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + R+   ++ +++  GK I+P     F AF  T F  VKV+ILGQDP
Sbjct: 6   TWHDVIGQEKEKPYFRDTLSYVAAQRHAGKIIYPAQKDVFNAFRFTQFAHVKVIILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL +D+ +F  P HG L+ W  +GVLLLN V
Sbjct: 66  YHGLNQAHGLSFSVLPGVPAPPSLVNIYKELVQDIADFTYPDHGCLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWEQFTD V+  ++     ++F+LWGA AQKK  ++D KRH VL+A
Sbjct: 126 LTVEAGKAHSHAHLGWEQFTDRVVAALNEYRTGVIFLLWGAHAQKKGSIIDRKRHFVLQA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GFFGCRHFS+ N+ LQ+    ++ WQ  L+
Sbjct: 186 PHPSPLSAHRGFFGCRHFSQVNQLLQQQKLASIRWQPELT 225


>gi|229496139|ref|ZP_04389859.1| uracil-DNA glycosylase [Porphyromonas endodontalis ATCC 35406]
 gi|229316717|gb|EEN82630.1| uracil-DNA glycosylase [Porphyromonas endodontalis ATCC 35406]
          Length = 221

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I E WK +L   F   +   L +F+  + R+G   +P  +  FRAFD  PF++V+VVI
Sbjct: 3   VRIEEGWKKVLAPEFDKFYFETLTDFVRKQYRQGA-AYPPAAQIFRAFDCCPFDRVRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHG-FLEHWGHEGVL 122
           LGQDPYH  GQA GL FSVP GI  PPSL N+ +E+  D+       G  L  W  +GVL
Sbjct: 62  LGQDPYHEPGQAEGLAFSVPEGITPPPSLRNILQEIASDLGHPSIIQGGHLMPWVEQGVL 121

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLNA LTVE  +AASH+GRGWE FTD+ I+ ++   + +VFMLWG+SA++K  ++   +H
Sbjct: 122 LLNATLTVEAHKAASHQGRGWETFTDAAIEALAKQREGLVFMLWGSSARRKAAMIPQGKH 181

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            VL+A HPSPLSA  GF GCRHFSKAN YL+  G+  + W
Sbjct: 182 FVLEAPHPSPLSAHRGFLGCRHFSKANEYLRRRGQQPIEW 221


>gi|116629926|ref|YP_815098.1| uracil-DNA glycosylase [Lactobacillus gasseri ATCC 33323]
 gi|116095508|gb|ABJ60660.1| Uracil-DNA glycosylase [Lactobacillus gasseri ATCC 33323]
          Length = 268

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+SE  + L +FL SE R  K+IFP   H F AF +T F   KVVILG
Sbjct: 42  IGNDWDEILAPAFESEQYQKLHDFLKSEYRT-KQIFPDMYHIFTAFKLTSFADTKVVILG 100

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  IP  HG+L+ W  +GVLLLN
Sbjct: 101 QDPYHNPGQATGMSFSVNPGVALPPSLKNIYKELYDDVGAIPVNHGYLKKWADQGVLLLN 160

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  H+G+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D ++++++
Sbjct: 161 AVLTVPYGNANGHQGKGWEIVTDAAIKALSDRGK-VVFILWGRFAQNKIPLIDEEKNVII 219

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 220 KSAHPSPFSADRGFFGSRPFSRCNDALTKFGESPIDWQLP 259


>gi|110642742|ref|YP_670472.1| uracil-DNA glycosylase [Escherichia coli 536]
 gi|191174008|ref|ZP_03035525.1| uracil-DNA glycosylase [Escherichia coli F11]
 gi|218701095|ref|YP_002408724.1| uracil-DNA glycosylase [Escherichia coli IAI39]
 gi|300974115|ref|ZP_07172465.1| uracil-DNA glycosylase [Escherichia coli MS 200-1]
 gi|123343739|sp|Q0TEQ8|UNG_ECOL5 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725940|sp|B7NRN6|UNG_ECO7I RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|110344334|gb|ABG70571.1| uracil-DNA glycosylase [Escherichia coli 536]
 gi|190905699|gb|EDV65321.1| uracil-DNA glycosylase [Escherichia coli F11]
 gi|218371081|emb|CAR18910.1| uracil-DNA-glycosylase [Escherichia coli IAI39]
 gi|300308938|gb|EFJ63458.1| uracil-DNA glycosylase [Escherichia coli MS 200-1]
 gi|324014375|gb|EGB83594.1| uracil-DNA glycosylase [Escherichia coli MS 60-1]
          Length = 229

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHRKGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|237807669|ref|YP_002892109.1| uracil-DNA glycosylase [Tolumonas auensis DSM 9187]
 gi|259563563|sp|C4LC44|UNG_TOLAT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|237499930|gb|ACQ92523.1| uracil-DNA glycosylase [Tolumonas auensis DSM 9187]
          Length = 223

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 143/218 (65%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  +L    +  + +   +F+  E+  GK ++P  +  F AF  T F  VKVVILGQD
Sbjct: 2   QTWSDVLGQEKKQAYFQETMDFVRREREAGKIVYPPAADVFNAFKYTEFADVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGLCFSV  G+ +PPSLVN+YKEL  D+  F  P+HG+L  W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLCFSVLPGVAVPPSLVNIYKELHRDIPGFEIPSHGYLLSWAQQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE G+A SH   GWE FTD VI  ++ + + +VF+LWG  AQKK   +D +RH VL 
Sbjct: 122 VLTVEAGKAHSHASSGWEHFTDRVIAALNEHREGLVFLLWGNHAQKKGQYIDRQRHHVLM 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GF GC HFS+ N++L +  K  +NWQI
Sbjct: 182 APHPSPLSAHRGFLGCGHFSQTNQFLTDADKQPINWQI 219


>gi|26248946|ref|NP_754986.1| uracil-DNA glycosylase [Escherichia coli CFT073]
 gi|26109352|gb|AAN81554.1|AE016764_236 Uracil-DNA glycosylase [Escherichia coli CFT073]
          Length = 229

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDXQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|29428121|sp|Q8FF08|UNG_ECOL6 RecName: Full=Uracil-DNA glycosylase; Short=UDG
          Length = 228

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDXQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|167538420|ref|XP_001750874.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163770620|gb|EDQ84304.1| predicted protein [Monosiga brevicollis MX1]
          Length = 412

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 142/218 (65%), Gaps = 2/218 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W+  L   F   + + L EFL  ++   K I+P                VKVVILG
Sbjct: 190 LAPDWRQALRAEFDKPYYKQLMEFLTKQQAAKKVIYPPPEMVHSYSRACRLRDVKVVILG 249

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLL 124
           QDPYH  GQAHGLCFSV  G+ IP SL N+YKEL  D++ F+ P HG+L+ W  +GVL+L
Sbjct: 250 QDPYHGPGQAHGLCFSVLKGVAIPGSLRNIYKELTADIDGFVAPKHGYLQSWADQGVLML 309

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NA LTVE  +  SH G+GWE++TD+VI  IS N  N+VF+LWG  A+KK   +D KRH V
Sbjct: 310 NACLTVEHKQPNSHAGQGWEKYTDAVIAWISKNLNNVVFILWGNYAKKKGSKVDQKRHCV 369

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           L  AHPSPLSA+  +FGCRHFS+AN YL++HGK  +NW
Sbjct: 370 LAGAHPSPLSATK-YFGCRHFSRANEYLKKHGKKPINW 406


>gi|254190497|ref|ZP_04897005.1| uracil-DNA glycosylase [Burkholderia pseudomallei Pasteur 52237]
 gi|254260919|ref|ZP_04951973.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1710a]
 gi|157938173|gb|EDO93843.1| uracil-DNA glycosylase [Burkholderia pseudomallei Pasteur 52237]
 gi|254219608|gb|EET08992.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1710a]
          Length = 262

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YH----NYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH    +  QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRDIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|320196416|gb|EFW71040.1| Uracil-DNA glycosylase, family 1 [Escherichia coli WV_060327]
          Length = 229

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|168705510|ref|ZP_02737787.1| uracil-DNA glycosylase [Gemmata obscuriglobus UQM 2246]
          Length = 270

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +  SW   L+   +  +  +L  F++ E+RK + +FP     F AF  TP +KVKV+ILG
Sbjct: 49  LDPSWHKALDPETRKPYWADLVRFIV-EERKTQTVFPPAPDVFNAFRFTPLDKVKVLILG 107

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV  GI  PPSL N+YKEL+ D+   P  HG+L  W   GVL+LN
Sbjct: 108 QDPYHGPGQAHGLCFSVRPGIATPPSLRNIYKELESDLGIPPVKHGYLAEWARRGVLMLN 167

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           A +TV +G+A SH+ +GWE+FTD+ I  +S   + +VF+LWG+ AQKK  ++D K+H+V+
Sbjct: 168 ACMTVRKGQANSHKDKGWEKFTDAAISAVSAQPRRVVFVLWGSYAQKKIPLIDQKKHVVV 227

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP S  H FFG + FSK N  L+  G+  ++W++P
Sbjct: 228 KSAHPSPFS-EHLFFGTKPFSKVNEVLEAAGEEPIDWRLP 266


>gi|116494499|ref|YP_806233.1| uracil-DNA glycosylase [Lactobacillus casei ATCC 334]
 gi|191637938|ref|YP_001987104.1| uracil-DNA glycosylase [Lactobacillus casei BL23]
 gi|239631258|ref|ZP_04674289.1| uracil-DNA glycosylase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301066014|ref|YP_003788037.1| uracil DNA glycosylase [Lactobacillus casei str. Zhang]
 gi|122264075|sp|Q03AI1|UNG_LACC3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238693028|sp|B3WCZ5|UNG_LACCB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|116104649|gb|ABJ69791.1| Uracil-DNA glycosylase [Lactobacillus casei ATCC 334]
 gi|190712240|emb|CAQ66246.1| Uracil-DNA glycosylase (UDG) [Lactobacillus casei BL23]
 gi|239525723|gb|EEQ64724.1| uracil-DNA glycosylase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300438421|gb|ADK18187.1| Uracil DNA glycosylase [Lactobacillus casei str. Zhang]
 gi|327382007|gb|AEA53483.1| uracil-DNA glycosylase [Lactobacillus casei LC2W]
 gi|327385165|gb|AEA56639.1| uracil-DNA glycosylase [Lactobacillus casei BD-II]
          Length = 228

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 150/220 (68%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+++LE  F+S     L  FL  E+   K I+P   H F+AF+ TPF+ VKVVILG
Sbjct: 5   IHNDWQTVLEPVFESPEYAQLHAFL-KEEYATKTIYPEMHHIFQAFEWTPFHDVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QA G  F+V  G+ +PPSL N+YKELQ D+ + P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHNPRQAVGASFAVAPGVALPPSLQNIYKELQSDLGYPPVHHGYLKAWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV+ G A SH+  GWE+ TD+ I  +S     +VF+LWG +A+KK  V+D  ++ ++
Sbjct: 124 AVLTVQAGEAYSHQNHGWEELTDAAIAALSAR-GGVVFILWGNAAKKKAAVIDTSKNAII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            +AHPSPLSAS GFFG R FS+ N  L++ G+  +NWQ+P
Sbjct: 183 ASAHPSPLSASRGFFGSRPFSRTNAALEKMGEAPINWQLP 222


>gi|228471269|ref|ZP_04056076.1| uracil-DNA glycosylase [Porphyromonas uenonis 60-3]
 gi|228306963|gb|EEK16058.1| uracil-DNA glycosylase [Porphyromonas uenonis 60-3]
          Length = 221

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 149/222 (67%), Gaps = 6/222 (2%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SW  +LE  F+  +   L  F+ SE +  KRI+P G   FRAFD+ PF  V+VVI
Sbjct: 3   VRIEPSWHRVLEEEFEKFYFETLTSFVRSEYQT-KRIYPPGGQIFRAFDLCPFEDVRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTH---GFLEHWGHEG 120
           LGQDPYH  GQA GL FSVP G+ +PPSL N+  E+  D+    P+    G L  W  +G
Sbjct: 62  LGQDPYHGVGQAEGLAFSVPEGVEVPPSLRNILTEISSDLGH--PSQIVGGHLTPWCRQG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTV    A SH+GRGWE FTD VI L+S+  +++VFMLWG  A+ K+ ++D +
Sbjct: 120 VLLLNATLTVVAHEAGSHQGRGWETFTDQVISLLSSQREHLVFMLWGNYARCKRALIDRQ 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HL+L+A HPSPLSA  GFFGCRHFSKAN YLQ +G   + W
Sbjct: 180 KHLILEAPHPSPLSAHRGFFGCRHFSKANAYLQRYGYEPIRW 221


>gi|227535530|ref|ZP_03965579.1| uracil-DNA glycosylase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|227186852|gb|EEI66919.1| uracil-DNA glycosylase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
          Length = 231

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 150/220 (68%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+++LE  F+S     L  FL  E+   K I+P   H F+AF+ TPF+ VKVVILG
Sbjct: 8   IHNDWQTVLEPVFESPEYAQLHAFL-KEEYATKTIYPEMHHIFQAFEWTPFHDVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QA G  F+V  G+ +PPSL N+YKELQ D+ + P  HG+L+ W  +GVLLLN
Sbjct: 67  QDPYHNPRQAVGASFAVAPGVALPPSLQNIYKELQSDLGYPPVHHGYLKAWADQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV+ G A SH+  GWE+ TD+ I  +S     +VF+LWG +A+KK  V+D  ++ ++
Sbjct: 127 AVLTVQAGEAYSHQNHGWEELTDAAIAALSAR-GGVVFILWGNAAKKKAAVIDTSKNAII 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            +AHPSPLSAS GFFG R FS+ N  L++ G+  +NWQ+P
Sbjct: 186 ASAHPSPLSASRGFFGSRPFSRTNAALEKMGEAPINWQLP 225


>gi|238897678|ref|YP_002923357.1| uracil-DNA-glycosylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465435|gb|ACQ67209.1| uracil-DNA-glycosylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 225

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 149/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ ++    +  + ++    + +E+R  K I+P   + F AF +T F +VKVVI+GQDP
Sbjct: 9   TWRDVIGAEKKEFYFKDTLASVAAERRSNKMIYPSPENVFNAFRLTEFGEVKVVIIGQDP 68

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI +PPSLVN+YKEL  D+  F+ P HG LE+W  +GVLLLN V
Sbjct: 69  YHGPNQAHGLSFSVLPGIVLPPSLVNIYKELLNDIIGFVYPNHGCLENWAKQGVLLLNTV 128

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE GRA SH   GW  FTD VI  ++ ++  I+F+LWG+ AQKK +++D +RH +LKA
Sbjct: 129 LTVEAGRANSHAHLGWGIFTDRVIAALNQHNHRIIFLLWGSHAQKKGEIIDTQRHFILKA 188

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GFFGC+HFSK N+ L++ G   ++WQ
Sbjct: 189 PHPSPLSAHRGFFGCKHFSKTNQLLEQQGLAPISWQ 224


>gi|291327246|ref|ZP_06127486.2| uracil-DNA glycosylase [Providencia rettgeri DSM 1131]
 gi|291311161|gb|EFE51614.1| uracil-DNA glycosylase [Providencia rettgeri DSM 1131]
          Length = 230

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++       + +    ++  +++ GK I+P     F AF  T  + +KVVILGQDP
Sbjct: 10  TWHDVIGPEKSKSYFKETLAYVAEQRKNGKIIYPAQDDVFNAFRYTELSDIKVVILGQDP 69

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI+ PPSLVN+YKEL++D+ +F  P HG+L  W  +GVLLLN V
Sbjct: 70  YHGPGQAHGLSFSVLPGIKPPPSLVNMYKELEKDISDFQRPNHGYLLSWAQQGVLLLNTV 129

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI+ I+ N + ++F+LWG+ AQKK  ++D KRH VLKA
Sbjct: 130 LTVEQGNAHSHAHLGWETFTDKVIEAINENTEGVIFLLWGSHAQKKGKIIDTKRHHVLKA 189

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GCRHFS+ N  L + GK  ++W
Sbjct: 190 PHPSPLSAHRGFLGCRHFSQTNEILAQQGKKPIDW 224


>gi|302873508|ref|YP_003842141.1| uracil-DNA glycosylase [Clostridium cellulovorans 743B]
 gi|307688312|ref|ZP_07630758.1| uracil-DNA glycosylase [Clostridium cellulovorans 743B]
 gi|302576365|gb|ADL50377.1| uracil-DNA glycosylase [Clostridium cellulovorans 743B]
          Length = 224

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/223 (47%), Positives = 146/223 (65%), Gaps = 1/223 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I+  W  LL++ F+ ++ + L+ FL+ E+ K   I+P     F A   T +  VKVVI
Sbjct: 2   VNINNDWDELLKDEFEKDYYKKLRGFLV-EEYKTHTIYPDKHDIFTAIKTTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QA G+ F+V  G++ PPSLVN+YKEL  D+    P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPNQAFGMAFAVKPGVKTPPSLVNIYKELNSDLGCFIPNNGYLVPWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV E    SH+G+GWE  TD +I L++   + IVF++WG  A++K   + +K HL
Sbjct: 121 LNAVLTVRENSPNSHKGKGWELLTDKIIQLLNEREEPIVFLIWGNPAKEKLKFITNKHHL 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           +L   HPSPLSAS GFFGC+HFSK N +L+  G   ++WQIP+
Sbjct: 181 ILTTVHPSPLSASRGFFGCKHFSKTNEFLKSKGMEPIDWQIPM 223


>gi|115371965|ref|ZP_01459277.1| uracil-DNA glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|310824746|ref|YP_003957104.1| uracil-DNA glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|115370930|gb|EAU69853.1| uracil-DNA glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|309397818|gb|ADO75277.1| Uracil-DNA glycosylase [Stigmatella aurantiaca DW4/3-1]
          Length = 224

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 146/221 (66%), Gaps = 1/221 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           ++ E WK  L+   ++     L+ F+  ++R    I+P     F AF +TP  +V+V+IL
Sbjct: 4   RLPEGWKQELKGALEAPSAEALERFV-DQERGEATIYPPEEELFSAFQLTPPERVRVLIL 62

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  G+R+PPSL+N++KELQ D+   P   G L  W  +GVLLL
Sbjct: 63  GQDPYHGPGQAHGLAFSVRPGVRLPPSLLNIFKELQSDLGLPPAMGGSLVSWAEQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV  G   SH   GWE+FTD+VI  +S   + +VF+LWG  A+KK+ ++D KRH +
Sbjct: 123 NAVLTVRAGTPNSHAAHGWEEFTDAVIQAVSARPEPVVFVLWGGYARKKKKLIDTKRHAI 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+AAHPSPLSAS GFFG R FS+ N  L   G+  ++W++P
Sbjct: 183 LEAAHPSPLSASQGFFGSRPFSRINEALVARGREPIDWRLP 223


>gi|33519990|ref|NP_878822.1| uracil-DNA glycosylase [Candidatus Blochmannia floridanus]
 gi|45477232|sp|Q7VRQ7|UNG_BLOFL RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|33504336|emb|CAD83229.1| uracil-DNA glycosylase [Candidatus Blochmannia floridanus]
          Length = 221

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ LL       + +N+   L  +K+ GK I+P+ +  F  F  T F  +KVVI+GQDP
Sbjct: 5   TWQLLLSQEKNLPYFKNIFTILNQQKKSGKIIYPKQNDIFNVFRFTAFESIKVVIIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH Y QAHGL FSVP GI +PPSL N+YKEL+ D+  FI P HG L  W  EGV LLN++
Sbjct: 65  YHGYNQAHGLAFSVPHGIPLPPSLKNIYKELETDIPGFIKPQHGCLSSWSKEGVFLLNSI 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G++ SH   GWE FTD VI  ++   QN+VF+LWG  AQ+K  ++++++H +L  
Sbjct: 125 LTVEQGKSRSHAHIGWELFTDKVIHTLNTYRQNLVFLLWGKHAQQKSHIINNQKHHILIT 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HPSP+SA +GF GC+HFSK N +L    +  +NWQ+
Sbjct: 185 SHPSPISAKYGFLGCKHFSKTNTFLANQNQHIINWQL 221


>gi|311110440|ref|ZP_07711837.1| uracil-DNA glycosylase [Lactobacillus gasseri MV-22]
 gi|311065594|gb|EFQ45934.1| uracil-DNA glycosylase [Lactobacillus gasseri MV-22]
          Length = 245

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+SE  + L +FL SE R  K+IFP   H F AF +T F   KVVILG
Sbjct: 19  IGNDWDEILAPAFESEQYQKLHDFLKSEYRT-KQIFPDMYHIFTAFKLTSFADTKVVILG 77

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  IP  HG+L+ W  +GVLLLN
Sbjct: 78  QDPYHNPGQATGMSFSVNPGVALPPSLKNIYKELYDDVGAIPVNHGYLKKWADQGVLLLN 137

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  H+G+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D ++++++
Sbjct: 138 AVLTVPYGNANGHQGKGWEIVTDAAIKALSDRGK-VVFILWGRFAQNKIPLIDEEKNVII 196

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 197 KSAHPSPFSADRGFFGSRPFSRCNDALTKFGESPIDWQLP 236


>gi|332300524|ref|YP_004442445.1| Uracil-DNA glycosylase [Porphyromonas asaccharolytica DSM 20707]
 gi|332177587|gb|AEE13277.1| Uracil-DNA glycosylase [Porphyromonas asaccharolytica DSM 20707]
          Length = 221

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 149/222 (67%), Gaps = 6/222 (2%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SW  +LE  F+  +   L  F+ SE +  KRI+P G   FRAFD+ PF  V+VVI
Sbjct: 3   VRIEPSWHRVLEEEFEKFYFETLTSFVRSEYQT-KRIYPPGGQIFRAFDLCPFEDVRVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTH---GFLEHWGHEG 120
           LGQDPYH  GQA GL FSVP G+ +PPSL N+  E+  D+    P+    G L  W  +G
Sbjct: 62  LGQDPYHGVGQAEGLAFSVPEGVEVPPSLRNILTEIASDLGH--PSQIVGGHLTPWCSQG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTV    A SH+GRGWE FTD VI L+S+  +++VFMLWG  A+ K+ ++D +
Sbjct: 120 VLLLNATLTVVAHEAGSHQGRGWETFTDQVISLLSSQREHLVFMLWGNYARCKRALIDRQ 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HL+L+A HPSPLSA  GFFGCRHFSKAN YLQ +G   + W
Sbjct: 180 KHLILEAPHPSPLSAHRGFFGCRHFSKANAYLQRYGYEPIRW 221


>gi|16803267|ref|NP_464752.1| uracil-DNA glycosylase [Listeria monocytogenes EGD-e]
 gi|224502478|ref|ZP_03670785.1| uracil-DNA glycosylase [Listeria monocytogenes FSL R2-561]
 gi|254828587|ref|ZP_05233274.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL N3-165]
 gi|254830019|ref|ZP_05234674.1| uracil-DNA glycosylase [Listeria monocytogenes 10403S]
 gi|255025805|ref|ZP_05297791.1| uracil-DNA glycosylase [Listeria monocytogenes FSL J2-003]
 gi|284801547|ref|YP_003413412.1| uracil-DNA glycosylase [Listeria monocytogenes 08-5578]
 gi|284994689|ref|YP_003416457.1| uracil-DNA glycosylase [Listeria monocytogenes 08-5923]
 gi|25009509|sp|Q8Y7P6|UNG2_LISMO RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|16410643|emb|CAC99305.1| lmo1227 [Listeria monocytogenes EGD-e]
 gi|258600985|gb|EEW14310.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL N3-165]
 gi|284057109|gb|ADB68050.1| uracil-DNA glycosylase [Listeria monocytogenes 08-5578]
 gi|284060156|gb|ADB71095.1| uracil-DNA glycosylase [Listeria monocytogenes 08-5923]
          Length = 224

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL+N F   +   L++FL  E +  K++FP     F A   T +  VKVVI
Sbjct: 2   IKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQT-KKVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG++A++K  +L + +H 
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHT 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIP 222


>gi|227529579|ref|ZP_03959628.1| uracil-DNA glycosylase [Lactobacillus vaginalis ATCC 49540]
 gi|227350502|gb|EEJ40793.1| uracil-DNA glycosylase [Lactobacillus vaginalis ATCC 49540]
          Length = 232

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W  +L+  F+S +   L  FL  E+   + I+P   H F AF+ TPF+KVKVVILG
Sbjct: 5   IHNDWWDVLKPQFESAYYAQLHNFL-KEEYSHRTIYPEMHHIFEAFEWTPFSKVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  GI +PPSL N+YKELQ DV   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHGPHQAHGCSFSVLPGIPVPPSLQNIYKELQSDVGCHPVQHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           +VLTV  G+A SH+G GWEQ TD+ I  +S   Q +VF+LWG +A+ K+ +++ K +++L
Sbjct: 124 SVLTVRAGQAFSHKGHGWEQLTDAAIHALSERPQPVVFILWGRAARDKKKLINLKTNIIL 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++AHPSPLSA+ GFFG + FSK N  L+  G+  ++WQ+P
Sbjct: 184 ESAHPSPLSANRGFFGSKPFSKTNEALRAMGEEPIDWQLP 223


>gi|291545126|emb|CBL18235.1| Uracil-DNA glycosylase [Ruminococcus sp. 18P13]
          Length = 222

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 146/222 (65%), Gaps = 2/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  LL++ F SE+ + L++FL+ E     R++P     F A   T +   + VI
Sbjct: 2   VHIGNDWDELLKDTFASENYQQLRQFLIREYST-HRVYPDMYDLFNALRYTSYADTRAVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIP-PTHGFLEHWGHEGVL 122
           LGQDPYH  GQAHGLCFSV  G+  PPSLVN++KEL++D+        G L  W   GVL
Sbjct: 61  LGQDPYHQPGQAHGLCFSVRPGVAPPPSLVNMFKELRDDLGIDNLGKGGTLIPWAKSGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG A SHRG+GWEQ TD +I L++   Q IVF+LWGA+A+ KQ ++   RH
Sbjct: 121 LLNTVLTVREGEANSHRGKGWEQVTDDIIRLLNAREQPIVFLLWGANARAKQALITAPRH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LVL  AHPSPLSA +GFFGCRHFSK N +L+  G   ++W+I
Sbjct: 181 LVLTCAHPSPLSAYNGFFGCRHFSKTNEFLRAQGMPEIDWRI 222


>gi|238853255|ref|ZP_04643640.1| uracil-DNA glycosylase [Lactobacillus gasseri 202-4]
 gi|282851480|ref|ZP_06260845.1| uracil-DNA glycosylase [Lactobacillus gasseri 224-1]
 gi|238834139|gb|EEQ26391.1| uracil-DNA glycosylase [Lactobacillus gasseri 202-4]
 gi|282557448|gb|EFB63045.1| uracil-DNA glycosylase [Lactobacillus gasseri 224-1]
          Length = 231

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+SE  + L +FL SE R  K+IFP   H F AF +T F   KVVILG
Sbjct: 5   IGNDWDEILAPAFESEQYQKLHDFLKSEYRT-KQIFPDMYHIFTAFKLTSFADTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  IP  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHNPGQATGMSFSVNPGVALPPSLKNIYKELYDDVGAIPVNHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  H+G+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D ++++++
Sbjct: 124 AVLTVPYGNANGHQGKGWEIVTDAAIKALSDRGK-VVFILWGRFAQNKIPLIDEEKNVII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 183 KSAHPSPFSADRGFFGSRPFSRCNDALTKFGESPIDWQLP 222


>gi|85375258|ref|YP_459320.1| uracil-DNA glycosylase [Erythrobacter litoralis HTCC2594]
 gi|84788341|gb|ABC64523.1| uracil-DNA glycosylase [Erythrobacter litoralis HTCC2594]
          Length = 228

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 145/223 (65%), Gaps = 3/223 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESWK  L+   ++   R L  +L +E+  GK I+P       A ++TP + VKVVILG
Sbjct: 5   VPESWKPALDPALETPEARQLGGWLRAEEEAGKTIYPPRGQRLSALELTPLDAVKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV  GI  PPSLVN++KEL+ D+    P+HG LE W  +GVLLLN
Sbjct: 65  QDPYHGPGQAHGLCFSVAQGIPPPPSLVNIFKELESDLGLPRPSHGCLEAWARQGVLLLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQ---DVLDHKRH 182
             LTVE  RA SH GRGW+  TD+ +  ++ + +   F+LWG+ AQKK      L   RH
Sbjct: 125 NSLTVEARRAGSHAGRGWDAITDAAVAAVAASDRPTAFVLWGSHAQKKAARIPGLTGGRH 184

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           LVLK+ HPSPLSA  GFFG R FS+ N +L+ HG+  ++W +P
Sbjct: 185 LVLKSPHPSPLSAHRGFFGSRPFSQVNAFLEAHGRGAIDWSLP 227


>gi|56965688|ref|YP_177422.1| uracil-DNA glycosylase [Bacillus clausii KSM-K16]
 gi|73920168|sp|Q5WAZ9|UNG_BACSK RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|56911934|dbj|BAD66461.1| uracil-DNA glycosylase [Bacillus clausii KSM-K16]
          Length = 232

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  ++   FQ  +   L+EFL  E ++ + ++P  +  F AF  TPF +VKVVILG
Sbjct: 4   LRNDWNDVIGGEFQKTYYLELREFLKREYKE-QTVYPHMNDLFNAFHYTPFEQVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV   + +PPSL N+YKELQ+D+   P  HG+L+ W  +GVLLLN
Sbjct: 63  QDPYHGPNQAHGLSFSVKPEVAVPPSLKNMYKELQDDLGVTPVDHGYLQPWADQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VL+V + +  SH+G+GWE FT+ VI  ++   + + F+LWG  AQ K++ +D  RHL++
Sbjct: 123 TVLSVRKRQPGSHKGKGWELFTNEVIHALNKREEPVAFVLWGRHAQAKKEAIDATRHLII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           ++AHPSP SA+ GFFG R FSK N +LQE GK  V+WQ+P+
Sbjct: 183 ESAHPSPFSANRGFFGSRPFSKINHWLQEQGKAPVDWQLPM 223


>gi|315641340|ref|ZP_07896416.1| uracil-DNA glycosylase [Enterococcus italicus DSM 15952]
 gi|315482913|gb|EFU73433.1| uracil-DNA glycosylase [Enterococcus italicus DSM 15952]
          Length = 224

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SW+ LL   FQ  +   L EFL  E ++ + I+P   H + A   TP+  VKVVILG
Sbjct: 5   IHNSWQKLLAEEFQKPYYLQLHEFLKKEYQE-QTIYPSMYHIYEALQRTPYETVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ IPPSL N+YKEL +D+    PT G L  W  +GVLLLN
Sbjct: 64  QDPYHGINQAHGLSFSVQKGVTIPPSLKNIYKELHDDIGCPIPTSGDLSEWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SH+G+GWEQ T+++I  ++   + ++F+LWG+ AQKK+  +D  +H+V+
Sbjct: 124 TVLTVRAGQANSHKGKGWEQLTNAIIQKLNQREEPVIFILWGSQAQKKKQQIDCSKHIVI 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           ++ HPSPLSA  GFFG R FSKAN  L   GK  ++W +
Sbjct: 184 ESVHPSPLSAYRGFFGSRPFSKANDALLALGKQPIDWSV 222


>gi|262274934|ref|ZP_06052745.1| uracil-DNA glycosylase [Grimontia hollisae CIP 101886]
 gi|262221497|gb|EEY72811.1| uracil-DNA glycosylase [Grimontia hollisae CIP 101886]
          Length = 225

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    + ++ +    ++   + +GK I+P     F AF  T  N+VKVVILGQDP
Sbjct: 6   TWHDVIGQEKEQDYFKYTMAYVAKAREEGKVIYPPKEDVFNAFRYTKLNEVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI  PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGINPPPSLVNIYKELAQDIEGFTIPQHGYLKSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI+ ++ +   +VF+LWG+ A+KK  V+D +RH VL+A
Sbjct: 126 LTVEQGNAHSHAHLGWETFTDRVIEAVNLHCDGVVFLLWGSHARKKGRVIDRQRHHVLEA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC+HFS  N+ L++ GKT +NWQ  L 
Sbjct: 186 PHPSPLSAHRGFLGCKHFSTTNQILRQAGKTPINWQPELD 225


>gi|292669502|ref|ZP_06602928.1| uracil-DNA glycosylase [Selenomonas noxia ATCC 43541]
 gi|292648865|gb|EFF66837.1| uracil-DNA glycosylase [Selenomonas noxia ATCC 43541]
          Length = 231

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 146/225 (64%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M        W+ LL +     + R L++FL+ E R  KRI+P     F A   T F   K
Sbjct: 1   MAKAIFKNDWQELLADEMAQPYYRELRQFLIVEYRT-KRIYPDMFAIFNALHYTSFADTK 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQAHGL FSV +G+  PPSL+N+Y+ELQ+D+   PP HG L  W  +G
Sbjct: 60  VVILGQDPYHGDGQAHGLSFSVQVGVEPPPSLLNIYRELQDDLGIAPPGHGCLIPWAQQG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV    AASH+G GWE+FTD +I L+    + + F+LWG+ A++K+ ++ + 
Sbjct: 120 VLLLNTVLTVRAHAAASHQGHGWERFTDHIIQLLGARERPLAFILWGSPARRKRSLITNP 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           RHL++++ HPSPLSA  GFFG R FS+ N +L   G+T + WQ+P
Sbjct: 180 RHLIVESPHPSPLSAHRGFFGSRPFSRVNSFLTAAGETPIEWQLP 224


>gi|298489945|ref|YP_003720122.1| uracil-DNA glycosylase ['Nostoc azollae' 0708]
 gi|298231863|gb|ADI62999.1| uracil-DNA glycosylase ['Nostoc azollae' 0708]
          Length = 226

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 152/225 (67%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M+ +++  SW+ +L       +   L++FL+ E R    I+P     F AF++TP+ +V 
Sbjct: 1   MKTLQMPGSWQQVLAEELVKPYFAKLQDFLIHE-RLSYTIYPPEKDIFSAFELTPYQQVN 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           V++LGQDPYHN  QAHGLCFSV  GI+ PPSLVN++KEL+ DV    P HG+L  W  +G
Sbjct: 60  VLLLGQDPYHNENQAHGLCFSVKPGIKPPPSLVNIFKELRADVGCDIPKHGYLSQWAKQG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           +L+LNAVLTV      SH+ +GWE FTD+VI+ ++     +VF+LWG  AQ+K  ++D  
Sbjct: 120 MLMLNAVLTVRAHTPNSHKNQGWETFTDAVINKVNERSDPVVFVLWGGYAQRKLKLIDVN 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           RHLV+++AHPSPLSA +GFFG + FS  N  L ++GK  ++WQ+P
Sbjct: 180 RHLVIQSAHPSPLSAHNGFFGSKPFSAINSALSDYGKPEIDWQLP 224


>gi|257453304|ref|ZP_05618603.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_5R]
 gi|317059836|ref|ZP_07924321.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_5R]
 gi|313685512|gb|EFS22347.1| uracil-DNA glycosylase [Fusobacterium sp. 3_1_5R]
          Length = 223

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 143/221 (64%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  +LE  FQ E+ +NL++ L+ E R  KRIFP     F A   T +   KVV+
Sbjct: 2   VHIGNDWDKVLEGEFQQEYYQNLRKILVREYR-SKRIFPPAEKIFNALKWTSYKDCKVVL 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSVP G RIPPSL N+YKELQ  +    P HG LE W  +GVLL
Sbjct: 61  LGQDPYHGLGQAHGLSFSVPKGQRIPPSLQNMYKELQNSLGLSIPHHGCLEKWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV EG+A+SH   GWE FTD VI  ++   + ++F+LWG  A+ K+  +D ++H 
Sbjct: 121 LNTSLTVVEGQASSHSKIGWEVFTDHVIQKLNEREEALIFILWGNHARSKKKWIDSRKHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+  HPSPLSA+ GFFGC HF + N  L+  GK  ++WQI
Sbjct: 181 ILEGVHPSPLSANRGFFGCGHFRQVNEILRTLGKEEIDWQI 221


>gi|53717347|ref|YP_105296.1| uracil-DNA glycosylase [Burkholderia mallei ATCC 23344]
 gi|52423317|gb|AAU46887.1| uracil-DNA glycosylase [Burkholderia mallei ATCC 23344]
          Length = 268

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+   +L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 43  DWRAIVEPFVASDAHASLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 100

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 101 YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 160

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 161 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 220

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 221 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 261


>gi|257467033|ref|ZP_05631344.1| uracil-DNA glycosylase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918170|ref|ZP_07914410.1| uracil-DNA glycosylase [Fusobacterium gonidiaformans ATCC 25563]
 gi|313692045|gb|EFS28880.1| uracil-DNA glycosylase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 223

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 143/221 (64%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  +LE  FQ E+ +NL++ L+ E R  KRIFP     F A   T +   KVV+
Sbjct: 2   VHIGNDWDKVLEGEFQQEYYQNLRKILVREYR-SKRIFPPAEKIFNALKWTSYKDCKVVL 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSVP G RIPPSL N+YKELQ  +    P HG LE W  +GVLL
Sbjct: 61  LGQDPYHGLGQAHGLSFSVPKGQRIPPSLQNMYKELQNSLGLSIPHHGCLEKWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV EG+A+SH   GWE FTD VI  ++   + ++F+LWG  A+ K+  +D ++H 
Sbjct: 121 LNTSLTVVEGQASSHSKIGWEIFTDHVIQKLNEREEALIFILWGNHARSKKKWIDSRKHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+  HPSPLSA+ GFFGC HF + N  L+  GK  ++WQI
Sbjct: 181 ILEGVHPSPLSANRGFFGCGHFRQVNEILRTLGKEEIDWQI 221


>gi|302533206|ref|ZP_07285548.1| uracil-DNA glycosylase [Streptomyces sp. C]
 gi|302442101|gb|EFL13917.1| uracil-DNA glycosylase [Streptomyces sp. C]
          Length = 225

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW  +L       + R L EF+  E+  G  ++P     F A + TPF+KVKV++LG
Sbjct: 5   LPESWLPVLGGELDQPYFRELTEFVEKERANGP-VYPPREQVFAALEATPFDKVKVLVLG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE++E++    P +G+L  W  +GVLLLN
Sbjct: 64  QDPYHGAGQGHGLCFSVQPGVKTPPSLRNIYKEMKEELGLPVPDNGYLMPWAEQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV E    SH+G+GWE+FTD+VI  +S     +VF+LWGA AQKK  ++D +RH+++
Sbjct: 124 AVLTVREAEPNSHKGKGWEKFTDAVIRAVSERPDPVVFVLWGAYAQKKIPLIDGERHVIV 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 184 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHEPIDWRIP 222


>gi|126173209|ref|YP_001049358.1| uracil-DNA glycosylase [Shewanella baltica OS155]
 gi|125996414|gb|ABN60489.1| Uracil-DNA glycosylase [Shewanella baltica OS155]
          Length = 221

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 147/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ ++      + + L  F+ +E+R GK ++P  +  F AF +TP  KVKVV++GQDP
Sbjct: 5   TWQTFIDGQRALPYFQQLSAFVDNERRAGKVVYPPEADVFNAFTMTPLEKVKVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSL N+YKEL  D++ F  P+HG L  W  +G+L+LN V
Sbjct: 65  YHGPDQAHGLCFSVKRGIKPPPSLANMYKELATDIDGFTIPSHGDLSAWAEQGILMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FT +V++L++   Q I+F+LWG+ A KK  V++  +H VL  
Sbjct: 125 LTVEQGKAHSHAKAGWEVFTTAVLELLNRQTQPIIFVLWGSHAIKKGQVINAPQHQVLTG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS+ N+ L E G+  + WQ+
Sbjct: 185 PHPSPLSAYRGFFGCGHFSQVNQLLLERGEAPIRWQV 221


>gi|323967624|gb|EGB63037.1| uracil-DNA glycosylase [Escherichia coli M863]
 gi|327252290|gb|EGE63962.1| uracil-DNA glycosylase [Escherichia coli STEC_7v]
          Length = 229

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPDHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|261494008|ref|ZP_05990513.1| uracil-DNA glycosylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261310333|gb|EEY11531.1| uracil-DNA glycosylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 239

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 145/220 (65%), Gaps = 1/220 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + +  ++ +E+  GK I+P  +  F AF +T F+ VKVVILGQD
Sbjct: 12  KTWTEALGEEKQKAYFQQILHYVHNERLAGKVIYPPQNEVFSAFALTEFSDVKVVILGQD 71

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   +  PPSLVN+YKEL ED+  F  P HG+L  W  +GV +LN 
Sbjct: 72  PYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELSEDIEGFQIPPHGYLIDWAKQGVFMLNT 131

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTVE+GRA SH   GWE FTD VI  ++ +  N+VF+LWG+ AQ+K   +D  RH VL 
Sbjct: 132 SLTVEQGRAGSHSQIGWEIFTDKVIAQLNQHRDNLVFLLWGSHAQRKGQFIDRNRHCVLA 191

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           + HPSPLSA  GFFGC+HFSKAN YL   G + +NWQ+P+
Sbjct: 192 SPHPSPLSAYRGFFGCKHFSKANNYLISQGISPINWQLPV 231


>gi|119952856|ref|YP_945065.1| uracil-DNA glycosylase [Borrelia turicatae 91E135]
 gi|254790571|sp|A1QYK3|UNG_BORT9 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|119861627|gb|AAX17395.1| uracil-DNA glycosylase [Borrelia turicatae 91E135]
          Length = 223

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L+  F   + + L  F+ +E K K  +IFP     F AFD  PF  +K+V
Sbjct: 3   VKIEESWKEMLKGEFCKSYFKRLVNFIKNEYKTKKDKIFPSPKLIFNAFDSLPFKDIKIV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH  GQA+GL FSV   I+IPPSL N++KE++  +      +G L  W  +GV 
Sbjct: 63  ILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERSLKIKTIPNGDLTRWATQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN++LTVEEGR +SH+  GWE FT+ VI +IS N  N+VFMLWG  A+ K++++D  +H
Sbjct: 123 LLNSILTVEEGRPSSHKDIGWEIFTNEVIKIISKNLNNVVFMLWGNFARGKKELIDASKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA +GF G  HFS+  +YL+EH K ++++Q
Sbjct: 183 LILETSHPSPYSAHNGFLGSNHFSQTLKYLKEHNKISIDFQ 223


>gi|83719304|ref|YP_443421.1| uracil-DNA glycosylase [Burkholderia thailandensis E264]
 gi|83653129|gb|ABC37192.1| uracil-DNA glycosylase [Burkholderia thailandensis E264]
          Length = 271

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+++LE    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 46  DWRAILEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 103

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 104 YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYEAPRHGCLDTWASQGVLLL 163

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 164 NTVLTVERSSAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDPREHCV 223

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 224 LEAPHPSPLSAHRGFLGCRHFALANDYLVKHGRAPIDWRLP 264


>gi|240851497|ref|ZP_04752248.1| uracil-DNA glycosylase [Actinobacillus minor 202]
 gi|240310015|gb|EER48307.1| uracil-DNA glycosylase [Actinobacillus minor 202]
          Length = 223

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 1/221 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++WK  L       + +++ + +  E+  GK ++P  +  F AF +T F  VKVVILGQD
Sbjct: 2   KTWKEALGEEKLQPYFQHILQQVHHERMSGKIVYPPQNEVFSAFSLTEFCDVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQED-VNFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   +  PPSLVN+YKEL +D V F  P HG+L  W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLAFSVKPPVAPPPSLVNIYKELSQDIVGFQIPQHGYLIDWAKQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTV++G A SH   GWE FTD VI  ++   +NIVF+LWG+ AQKK   +D KRH VL 
Sbjct: 122 VLTVQQGMAHSHAKFGWETFTDKVIAQLNEYRENIVFLLWGSHAQKKGQFIDRKRHCVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           A HPSPLSA  GFFGC+HFSKAN YLQ     T+NW +P++
Sbjct: 182 APHPSPLSAHRGFFGCKHFSKANDYLQMKNIKTINWSLPIN 222


>gi|4699671|pdb|2UUG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex
           With H187d Mutant Udg And Wild-Type Ugi
 gi|4699672|pdb|2UUG|B Chain B, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex
           With H187d Mutant Udg And Wild-Type Ugi
          Length = 229

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
             PSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PDPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|322514237|ref|ZP_08067298.1| uracil-DNA glycosylase [Actinobacillus ureae ATCC 25976]
 gi|322119849|gb|EFX91863.1| uracil-DNA glycosylase [Actinobacillus ureae ATCC 25976]
          Length = 223

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 143/220 (65%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L    Q  + + + + +  E+  G  +FP     F AF +T F  VKVVILGQDP
Sbjct: 3   NWTEALGEEKQQAYFQQILQQVHQERMDGVTVFPPQKEVFSAFTLTEFKDVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV   +  PPSLVN+YKEL +D+  F  P HG+L  W  +GVLLLN V
Sbjct: 63  YHGPNQAHGLAFSVKPPVAPPPSLVNMYKELAQDIEGFQIPNHGYLVDWAKQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV +G+A SH   GWE FTD VI  ++ + +N+VF+LWG+ AQKK   +D  RH VL A
Sbjct: 123 LTVRQGQAHSHANFGWEIFTDKVIAQLNQHRENLVFLLWGSHAQKKGQFIDRSRHCVLTA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GCRHFSKAN YL+E G   +NWQ+P++
Sbjct: 183 PHPSPLSAHRGFLGCRHFSKANAYLKEKGIQEINWQLPMN 222


>gi|52424428|ref|YP_087565.1| uracil-DNA glycosylase [Mannheimia succiniciproducens MBEL55E]
 gi|81691483|sp|Q65VN0|UNG_MANSM RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|52306480|gb|AAU36980.1| Ung protein [Mannheimia succiniciproducens MBEL55E]
          Length = 224

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++WK ++       + +++ + + + +  GK I+P     F AF +T F++VKVVILGQD
Sbjct: 2   QTWKDVIGTEKTQPYFQHILQQVHAARDAGKTIYPPQHDVFNAFKLTEFDQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  GI  PPSL+N+YKEL+ D+  F  P HG+L  W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLAFSVLPGIVPPPSLLNIYKELENDIAGFQIPRHGYLVKWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE G A SH   GWE FTD VI  ++ + +N+VF+LWG+ AQKK   +D  RH VL 
Sbjct: 122 VLTVERGLAHSHANFGWETFTDRVIAALNRHRENLVFLLWGSHAQKKGQFIDRDRHCVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GF GC HFSKAN YLQEH  T ++WQ+
Sbjct: 182 APHPSPLSAHRGFLGCHHFSKANNYLQEHKITEIDWQL 219


>gi|323978390|gb|EGB73475.1| uracil-DNA glycosylase [Escherichia coli TW10509]
          Length = 229

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + L SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTLASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|296327808|ref|ZP_06870346.1| uracil-DNA glycosylase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|296155064|gb|EFG95843.1| uracil-DNA glycosylase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 226

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE  L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFEKEYFVKLKE-TLEEEYKNYTVYPPKRDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKELQ+D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQRGQAHGLAFSVNYGIKTPPSLVNMYKELQDDLGLYIPNNGFLEKWSKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD+VI  ++   + ++F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSEANSHSKIGWQTFTDNVIKSLNEREKPVIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANKGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|225552333|ref|ZP_03773273.1| uracil-DNA glycosylase [Borrelia sp. SV1]
 gi|225371331|gb|EEH00761.1| uracil-DNA glycosylase [Borrelia sp. SV1]
          Length = 223

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L  F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVRFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSKIKIPPSLQNIFKEIEKSLKIKTIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKGLIDPTKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K T+++Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSSALDYLKKHNKNTIDFQ 223


>gi|331002183|ref|ZP_08325702.1| uracil-DNA glycosylase [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411277|gb|EGG90693.1| uracil-DNA glycosylase [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 225

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 148/216 (68%), Gaps = 2/216 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           WK +L   F+  + R+L EF+  E  K   I+P     F A  +T  + +KVVILGQDPY
Sbjct: 8   WKEVLSGEFKKAYYRSLYEFVKEEYGK-YTIYPPADKIFEALHLTALSDIKVVILGQDPY 66

Query: 70  HNYGQAHGLCFSVPLG-IRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           H   QAHGL FSVP    RIPPSLVN+YKELQ+DV    P +G L  W ++GV LLN +L
Sbjct: 67  HGDNQAHGLSFSVPPSQKRIPPSLVNIYKELQDDVGTYIPNNGNLLKWTNQGVFLLNTIL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV   +A SH+G+GWE FTD++I +I++  + IVFMLWG++A  K  +L++ +HLVLK  
Sbjct: 127 TVRAHKAFSHQGKGWENFTDAIIKIINDTDRPIVFMLWGSAAISKSKMLNNPKHLVLKTV 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGC+HFSKAN +L ++  + ++WQI
Sbjct: 187 HPSPLSAYRGFFGCKHFSKANEFLIKNNISPIDWQI 222


>gi|15594399|ref|NP_212187.1| uracil-DNA glycosylase [Borrelia burgdorferi B31]
 gi|195941792|ref|ZP_03087174.1| uracil-DNA glycosylase [Borrelia burgdorferi 80a]
 gi|216264642|ref|ZP_03436634.1| uracil-DNA glycosylase [Borrelia burgdorferi 156a]
 gi|218249579|ref|YP_002374584.1| uracil-DNA glycosylase [Borrelia burgdorferi ZS7]
 gi|221217436|ref|ZP_03588907.1| uracil-DNA glycosylase [Borrelia burgdorferi 72a]
 gi|223889149|ref|ZP_03623738.1| uracil-DNA glycosylase [Borrelia burgdorferi 64b]
 gi|224533026|ref|ZP_03673632.1| uracil-DNA glycosylase [Borrelia burgdorferi WI91-23]
 gi|224533900|ref|ZP_03674485.1| uracil-DNA glycosylase [Borrelia burgdorferi CA-11.2a]
 gi|225549677|ref|ZP_03770642.1| uracil-DNA glycosylase [Borrelia burgdorferi 118a]
 gi|226320775|ref|ZP_03796331.1| uracil-DNA glycosylase [Borrelia burgdorferi 29805]
 gi|226322035|ref|ZP_03797560.1| uracil-DNA glycosylase [Borrelia burgdorferi Bol26]
 gi|3334401|sp|O51082|UNG_BORBU RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|226725938|sp|B7J0Y9|UNG_BORBZ RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|2687922|gb|AAC66430.1| uracil DNA glycosylase (ung) [Borrelia burgdorferi B31]
 gi|215981115|gb|EEC21922.1| uracil-DNA glycosylase [Borrelia burgdorferi 156a]
 gi|218164767|gb|ACK74828.1| uracil-DNA glycosylase [Borrelia burgdorferi ZS7]
 gi|221192714|gb|EEE18930.1| uracil-DNA glycosylase [Borrelia burgdorferi 72a]
 gi|223885398|gb|EEF56499.1| uracil-DNA glycosylase [Borrelia burgdorferi 64b]
 gi|224512020|gb|EEF82415.1| uracil-DNA glycosylase [Borrelia burgdorferi WI91-23]
 gi|224512903|gb|EEF83269.1| uracil-DNA glycosylase [Borrelia burgdorferi CA-11.2a]
 gi|225369637|gb|EEG99085.1| uracil-DNA glycosylase [Borrelia burgdorferi 118a]
 gi|226232625|gb|EEH31379.1| uracil-DNA glycosylase [Borrelia burgdorferi Bol26]
 gi|226233830|gb|EEH32555.1| uracil-DNA glycosylase [Borrelia burgdorferi 29805]
 gi|312148501|gb|ADQ31160.1| uracil-DNA glycosylase [Borrelia burgdorferi JD1]
 gi|312149033|gb|ADQ29104.1| uracil-DNA glycosylase [Borrelia burgdorferi N40]
          Length = 223

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSKIKIPPSLQNIFKEIEKSLKIKTIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKGLIDPTKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSSALDYLKKHNKNIINFQ 223


>gi|260913778|ref|ZP_05920254.1| uracil-DNA glycosylase [Pasteurella dagmatis ATCC 43325]
 gi|260632317|gb|EEX50492.1| uracil-DNA glycosylase [Pasteurella dagmatis ATCC 43325]
          Length = 222

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++WK ++    +  + +++ E +   +  G  ++P  S  F AF +T F +VKVVILGQD
Sbjct: 2   KTWKDVIGIEKEQPYFKHILEQIHQARSSGIVVYPPASEVFSAFQLTEFYQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV  GI+ PPSL+N+YKEL +D+  F  P HG+L  W  +GVL+LN 
Sbjct: 62  PYHGANQAHGLAFSVKPGIQPPPSLMNMYKELTQDIEGFQIPNHGYLVPWAEQGVLMLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH   GWE FTD VI  ++   + IVF+LWG+ AQKK   +D  +H VL 
Sbjct: 122 VLTVEQGKAHSHANFGWEIFTDKVIAALNEQREKIVFLLWGSHAQKKGQFIDRNKHFVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GF GCRHFSKAN+YL E G + + WQ+
Sbjct: 182 APHPSPLSAHRGFLGCRHFSKANQYLVEQGLSPIQWQL 219


>gi|167920650|ref|ZP_02507741.1| uracil-DNA glycosylase [Burkholderia pseudomallei BCC215]
          Length = 262

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|260583623|ref|ZP_05851371.1| uracil-DNA glycosylase [Granulicatella elegans ATCC 700633]
 gi|260158249|gb|EEW93317.1| uracil-DNA glycosylase [Granulicatella elegans ATCC 700633]
          Length = 218

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 106/214 (49%), Positives = 145/214 (67%), Gaps = 1/214 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q ++ + L+ F+  ++R   R+FP   + F A ++TPF  VKVVILGQDP
Sbjct: 4   TWNEILAEEMQKDYYQELQAFV-QKRRAEVRVFPEEKNVFNALELTPFESVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH +GQAHGL FSV  GI +PPSL N+YKELQED+    PT G L HW  +GVLLLN VL
Sbjct: 63  YHGFGQAHGLSFSVKKGIPLPPSLRNIYKELQEDIGGNLPTEGDLSHWAKQGVLLLNTVL 122

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TVEEG A SH+G GWE+ T+ +I+ ++     ++F+LWG  AQ K+ ++ +  H++LKA 
Sbjct: 123 TVEEGNANSHKGMGWERLTNRLIESLNELPHPVIFILWGKPAQDKEKLITNSNHVILKAP 182

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           HPSPLSA  GFFG + FS+ N  L + G+T + W
Sbjct: 183 HPSPLSAYRGFFGSKPFSRVNDVLIQQGQTPIRW 216


>gi|126440208|ref|YP_001060566.1| uracil-DNA glycosylase [Burkholderia pseudomallei 668]
 gi|126453114|ref|YP_001067819.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106a]
 gi|134283343|ref|ZP_01770044.1| uracil-DNA glycosylase [Burkholderia pseudomallei 305]
 gi|167721375|ref|ZP_02404611.1| uracil-DNA glycosylase [Burkholderia pseudomallei DM98]
 gi|167847448|ref|ZP_02472956.1| uracil-DNA glycosylase [Burkholderia pseudomallei B7210]
 gi|167896036|ref|ZP_02483438.1| uracil-DNA glycosylase [Burkholderia pseudomallei 7894]
 gi|167904422|ref|ZP_02491627.1| uracil-DNA glycosylase [Burkholderia pseudomallei NCTC 13177]
 gi|217424729|ref|ZP_03456226.1| uracil-DNA glycosylase [Burkholderia pseudomallei 576]
 gi|242314911|ref|ZP_04813927.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106b]
 gi|254180515|ref|ZP_04887113.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1655]
 gi|254198574|ref|ZP_04904995.1| uracil-DNA glycosylase [Burkholderia pseudomallei S13]
 gi|126219701|gb|ABN83207.1| uracil-DNA glycosylase [Burkholderia pseudomallei 668]
 gi|126226756|gb|ABN90296.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106a]
 gi|134245538|gb|EBA45631.1| uracil-DNA glycosylase [Burkholderia pseudomallei 305]
 gi|169655314|gb|EDS88007.1| uracil-DNA glycosylase [Burkholderia pseudomallei S13]
 gi|184211054|gb|EDU08097.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1655]
 gi|217392185|gb|EEC32210.1| uracil-DNA glycosylase [Burkholderia pseudomallei 576]
 gi|242138150|gb|EES24552.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106b]
          Length = 262

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|167740344|ref|ZP_02413118.1| uracil-DNA glycosylase [Burkholderia pseudomallei 14]
 gi|167817561|ref|ZP_02449241.1| uracil-DNA glycosylase [Burkholderia pseudomallei 91]
 gi|167825963|ref|ZP_02457434.1| uracil-DNA glycosylase [Burkholderia pseudomallei 9]
 gi|167912684|ref|ZP_02499775.1| uracil-DNA glycosylase [Burkholderia pseudomallei 112]
 gi|226192988|ref|ZP_03788599.1| uracil-DNA glycosylase [Burkholderia pseudomallei Pakistan 9]
 gi|254300750|ref|ZP_04968195.1| uracil-DNA glycosylase [Burkholderia pseudomallei 406e]
 gi|157810502|gb|EDO87672.1| uracil-DNA glycosylase [Burkholderia pseudomallei 406e]
 gi|225934958|gb|EEH30934.1| uracil-DNA glycosylase [Burkholderia pseudomallei Pakistan 9]
          Length = 262

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|294501919|ref|YP_003565619.1| uracil-DNA glycosylase [Bacillus megaterium QM B1551]
 gi|294351856|gb|ADE72185.1| uracil-DNA glycosylase [Bacillus megaterium QM B1551]
          Length = 224

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 147/216 (68%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W  LLE  FQ ++   L+EFL+ E      I+P     F A   T +  VKVVILGQDP
Sbjct: 7   DWALLLEEEFQKDYYIQLREFLVDEYNH-HTIYPDKYDIFNALHYTDYKNVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH   QAHGL FSV  G++ PPSLVN+YKEL+ ++++  P +G+L  W  +GVLLLN VL
Sbjct: 66  YHGPNQAHGLSFSVQPGVKTPPSLVNIYKELKNEMDYHIPNNGYLVKWAEQGVLLLNTVL 125

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV  G A SH+G+GWEQ TD +I+L++   + +VF+LWG  AQ K++++ H  HL+L++ 
Sbjct: 126 TVRRGEANSHKGKGWEQLTDRIIELVAQKEEPVVFLLWGKHAQAKKELIHHSHHLILESP 185

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSP SA+ GFFG  HF +AN +L ++G+ +++WQI
Sbjct: 186 HPSPFSANRGFFGNNHFQRANEFLLQYGRQSIDWQI 221


>gi|283832028|ref|ZP_06351769.1| uracil-DNA glycosylase [Citrobacter youngae ATCC 29220]
 gi|291071646|gb|EFE09755.1| uracil-DNA glycosylase [Citrobacter youngae ATCC 29220]
          Length = 229

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + +  E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFVNTLQTVAGERQSGMTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  PTHG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELETTIPGFTRPTHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D KRH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDAKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN +L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANEWLEKRGEKPIDW 220


>gi|237813951|ref|YP_002898402.1| uracil-DNA glycosylase [Burkholderia pseudomallei MSHR346]
 gi|237504045|gb|ACQ96363.1| uracil-DNA glycosylase [Burkholderia pseudomallei MSHR346]
          Length = 262

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 255


>gi|67640246|ref|ZP_00439060.1| uracil-DNA glycosylase [Burkholderia mallei GB8 horse 4]
 gi|121597701|ref|YP_990255.1| uracil-DNA glycosylase [Burkholderia mallei SAVP1]
 gi|124381474|ref|YP_001024754.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10229]
 gi|126446651|ref|YP_001079092.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10247]
 gi|167003489|ref|ZP_02269275.1| uracil-DNA glycosylase [Burkholderia mallei PRL-20]
 gi|254175797|ref|ZP_04882456.1| uracil-DNA glycosylase [Burkholderia mallei ATCC 10399]
 gi|254203263|ref|ZP_04909625.1| uracil-DNA glycosylase [Burkholderia mallei FMH]
 gi|254208599|ref|ZP_04914948.1| uracil-DNA glycosylase [Burkholderia mallei JHU]
 gi|254355766|ref|ZP_04972045.1| uracil-DNA glycosylase [Burkholderia mallei 2002721280]
 gi|121225499|gb|ABM49030.1| uracil-DNA glycosylase [Burkholderia mallei SAVP1]
 gi|124289494|gb|ABM98763.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10229]
 gi|126239505|gb|ABO02617.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10247]
 gi|147746308|gb|EDK53386.1| uracil-DNA glycosylase [Burkholderia mallei FMH]
 gi|147751286|gb|EDK58354.1| uracil-DNA glycosylase [Burkholderia mallei JHU]
 gi|148024737|gb|EDK82920.1| uracil-DNA glycosylase [Burkholderia mallei 2002721280]
 gi|160696840|gb|EDP86810.1| uracil-DNA glycosylase [Burkholderia mallei ATCC 10399]
 gi|238520938|gb|EEP84394.1| uracil-DNA glycosylase [Burkholderia mallei GB8 horse 4]
 gi|243061003|gb|EES43189.1| uracil-DNA glycosylase [Burkholderia mallei PRL-20]
          Length = 259

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 148/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+   +L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 34  DWRAIVEPFVASDAHASLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 91

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 92  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 151

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 152 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 211

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 212 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 252


>gi|262404682|ref|ZP_06081237.1| uracil-DNA glycosylase [Vibrio sp. RC586]
 gi|262349714|gb|EEY98852.1| uracil-DNA glycosylase [Vibrio sp. RC586]
          Length = 226

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 143/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    Q ++ +   +F+ S+++ GK I+P     F AF  T F  V VVILGQDP
Sbjct: 6   TWHDVIGKEKQQDYFQQTMQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVNVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPQHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   +VF+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRSGLVFLLWGSHAQKKGRMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+ N+ L       ++WQ
Sbjct: 186 PHPSPLSAHRGFLGCQHFSQTNQLLSNQCLKPIDWQ 221


>gi|15616412|ref|NP_244717.1| uracil-DNA glycosylase [Bacillus halodurans C-125]
 gi|18203157|sp|Q9K682|UNG_BACHD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|10176475|dbj|BAB07569.1| uracil-DNA glycosylase [Bacillus halodurans C-125]
          Length = 224

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 146/220 (66%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +H  W  +LE  FQ  +   L+EFL  ++   + I+P     F A   TP  + KVVILG
Sbjct: 4   LHNDWADVLEAEFQKPYYVQLREFL-KQEYSTQTIYPSMYDIFNALHYTPLAEAKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ +PPSL N++KEL+ED+    P +G L  W  +GVLLLN
Sbjct: 63  QDPYHGPNQAHGLSFSVKPGVPLPPSLQNIFKELREDLGCPIPNNGHLTPWAEQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV +G+AASHRG+GWE FTD VI  ++   + ++F+LWG  AQ+KQ ++ + RH +L
Sbjct: 123 TVLTVRKGQAASHRGKGWESFTDRVITCLNEREKPVIFVLWGRHAQEKQALITNDRHYIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            A HPSP SA+ GFFG R FS  NR LQE G++ ++W+IP
Sbjct: 183 TAPHPSPFSANRGFFGSRPFSTINRILQEQGESQIHWEIP 222


>gi|53720664|ref|YP_109650.1| uracil-DNA glycosylase [Burkholderia pseudomallei K96243]
 gi|52211078|emb|CAH37066.1| uracil-DNA glycosylase [Burkholderia pseudomallei K96243]
          Length = 245

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W++++E    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 20  DWRAIVEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 77

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 78  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 137

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 138 NTVLTVERAAAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDAREHCV 197

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 198 LEAPHPSPLSAHRGFLGCRHFALANDYLVQHGRAPIDWRLP 238


>gi|237742228|ref|ZP_04572709.1| uracil-DNA glycosylase [Fusobacterium sp. 4_1_13]
 gi|229429876|gb|EEO40088.1| uracil-DNA glycosylase [Fusobacterium sp. 4_1_13]
          Length = 226

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE  L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFEKEYFVKLKE-TLEEEYKNYTVYPPKRDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV  GI+ PPSLVN+YKEL +D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQKGQAHGLAFSVNYGIKTPPSLVNMYKELHDDLGLYIPNNGFLEKWAKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV + +A SH G GW+ FTD+VI  ++   + I+F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSQANSHSGLGWQTFTDNVIKSLNEREKPIIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ NR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANRGFFGCKHFSEVNRILKNLGEKEIDWQI 221


>gi|293410996|ref|ZP_06654572.1| uracil-DNA glycosylase [Escherichia coli B354]
 gi|291471464|gb|EFF13948.1| uracil-DNA glycosylase [Escherichia coli B354]
          Length = 229

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + +E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVANERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|320176114|gb|EFW51181.1| Uracil-DNA glycosylase, family 1 [Shigella dysenteriae CDC 74-1112]
          Length = 229

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPRQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDW 220


>gi|315224044|ref|ZP_07865885.1| uracil-DNA glycosylase [Capnocytophaga ochracea F0287]
 gi|314946015|gb|EFS98023.1| uracil-DNA glycosylase [Capnocytophaga ochracea F0287]
          Length = 221

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V IH SWK +L+  F   +   L +F+  E  +    +P+G   F AFD  P ++VKVVI
Sbjct: 3   VNIHPSWKQVLQEEFNKPYFNQLTDFVKKEYAE-NICYPKGKQIFSAFDHCPLDRVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  GI  PPSL+N+++E+ +D+    P  G LE W  +GVLL
Sbjct: 62  IGQDPYHGEGQANGLCFSVHDGIAHPPSLINIFREIGQDLGTSYPISGNLERWASQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV    A SH+ +GWE FTD+VI  +S +  NIVFMLWG  A+KK  ++D  +H 
Sbjct: 122 LNATLTVRANEAGSHQNKGWETFTDAVIKAVSAHCNNIVFMLWGGYAKKKTSLIDPAKHC 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG +HFSKAN YL   GK  +NW
Sbjct: 182 ILTSGHPSPLSANKGYWFGNKHFSKANAYLTSVGKEAINW 221


>gi|223982900|ref|ZP_03633116.1| hypothetical protein HOLDEFILI_00390 [Holdemania filiformis DSM
           12042]
 gi|223965143|gb|EEF69439.1| hypothetical protein HOLDEFILI_00390 [Holdemania filiformis DSM
           12042]
          Length = 221

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 149/215 (69%), Gaps = 1/215 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W   L+  FQ  + + L  FL  ++    +++P     F AF+ T ++ VKVVILGQDPY
Sbjct: 6   WTPFLKEEFQKPYFQQLSAFL-RQQYATTKVYPPRLQVFSAFEFTNYSDVKVVILGQDPY 64

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H   QAHG+CFSV  G+++PPSLVN+YKEL +D+    P HG+L  W  +GV L+N VLT
Sbjct: 65  HQPNQAHGMCFSVRKGVKVPPSLVNIYKELHDDLGCTIPHHGYLMKWAQQGVFLMNTVLT 124

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           VE+ +  SHRG+GWE+FTD V+  ++++   +VF+LWG +AQ K   + + +HL+LK+ H
Sbjct: 125 VEDSKPLSHRGKGWEEFTDEVMRRLNDHPDPLVFILWGRNAQDKGRWITNPKHLILKSPH 184

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           PSPLSAS+GFFG   FSKAN++L + G+T ++WQI
Sbjct: 185 PSPLSASYGFFGTHPFSKANQFLIDQGRTPIDWQI 219


>gi|156932879|ref|YP_001436795.1| uracil-DNA glycosylase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531133|gb|ABU75959.1| hypothetical protein ESA_00680 [Cronobacter sakazakii ATCC BAA-894]
          Length = 253

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  +  + + +   + +E+  G  I+P     F AF  T    VKVVILGQDP
Sbjct: 30  TWHDVLADEKEKPYFKKILTTVAAEREAGVTIYPPQKEVFNAFRFTELGDVKVVILGQDP 89

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+  PPSLVN+YKEL++ V  F  P+HG+LE W  +GV+LLN V
Sbjct: 90  YHGPGQAHGLAFSVRPGVAPPPSLVNMYKELEQSVPGFTRPSHGYLESWARQGVMLLNTV 149

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV+ G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D  RH VL+A
Sbjct: 150 LTVQAGKAHSHANLGWETFTDKVISLINEHREGVVFLLWGSHAQKKGAIIDRNRHHVLQA 209

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF K N+YL+  G+  ++W
Sbjct: 210 PHPSPLSAHRGFFGCGHFVKTNQYLESRGEAPIDW 244


>gi|167582466|ref|ZP_02375340.1| uracil-DNA glycosylase [Burkholderia thailandensis TXDOH]
          Length = 262

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+++LE    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAILEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYEAPRHGCLDTWASQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERSSAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDPREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVKHGRAPIDWRLP 255


>gi|167620558|ref|ZP_02389189.1| uracil-DNA glycosylase [Burkholderia thailandensis Bt4]
 gi|257137801|ref|ZP_05586063.1| uracil-DNA glycosylase [Burkholderia thailandensis E264]
          Length = 262

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 147/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+++LE    S+    L  F+  E+  GK I+P  +  FRA  +T  + VKVVILGQDP
Sbjct: 37  DWRAILEPFVASDAYAPLCRFVDGERAAGKAIYP--ADVFRALRLTHPDDVKVVILGQDP 94

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP G+R PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 95  YHGEDRGIPQAHGLAFSVPPGVRPPPSLRNIFKEISADFGYEAPRHGCLDTWASQGVLLL 154

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D + H V
Sbjct: 155 NTVLTVERSSAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDPREHCV 214

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL +HG+  ++W++P
Sbjct: 215 LEAPHPSPLSAHRGFLGCRHFALANDYLVKHGRAPIDWRLP 255


>gi|47095069|ref|ZP_00232682.1| uracil-DNA glycosylase [Listeria monocytogenes str. 1/2a F6854]
 gi|254898612|ref|ZP_05258536.1| uracil-DNA glycosylase [Listeria monocytogenes J0161]
 gi|254911899|ref|ZP_05261911.1| uracil-DNA glycosylase [Listeria monocytogenes J2818]
 gi|254936224|ref|ZP_05267921.1| uracil-DNA glycosylase [Listeria monocytogenes F6900]
 gi|47016687|gb|EAL07607.1| uracil-DNA glycosylase [Listeria monocytogenes str. 1/2a F6854]
 gi|258608814|gb|EEW21422.1| uracil-DNA glycosylase [Listeria monocytogenes F6900]
 gi|293589857|gb|EFF98191.1| uracil-DNA glycosylase [Listeria monocytogenes J2818]
          Length = 224

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL+N F   +   L++FL  E +  K++FP     F A   T +  VKVVI
Sbjct: 2   IKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQT-KKVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG++A++K  +L + +H 
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHT 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFTGCKHFSKTNQFLEQNGVKPIDWQIP 222


>gi|324113106|gb|EGC07082.1| uracil-DNA glycosylase [Escherichia fergusonii B253]
          Length = 229

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPDHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|159532487|gb|ABW97852.1| uracil-DNA glycosylase [Psychrobacter sp. HJ147]
          Length = 244

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/226 (46%), Positives = 151/226 (66%), Gaps = 2/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           ++ V++ E WK+ L +   S +M +L+ FL    +    I+P     F A ++TP +++K
Sbjct: 19  LDNVRLPEDWKTALADELTSNNMDDLRAFLKEAYQSENSIYPPAPLIFNALNLTPLSQIK 78

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH  GQA GL FSVP  I  PPSL N+ KE+  DV   P  HG L +W  +G
Sbjct: 79  VVILGQDPYHGPGQAMGLSFSVPKVIPKPPSLNNLLKEMASDVGIAPSKHGDLTYWAQQG 138

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN+ LTV E    SH+ +GWEQFTD+VID+++   ++ VF+LWG+ AQK +  ++  
Sbjct: 139 VLLLNSSLTVRESEPNSHQNKGWEQFTDAVIDVVNEQTEHTVFILWGSHAQKSK-YINTD 197

Query: 181 RHLVLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +HL+L A HPSPL+A+  GFFG + FSK N YL ++G+T ++WQ+P
Sbjct: 198 KHLILTAVHPSPLAANRGGFFGSKPFSKTNDYLVQYGQTPIDWQLP 243


>gi|302549989|ref|ZP_07302331.1| uracil-DNA glycosylase [Streptomyces viridochromogenes DSM 40736]
 gi|302467607|gb|EFL30700.1| uracil-DNA glycosylase [Streptomyces viridochromogenes DSM 40736]
          Length = 227

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  +   L EF+  E+ KG  + P     F A D TP+ KVKV+ILG
Sbjct: 7   LPESWRGVLGDELQQPYFNELTEFVEEERAKGP-VHPPREEVFAALDATPYEKVKVLILG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+RIPPSL N+YKE+ E++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVRIPPSLRNIYKEMHEELGTPIPDNGYLMPWAQQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+GRGWE+FTD+VI  +++     VF+LWG  AQKK  ++D  RH+V+
Sbjct: 126 AVLTVRGGEANSHKGRGWEKFTDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDETRHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ +  +   G   ++W IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQIDAAVAAQGHEPIDWTIP 224


>gi|240143847|ref|ZP_04742448.1| uracil-DNA glycosylase [Roseburia intestinalis L1-82]
 gi|257204164|gb|EEV02449.1| uracil-DNA glycosylase [Roseburia intestinalis L1-82]
 gi|291539631|emb|CBL12742.1| Uracil-DNA glycosylase [Roseburia intestinalis XB6B4]
          Length = 225

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   ++  F+  + R L +F+  E  +   I+P     F A   TP ++VKV+ILG
Sbjct: 4   ITNDWLPAIQGEFKKPYYRELFQFVKEEYSRAV-IYPPADDIFNAMHFTPLSEVKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPYHN  QAHGL FSV P    IPPSL N+YKELQ+D+    P +G+L+ W  +GVLLL
Sbjct: 63  QDPYHNENQAHGLSFSVLPSQKEIPPSLQNIYKELQDDLGCYIPNNGYLKKWADQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV   +A SH+GRGWEQFTD++I  ++   + IV+MLWG  AQ K  +L + +HL+
Sbjct: 123 NTVLTVRAHQANSHQGRGWEQFTDAIIQAVNAQDRPIVYMLWGRPAQSKIPMLTNPKHLI 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LKA HPSPLSA  GFFGCRHFS+AN +L+ +G   ++WQI
Sbjct: 183 LKAPHPSPLSAYRGFFGCRHFSQANDFLKANGIEPIDWQI 222


>gi|291535105|emb|CBL08217.1| Uracil-DNA glycosylase [Roseburia intestinalis M50/1]
          Length = 225

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   ++  F+  + R L +F+  E  +   I+P     F A   TP ++VKV+ILG
Sbjct: 4   IMNDWLPAIQGEFKKPYYRELFQFVKEEYSRAV-IYPPADDIFNAMHFTPLSEVKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPYHN  QAHGL FSV P    IPPSL N+YKELQ+D+    P +G+L+ W  +GVLLL
Sbjct: 63  QDPYHNENQAHGLSFSVLPSQKEIPPSLQNIYKELQDDLGCYIPNNGYLKKWADQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV   +A SH+GRGWEQFTD++I  ++   + IV+MLWG  AQ K  +L + +HL+
Sbjct: 123 NTVLTVRAHQANSHQGRGWEQFTDAIIQAVNAQDRPIVYMLWGRPAQSKIPMLTNPKHLI 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LKA HPSPLSA  GFFGCRHFS+AN +L+ +G   ++WQI
Sbjct: 183 LKAPHPSPLSAYRGFFGCRHFSQANDFLKANGIEPIDWQI 222


>gi|291550475|emb|CBL26737.1| Uracil-DNA glycosylase [Ruminococcus torques L2-14]
          Length = 222

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W   L+  F   + R L E  ++E+ + K IFP     F AF +TP   VKVVILG
Sbjct: 4   LNGDWYEALKGEFSKPYYRKLFE-TVNEEYRTKLIFPPAQDIFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGL FSV  G+ IPPSLVN+YKEL +D+    P HG L  W  +GVL+LN
Sbjct: 63  QDPYHNNGQAHGLSFSVQKGVDIPPSLVNIYKELHDDLGCTIPNHGCLTKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  +++  + IVF+LWGA AQ+K+ +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAILALNSQDRPIVFILWGAPAQRKKRMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPL+A  GFFG + FS+ N +L+++G   ++WQI
Sbjct: 183 EAPHPSPLAAYRGFFGSKPFSQTNAFLEKNGIEPIDWQI 221


>gi|323167781|gb|EFZ53476.1| uracil-DNA glycosylase [Shigella sonnei 53G]
          Length = 220

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 142/211 (67%), Gaps = 1/211 (0%)

Query: 13  LLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNY 72
           +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDPYH  
Sbjct: 1   MLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGP 60

Query: 73  GQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVE 131
           GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN VLTV 
Sbjct: 61  GQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVR 120

Query: 132 EGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPS 191
            G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA HPS
Sbjct: 121 AGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPS 180

Query: 192 PLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           PLSA  GFFGC HF  AN++L++ G+T ++W
Sbjct: 181 PLSAHRGFFGCNHFVLANQWLEQRGETPIDW 211


>gi|308048489|ref|YP_003912055.1| uracil-DNA glycosylase [Ferrimonas balearica DSM 9799]
 gi|307630679|gb|ADN74981.1| Uracil-DNA glycosylase [Ferrimonas balearica DSM 9799]
          Length = 228

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 143/221 (64%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +   W+  L       + + +   +   + +G+ I+P     F AF  T F+++KVVI
Sbjct: 1   MPVQNQWQPFLGGVKSEPYFQQMMAQIAEWRAQGQVIYPPQEQVFEAFRRTDFDQIKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           LGQDPYH   QAHGLCFSV  G++ PPSLVN+YKEL  D+  F  P HG+L HW  +GVL
Sbjct: 61  LGQDPYHGPNQAHGLCFSVQPGVKTPPSLVNIYKELANDIPGFQIPDHGYLAHWADQGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV  G+A SH   GWE FTD VI+LI+   + +VF+LWG+ AQKK   +D  +H
Sbjct: 121 LLNTVLTVNAGQAHSHAALGWETFTDRVIELINAEREGVVFLLWGSHAQKKGRHIDTSKH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            VLKA HPSPLSA  GF GC HFS+ N  L+E GKT ++WQ
Sbjct: 181 AVLKAPHPSPLSAHRGFLGCGHFSQTNAILREQGKTEIDWQ 221


>gi|199597297|ref|ZP_03210728.1| uracil-DNA glycosylase [Lactobacillus rhamnosus HN001]
 gi|258507953|ref|YP_003170704.1| uracil-DNA glycosylase [Lactobacillus rhamnosus GG]
 gi|258539205|ref|YP_003173704.1| uracil-DNA glycosylase [Lactobacillus rhamnosus Lc 705]
 gi|199591813|gb|EDY99888.1| uracil-DNA glycosylase [Lactobacillus rhamnosus HN001]
 gi|257147880|emb|CAR86853.1| Uracil-DNA glycosylase [Lactobacillus rhamnosus GG]
 gi|257150881|emb|CAR89853.1| Uracil-DNA glycosylase [Lactobacillus rhamnosus Lc 705]
 gi|259649280|dbj|BAI41442.1| uracil-DNA glycosylase [Lactobacillus rhamnosus GG]
          Length = 229

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+++LE  F+S     L  FL  E+   K I+P   H F+AF+ TPF+ VKVVILG
Sbjct: 5   IHNDWQTVLEPIFESSEYARLHGFL-KEEYATKTIYPEMHHIFQAFEWTPFHDVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QA G  F+V  G+ +PPSL N+YKELQ D+ + P  HG+L+ W ++GVLLLN
Sbjct: 64  QDPYHNPHQAVGASFAVAPGVALPPSLQNIYKELQSDLGYPPVHHGYLKAWANQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV+ G A SH+  GWE  TD+ I  +S     +VF+LWG +A+KK  ++D  ++ ++
Sbjct: 124 AVLTVQAGHAYSHQNHGWEALTDAAIAALSAR-GGVVFILWGNAAKKKAALIDTSKNAII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            +AHPSPLSAS GFFG R FS+ N  L++ G+T +NWQ+P
Sbjct: 183 ASAHPSPLSASRGFFGSRPFSRTNEALEKMGETPINWQLP 222


>gi|229551805|ref|ZP_04440530.1| uracil-DNA glycosylase [Lactobacillus rhamnosus LMS2-1]
 gi|229314859|gb|EEN80832.1| uracil-DNA glycosylase [Lactobacillus rhamnosus LMS2-1]
          Length = 232

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (68%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+++LE  F+S     L  FL  E+   K I+P   H F+AF+ TPF+ VKVVILG
Sbjct: 8   IHNDWQTVLEPIFESSEYARLHGFL-KEEYATKTIYPEMHHIFQAFEWTPFHDVKVVILG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QA G  F+V  G+ +PPSL N+YKELQ D+ + P  HG+L+ W ++GVLLLN
Sbjct: 67  QDPYHNPHQAVGASFAVAPGVALPPSLQNIYKELQSDLGYPPVHHGYLKAWANQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV+ G A SH+  GWE  TD+ I  +S     +VF+LWG +A+KK  ++D  ++ ++
Sbjct: 127 AVLTVQAGHAYSHQNHGWEALTDAAIAALSAR-GGVVFILWGNAAKKKAALIDTSKNAII 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            +AHPSPLSAS GFFG R FS+ N  L++ G+T +NWQ+P
Sbjct: 186 ASAHPSPLSASRGFFGSRPFSRTNEALEKMGETPINWQLP 225


>gi|219684832|ref|ZP_03539774.1| uracil-DNA glycosylase [Borrelia garinii PBr]
 gi|219671777|gb|EED28832.1| uracil-DNA glycosylase [Borrelia garinii PBr]
          Length = 223

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKYEYKTKKGKIFPPPKLIFNAFDSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLKIKTLPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D ++H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKKLIDPEKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HF  A  YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFIYALNYLKKHNKNKINFQ 223


>gi|149185090|ref|ZP_01863407.1| uracil-DNA glycosylase [Erythrobacter sp. SD-21]
 gi|148831201|gb|EDL49635.1| uracil-DNA glycosylase [Erythrobacter sp. SD-21]
          Length = 226

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 146/222 (65%), Gaps = 3/222 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I ESW+ +LE     +  R L  +L +E+  GK ++P      +A ++TP + VKVVILG
Sbjct: 5   IPESWRPVLEPVLARDEARALGAWLRAEEAAGKTVYPPRGQRLKALELTPLDAVKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQA GL FSVP G+++PPSL N+YKEL  D+    P  G L HW  +GVLLLN
Sbjct: 65  QDPYHGPGQAMGLAFSVPEGVKLPPSLRNIYKELASDLGGETPISGDLSHWSRQGVLLLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQ---KKQDVLDHKRH 182
             LTVE+G+A SH GRGW+  TD+ +  ++      VF+LWG+ AQ   K+ D L   RH
Sbjct: 125 NTLTVEDGKAGSHAGRGWDAVTDACVAAVAARDAPSVFILWGSHAQAQAKRIDGLRDGRH 184

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LV+++ HPSPLSA  GFFG + FS++N +L EHG+  V+W++
Sbjct: 185 LVIESPHPSPLSAHRGFFGSKPFSRSNSFLVEHGRGAVDWRV 226


>gi|315282002|ref|ZP_07870509.1| uracil-DNA glycosylase [Listeria marthii FSL S4-120]
 gi|313614347|gb|EFR87984.1| uracil-DNA glycosylase [Listeria marthii FSL S4-120]
          Length = 224

 Score =  227 bits (579), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +++   W  LL++ F   +   L++FL +E +  K++FP     F A   T +  VKVVI
Sbjct: 2   IQLENDWDELLKDEFNQPYYLKLRQFLKNEYQT-KKVFPDMYDIFNALKHTAYKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+  PPSL N+Y ELQ D+    P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQKGVXXPPSLQNIYLELQNDLKCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H+
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEMLTNRIIEMINEKEEPVVFLLWGNNAKEKLQLLTNPKHI 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G T ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCQHFSKTNQFLEQNGVTPIDWQIP 222


>gi|218547894|ref|YP_002381685.1| uracil-DNA glycosylase [Escherichia fergusonii ATCC 35469]
 gi|226725944|sp|B7LUY5|UNG_ESCF3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|218355435|emb|CAQ88043.1| uracil-DNA-glycosylase [Escherichia fergusonii ATCC 35469]
          Length = 229

 Score =  227 bits (579), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPGHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|160916123|ref|ZP_02078330.1| hypothetical protein EUBDOL_02150 [Eubacterium dolichum DSM 3991]
 gi|158431847|gb|EDP10136.1| hypothetical protein EUBDOL_02150 [Eubacterium dolichum DSM 3991]
          Length = 224

 Score =  227 bits (579), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 145/217 (66%), Gaps = 1/217 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           + WK L        + + L  FL +       +FP     F  F++ P  +VKVVILGQD
Sbjct: 4   KDWKDLFREEETKPYYQELMAFL-NHAYAATTVFPPKEKLFTCFEVCPLQQVKVVILGQD 62

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH   QAHGLCFSV  G++IPPSL N+YKEL+ D++   P+HG+L  W  +GV ++NAV
Sbjct: 63  PYHEPNQAHGLCFSVQKGVKIPPSLRNIYKELKSDLDIYAPSHGYLMDWAKQGVFMMNAV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           ++VE+G+A SHR +GWEQF+D VI++++   Q IVF+LWG  A +K  ++ + +H ++ +
Sbjct: 123 MSVEKGKAGSHRKKGWEQFSDRVIEVLNAQSQGIVFILWGNWAIQKTKLITNPQHRIITS 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFG R FSK N YL+E G+T ++W+I
Sbjct: 183 PHPSPLSAYQGFFGSRPFSKTNEYLKEMGRTPIDWRI 219


>gi|210617975|ref|ZP_03291834.1| hypothetical protein CLONEX_04066 [Clostridium nexile DSM 1787]
 gi|210149049|gb|EEA80058.1| hypothetical protein CLONEX_04066 [Clostridium nexile DSM 1787]
          Length = 224

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I+  W   L++ F+ ++ + L E  ++E+ + + IFP  +  F AF +TP   VKVVILG
Sbjct: 4   INGDWLEALKDEFKKDYYKQLFE-KVNEEYRTRLIFPPANDIFNAFHLTPLKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGLCFSV   + IPPSLVN+YKEL +D+    P HG+L  W  +GVL+LN
Sbjct: 63  QDPYHGNNQAHGLCFSVKPEVEIPPSLVNIYKELHDDLGCTIPDHGYLVKWAKQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I +++   + IVF+LWG  AQ K+ +L++ +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRVLNTQDRPIVFILWGRPAQMKKAMLNNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLS+  GFFG R FSK N++L+ +G   ++WQI
Sbjct: 183 EAPHPSPLSSYRGFFGSRPFSKTNQFLEANGVEPIDWQI 221


>gi|163788427|ref|ZP_02182873.1| uracil-DNA glycosylase [Flavobacteriales bacterium ALC-1]
 gi|159876747|gb|EDP70805.1| uracil-DNA glycosylase [Flavobacteriales bacterium ALC-1]
          Length = 223

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 110/222 (49%), Positives = 151/222 (68%), Gaps = 2/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V IH+SWK  L+  F   + ++L EF+ +E R     FP+GS  F AF+   FN  KVVI
Sbjct: 3   VDIHQSWKPFLQPEFVKPYFKSLVEFIKTEYRT-HTCFPKGSDIFNAFNHCHFNDTKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  GI  PPSL+N++KE+++D+    P  G L  W  +GVLL
Sbjct: 62  IGQDPYHGVGQANGLCFSVNDGISHPPSLINIFKEIEQDLGIPYPKSGNLMPWADQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +AASH+  GWEQFTD++I  IS+   N++F+LWG  A+KK+ ++D  +H 
Sbjct: 122 LNATLTVRAHQAASHQKMGWEQFTDAIIKTISSEKTNVIFLLWGGFAKKKKKLIDANKHF 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNWQI 224
           VL+  HPSPLSA+ G+ FG +HFSK N  L++ G + + WQ+
Sbjct: 182 VLETGHPSPLSANRGYWFGNKHFSKTNSQLEQVGASVIEWQL 223


>gi|295425907|ref|ZP_06818585.1| uracil-DNA glycosylase [Lactobacillus amylolyticus DSM 11664]
 gi|295064405|gb|EFG55335.1| uracil-DNA glycosylase [Lactobacillus amylolyticus DSM 11664]
          Length = 231

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L+  F SE   +L +FL  E+   K+I+P   H F AF +TPF+K KVVILG
Sbjct: 5   IGNDWDQVLDPVFASEEYHHLHDFL-KEEYSTKKIYPDMYHIFTAFKLTPFSKTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA+G+ FSV  G  +PPSL N+YKEL +DV   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHNPGQANGMSFSVMPGTTLPPSLKNIYKELYDDVGARPVNHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  H+G+GWE+ TD+ I  +S   + +VF+LWG  AQ K  ++D  ++ V+
Sbjct: 124 AVLTVPYGHANGHQGKGWEKVTDAAIKALSQRGK-VVFILWGRFAQNKIPLIDQDKNFVI 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA  GFFG R FS+ N  L++ G+T ++WQ+P
Sbjct: 183 KSAHPSPFSADRGFFGSRPFSRCNNALKDFGETPIDWQLP 222


>gi|255691173|ref|ZP_05414848.1| uracil-DNA glycosylase [Bacteroides finegoldii DSM 17565]
 gi|260623076|gb|EEX45947.1| uracil-DNA glycosylase [Bacteroides finegoldii DSM 17565]
          Length = 220

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESW+  L+  F   +   L  F+ SE  +   I P G   F  F+  PF KVKVVI
Sbjct: 3   VKIEESWRQQLQEEFNKPYFEKLVAFVKSEYERA-HILPLGHQIFHVFNSCPFEKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPY N GQ +G+CFSVP G+ IP SL N++KE+ +D+    PT G L+ W  +GV  
Sbjct: 62  LGQDPYPNPGQYYGICFSVPDGVTIPGSLANIFKEINQDLGKPIPTSGNLDRWVTQGVFP 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +N+VLTV      SHR  GWE FTD+VI  +S+  +N+VFMLWG+ A++K+ ++D  +HL
Sbjct: 122 MNSVLTVRAHETGSHRNMGWEIFTDAVIRKLSDKRENLVFMLWGSYAKEKRSLIDTNKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL   HPSP SA +GFFGC+HFSKAN +LQ  G   +NW
Sbjct: 182 VLTTVHPSPRSAEYGFFGCKHFSKANAFLQSKGIKEINW 220


>gi|323188305|gb|EFZ73597.1| uracil-DNA glycosylase [Escherichia coli RN587/1]
          Length = 229

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTALGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|307109753|gb|EFN57990.1| hypothetical protein CHLNCDRAFT_142153 [Chlorella variabilis]
          Length = 311

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 146/224 (65%), Gaps = 5/224 (2%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + +SW+ LL +     +  +L+ F+ SE    + +FP     FRA +  P +KV+VVILG
Sbjct: 87  VEDSWRHLLSSELDKPYFADLEAFVRSEWAGSQMVFPPKDCVFRALNSCPVDKVRVVILG 146

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNF-----IPPTHGFLEHWGHEG 120
           QDPYH+ GQA GL FSVP G  +P SL N+YKEL+ED+         P HG LE W H+G
Sbjct: 147 QDPYHDLGQAMGLSFSVPHGRAVPSSLRNMYKELREDLGCEGGRGAVPKHGNLEKWAHQG 206

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNAVLTV    AASH  +GWE+FTD+ I  +S     +VF+LWG  AQ K  V+D  
Sbjct: 207 VLLLNAVLTVRAHSAASHAKKGWEKFTDAAISRLSKQRSGVVFLLWGRYAQDKGKVIDKS 266

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H VL AAHPS LSA+ GFFGCRHFS+ NR L++ G+  ++W I
Sbjct: 267 KHHVLTAAHPSGLSANRGFFGCRHFSQTNRLLEKDGQLPIDWCI 310


>gi|295400626|ref|ZP_06810603.1| uracil-DNA glycosylase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112684|ref|YP_003991000.1| uracil-DNA glycosylase [Geobacillus sp. Y4.1MC1]
 gi|294977207|gb|EFG52808.1| uracil-DNA glycosylase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217785|gb|ADP76389.1| uracil-DNA glycosylase [Geobacillus sp. Y4.1MC1]
          Length = 224

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  F+  +   L+EFL  E R  + I+P     F A   TP+++VKVVILG
Sbjct: 4   LKNDWAPLLEEEFRKPYYIKLREFLKEEYRT-RTIYPDMYDIFNALHYTPYSQVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPLPPSLVNIFKELHDDLGCYIPNNGYLVKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SH+G+GWE FTD VI+L++     +VF+LWG  AQ K++++ +  H ++
Sbjct: 123 TVLTVRRGQANSHKGKGWEFFTDRVIELVNEKQDPVVFLLWGRHAQAKKELITNPHHYII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+AN +LQ+ G+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRANAFLQKVGREPIDWQI 221


>gi|167587617|ref|ZP_02380005.1| uracil-DNA glycosylase [Burkholderia ubonensis Bu]
          Length = 292

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 111/224 (49%), Positives = 146/224 (65%), Gaps = 6/224 (2%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ++W+ +L     SE    L  F+ SE+  GK ++P  +  FRA  +T  + VKVVILG
Sbjct: 64  LPDAWREVLAPFVASEAYGPLCRFVDSERAAGKTVYP--TDVFRALRLTSPDDVKVVILG 121

Query: 66  QDPYHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           QDPYH       QAHGL FSVP  ++ PPSL N++KE+  +     P HG L+ W  +GV
Sbjct: 122 QDPYHGDDRGTPQAHGLAFSVPPAVKPPPSLRNIFKEIAANFGHDTPRHGCLDSWARQGV 181

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   
Sbjct: 182 LLLNTVLTVERGAAASHAKRGWEQCTDTLIHELANRHRGLVFMLWGAHAQAKRALFDANA 241

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           H VL+A HPSPLSA  GF GCRHF+ AN YL  HG+  ++W++P
Sbjct: 242 HCVLEAPHPSPLSAHRGFLGCRHFALANDYLVAHGRDAIDWRLP 285


>gi|332311612|gb|EGJ24707.1| Uracil-DNA glycosylase 2 [Listeria monocytogenes str. Scott A]
          Length = 230

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 148/222 (66%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL  E +  K++FP     F A   T    VKVVI
Sbjct: 8   IKLGNDWDELLKDEFNQPYYLTLRQFLKKEYQT-KKVFPDMYDIFNALKYTACKDVKVVI 66

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 67  LGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIRWADQGVLL 126

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H 
Sbjct: 127 LNTVLTVRAGQANSHRGQGWEILTNRIIEIINQKEEPVVFLLWGNNAKEKLQLLTNPKHT 186

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G   ++WQIP
Sbjct: 187 AFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIP 228


>gi|157144487|ref|YP_001451806.1| uracil-DNA glycosylase [Citrobacter koseri ATCC BAA-895]
 gi|166201517|sp|A8AD07|UNG_CITK8 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|157081692|gb|ABV11370.1| hypothetical protein CKO_00204 [Citrobacter koseri ATCC BAA-895]
          Length = 229

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N    +  E++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFVNTLHTVAGERQSGMTVYPPQKDVFNAFRFTELGNVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELETSIPGFTRPAHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI L++ + + +VF+LWG+ AQKK  ++D +RH VL+A
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLVNEHREGVVFLLWGSHAQKKGAIIDRQRHYVLRA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQHGEKPIDW 220


>gi|325284597|ref|YP_004264060.1| Uracil-DNA glycosylase [Deinococcus proteolyticus MRP]
 gi|324316086|gb|ADY27200.1| Uracil-DNA glycosylase [Deinococcus proteolyticus MRP]
          Length = 757

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 145/222 (65%), Gaps = 2/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V++   W ++L +       R L EF+  E+R+   ++P     F A  +T +   KV+I
Sbjct: 537 VQLPHDWGAVLHDEISRPSFRRLLEFV-EEQRRTATVYPPPEDVFTALRLTSYQDAKVLI 595

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+R+PPSL N+Y+EL+EDV   PP HG LE W   GVLL
Sbjct: 596 LGQDPYHGAGQAHGLAFSVRRGVRVPPSLRNIYQELKEDVGVTPPRHGNLEAWAERGVLL 655

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV EG   SH G+GWE FTD+VI  ++   Q +VF+LWGA A+KK+ ++   +H+
Sbjct: 656 LNAVLTVREGEPNSHAGQGWEDFTDAVIRALNAKEQRVVFVLWGAYARKKKKLVTAPQHV 715

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           V+++ HPSPLS  H F G R FS  NR LQE G+  V+W +P
Sbjct: 716 VIESGHPSPLSVRH-FAGTRPFSAVNRALQEAGEEAVDWSLP 756


>gi|46907446|ref|YP_013835.1| uracil-DNA glycosylase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47092026|ref|ZP_00229820.1| uracil-DNA glycosylase [Listeria monocytogenes str. 4b H7858]
 gi|226223827|ref|YP_002757934.1| uracil-DNA glycosylase [Listeria monocytogenes Clip81459]
 gi|254823519|ref|ZP_05228520.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL J1-194]
 gi|254852904|ref|ZP_05242252.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL R2-503]
 gi|254932895|ref|ZP_05266254.1| uracil-DNA glycosylase 2 [Listeria monocytogenes HPB2262]
 gi|254992866|ref|ZP_05275056.1| uracil-DNA glycosylase [Listeria monocytogenes FSL J2-064]
 gi|255522228|ref|ZP_05389465.1| uracil-DNA glycosylase [Listeria monocytogenes FSL J1-175]
 gi|300764376|ref|ZP_07074370.1| uracil-DNA glycosylase [Listeria monocytogenes FSL N1-017]
 gi|73920163|sp|Q720K2|UNG2_LISMF RecName: Full=Uracil-DNA glycosylase 2; Short=UDG 2
 gi|46880714|gb|AAT04012.1| uracil-DNA glycosylase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47019742|gb|EAL10481.1| uracil-DNA glycosylase [Listeria monocytogenes str. 4b H7858]
 gi|225876289|emb|CAS04998.1| Putative uracil-DNA glycosylase [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258606239|gb|EEW18847.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL R2-503]
 gi|293584449|gb|EFF96481.1| uracil-DNA glycosylase 2 [Listeria monocytogenes HPB2262]
 gi|293592739|gb|EFG00500.1| uracil-DNA glycosylase 2 [Listeria monocytogenes FSL J1-194]
 gi|300515028|gb|EFK42081.1| uracil-DNA glycosylase [Listeria monocytogenes FSL N1-017]
 gi|328466621|gb|EGF37756.1| uracil-DNA glycosylase [Listeria monocytogenes 1816]
 gi|328475246|gb|EGF46027.1| uracil-DNA glycosylase [Listeria monocytogenes 220]
          Length = 224

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 148/222 (66%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL++ F   +   L++FL  E +  K++FP     F A   T    VKVVI
Sbjct: 2   IKLGNDWDELLKDEFNQPYYLTLRQFLKKEYQT-KKVFPDMYDIFNALKYTACKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIRWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H 
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEILTNRIIEIINQKEEPVVFLLWGNNAKEKLQLLTNPKHT 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIP 222


>gi|158319691|ref|YP_001512198.1| uracil-DNA glycosylase [Alkaliphilus oremlandii OhILAs]
 gi|167011635|sp|A8MM35|UNG_ALKOO RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|158139890|gb|ABW18202.1| uracil-DNA glycosylase [Alkaliphilus oremlandii OhILAs]
          Length = 225

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 149/222 (67%), Gaps = 1/222 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           GV     W+ LL++ F+ E+ + ++ FL+ E R  K I+P  +H F A   T +  V+VV
Sbjct: 2   GVIFENDWQELLKDEFEKEYYKKVRGFLVEEYRT-KTIYPDKNHIFSALHYTAYKDVRVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHGL FSV  G+RIPPSLVN+YKEL+ D+    P HG+L+ W  +GVL
Sbjct: 61  ILGQDPYHGPNQAHGLSFSVQPGVRIPPSLVNIYKELETDLGCYIPNHGYLKKWADQGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN  LTV  G A SH+  GWE FTD +I L+++  + IVF+LWG +A  K+  + + +H
Sbjct: 121 LLNTSLTVRAGEANSHQKIGWEIFTDHIIQLLNDRKEPIVFILWGNNAISKERFITNPQH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            ++K+ HPSPLSAS GFFG + FSK N +L+  G+  ++WQI
Sbjct: 181 YIIKSVHPSPLSASRGFFGSKPFSKTNSFLESIGEKPIDWQI 222


>gi|90413171|ref|ZP_01221167.1| putative uracil-DNA-glycosylase [Photobacterium profundum 3TCK]
 gi|90325862|gb|EAS42314.1| putative uracil-DNA-glycosylase [Photobacterium profundum 3TCK]
          Length = 227

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 107/216 (49%), Positives = 143/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ ++    Q  + + +++F+ + +  G  IFP     F AF+ TP  +VKVVILGQDP
Sbjct: 6   TWQDIINQEKQQPYFQKIEQFVSTARSNGNVIFPPEQDVFNAFNSTPLAQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI+ PPSL N+YKEL  D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGVNQAHGLSFSVLPGIKTPPSLANMYKELATDIPGFQIPQHGYLQSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+ +A SH   GWE FTD +ID++      +VF+LWGA AQKK   ++  +H VLK+
Sbjct: 126 LTVEQSKAHSHAKIGWETFTDKIIDVLDQQSAGVVFVLWGAHAQKKGKKINTDKHHVLKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           AHPSPLSA  GFFGC+HFS+ N  L +  K  ++WQ
Sbjct: 186 AHPSPLSAYRGFFGCKHFSQVNHLLCDMNKAPIDWQ 221


>gi|168206631|ref|ZP_02632636.1| uracil-DNA glycosylase [Clostridium perfringens E str. JGS1987]
 gi|170661978|gb|EDT14661.1| uracil-DNA glycosylase [Clostridium perfringens E str. JGS1987]
          Length = 225

 Score =  227 bits (578), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 149/223 (66%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
             + +  W  LL++ F+ E+  NL++FL++E  K ++I P     F A   TP+  VKVV
Sbjct: 2   AAEFNNDWDDLLKDEFEKEYYLNLRKFLINE-YKTQKIHPSMYDIFNALKFTPYKDVKVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHG  FSV  G++ PPSL N++KEL  D+    P +GFLE W  +G+L
Sbjct: 61  ILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGIL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG+A SH+G+GWE FTD VI+L++   + IVF+LWG +A  K+ ++ +  H
Sbjct: 121 LLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKETLITNPIH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++K+ HPSPLSA+ GFFG + FSK N +L    K  ++WQIP
Sbjct: 181 KIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIP 223


>gi|110798755|ref|YP_694720.1| uracil-DNA glycosylase [Clostridium perfringens ATCC 13124]
 gi|168214113|ref|ZP_02639738.1| uracil-DNA glycosylase [Clostridium perfringens CPE str. F4969]
 gi|122959105|sp|Q0TUH0|UNG_CLOP1 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|110673402|gb|ABG82389.1| uracil-DNA glycosylase [Clostridium perfringens ATCC 13124]
 gi|170714445|gb|EDT26627.1| uracil-DNA glycosylase [Clostridium perfringens CPE str. F4969]
          Length = 225

 Score =  227 bits (578), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 149/223 (66%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
             + +  W  LL++ F+ E+  NL++FL++E  K ++I P     F A   TP+  VKVV
Sbjct: 2   AAEFNNDWDDLLKDEFEKEYYLNLRKFLINE-YKTQKIHPSMYDIFNALKFTPYKDVKVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHG  FSV  G++ PPSL N++KEL  D+    P +GFLE W  +G+L
Sbjct: 61  ILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGIL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG+A SH+G+GWE FTD VI+L++   + IVF+LWG +A  K+ ++ +  H
Sbjct: 121 LLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNSIH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++K+ HPSPLSA+ GFFG + FSK N +L    K  ++WQIP
Sbjct: 181 KIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIP 223


>gi|301024867|ref|ZP_07188504.1| uracil-DNA glycosylase [Escherichia coli MS 69-1]
 gi|331664148|ref|ZP_08365058.1| uracil-DNA glycosylase [Escherichia coli TA143]
 gi|300396398|gb|EFJ79936.1| uracil-DNA glycosylase [Escherichia coli MS 69-1]
 gi|331059947|gb|EGI31924.1| uracil-DNA glycosylase [Escherichia coli TA143]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|34540088|ref|NP_904567.1| uracil-DNA glycosylase [Porphyromonas gingivalis W83]
 gi|45477226|sp|Q7MXF6|UNG_PORGI RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|34396399|gb|AAQ65466.1| uracil-DNA glycosylase [Porphyromonas gingivalis W83]
          Length = 222

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 149/225 (66%), Gaps = 6/225 (2%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M+ V+I   WK +L+  F   +   L +F+  E R+   I+P     FRAFD  PF++VK
Sbjct: 1   MKEVRIEAGWKKVLQEEFDKFYFEKLTDFVREEYRQSP-IYPPARFIFRAFDTCPFDRVK 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTH---GFLEHWG 117
           VVILGQDPYH  GQA GL FSVP GI IPPSL N+ +E++ D     P H   G L  W 
Sbjct: 60  VVILGQDPYHEPGQAEGLAFSVPTGIPIPPSLRNICEEIRTDTG--QPAHIDGGSLLPWV 117

Query: 118 HEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL 177
            +GVLLLNA LTV   +A SH+G GWE FTD+ I+ ++   +++VF+LWG+ A++K  ++
Sbjct: 118 EQGVLLLNATLTVRASQAGSHQGHGWETFTDAAIEALAKRREHLVFLLWGSYARRKSAMI 177

Query: 178 DHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           D + HL+L+A HPSPLSA  GFFGC+HFS+ N YL++HG   + W
Sbjct: 178 DPRCHLILEAPHPSPLSAHRGFFGCKHFSRTNAYLRQHGIAPIVW 222


>gi|81428955|ref|YP_395955.1| uracil-DNA glycosylase [Lactobacillus sakei subsp. sakei 23K]
 gi|123563983|sp|Q38VY5|UNG_LACSS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|78610597|emb|CAI55648.1| Uracil-DNA glycosylase [Lactobacillus sakei subsp. sakei 23K]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH  W+++LE  F   +   L +FL  E      ++P   H F+AF+ TPF +VKVVILG
Sbjct: 5   IHNDWQTVLEPEFAKPYYGQLHQFLKQE-YATTTVYPEMHHIFQAFEWTPFEQVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHG  FSV  G+++PPSL N+YKELQ DV F P  HG+L+ W  +GV LLN
Sbjct: 64  QDPYHGPHQAHGCSFSVLPGVKVPPSLKNIYKELQTDVGFNPVNHGYLKAWADQGVFLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G A SHR +GWEQ TD+ I  +S    ++VF+LWG SA+ K+ ++D  ++ VL
Sbjct: 124 TVLTVRAGEANSHRQQGWEQLTDAAIAALSQRG-HVVFILWGNSAKAKRALIDESQNAVL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            A HPSPL+A HGFFG + FS+ N+ L++   T +NWQ+P
Sbjct: 183 TAVHPSPLAAYHGFFGSKPFSQTNQQLKQWAMTPINWQLP 222


>gi|331674029|ref|ZP_08374792.1| uracil-DNA glycosylase [Escherichia coli TA280]
 gi|331069302|gb|EGI40694.1| uracil-DNA glycosylase [Escherichia coli TA280]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|225549342|ref|ZP_03770315.1| uracil-DNA glycosylase [Borrelia burgdorferi 94a]
 gi|225370200|gb|EEG99640.1| uracil-DNA glycosylase [Borrelia burgdorferi 94a]
          Length = 223

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSKIKIPPSLQNIFKEIEKSLKIKTIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI  IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKTISKNLKNIVFMLWGNLARSKKGLIDPTKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSSALDYLKKHNKNIINFQ 223


>gi|310829607|ref|YP_003961964.1| uracil-DNA glycosylase [Eubacterium limosum KIST612]
 gi|308741341|gb|ADO39001.1| uracil-DNA glycosylase [Eubacterium limosum KIST612]
          Length = 225

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 144/221 (65%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +     W+  L+  FQ E+ + L+ FLL E  K + ++P     F AF  T ++  KV I
Sbjct: 3   INFQNDWEDTLQKEFQQEYYQKLRRFLLHE-YKTQTVYPDMYDIFNAFHFTAYSDTKVCI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQAHGL FSV   + +PPSL N+YKEL +D+    P+HG+L+ W  EGVLL
Sbjct: 62  IGQDPYHGRGQAHGLSFSVKPEVAVPPSLQNIYKELHDDLGCAIPSHGYLKKWTDEGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV  G+ ASHRG GWEQFTD VI+ ++     IVF+LWGA AQ K  ++ +  H 
Sbjct: 122 LNAVLTVRAGQPASHRGMGWEQFTDHVIETLNRREDPIVFILWGAFAQSKIPMITNPAHH 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           ++K+ HPSP SA  GFFG R FSK N +L+  GK  V+WQI
Sbjct: 182 IIKSPHPSPFSAGRGFFGSRPFSKTNAFLESIGKKPVDWQI 222


>gi|167571381|ref|ZP_02364255.1| uracil-DNA glycosylase [Burkholderia oklahomensis C6786]
          Length = 259

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 149/221 (67%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+ +LE    S+    L  F+  E+  GK ++P  +  FRA  +T  + VKVVILGQDP
Sbjct: 34  DWREILEPFIASDAYAPLCRFVDGERAAGKAVYP--TDVFRALRLTHPDDVKVVILGQDP 91

Query: 69  YH--NYG--QAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH  ++G  QAHGL FSVP G++ PPSL N++KE+  D  +  P HG L+ W  +GVLLL
Sbjct: 92  YHGEDHGIPQAHGLAFSVPPGVKPPPSLRNIFKEISADFGYETPRHGCLDTWARQGVLLL 151

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H+++VFMLWGA AQ K+ + D   H V
Sbjct: 152 NTVLTVERSSAASHAKRGWEKCTDTLIHELATRHRHLVFMLWGAHAQAKRALFDASEHCV 211

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL++HG+  ++W++P
Sbjct: 212 LEAPHPSPLSAHRGFLGCRHFALANDYLKQHGRAPIDWRLP 252


>gi|138896998|ref|YP_001127451.1| uracil-DNA glycosylase [Geobacillus thermodenitrificans NG80-2]
 gi|196249819|ref|ZP_03148515.1| uracil-DNA glycosylase [Geobacillus sp. G11MC16]
 gi|166200400|sp|A4ITQ2|UNG_GEOTN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|134268511|gb|ABO68706.1| Uracil-DNA glycosylase [Geobacillus thermodenitrificans NG80-2]
 gi|196210695|gb|EDY05458.1| uracil-DNA glycosylase [Geobacillus sp. G11MC16]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  FQ  +   L+EFL  E R  + I+P     F A   TP+  VKVV+LG
Sbjct: 4   LKNDWAPLLEEEFQKPYYLKLREFLKEEYRT-RTIYPDMYDIFNALHYTPYANVKVVLLG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ +PPSLVN++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPVPPSLVNIFKELHDDLGCYIPDNGYLVKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G+A SHRG+GWE FTD VI+L++     +VF+LWG +AQ+K++ + + RH ++
Sbjct: 123 TVLTVRRGQANSHRGKGWEHFTDRVIELVNEKDDPVVFLLWGRNAQEKKERITNPRHHII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+ N +L + G+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRTNAFLTKCGREPIDWQI 221


>gi|271501632|ref|YP_003334658.1| uracil-DNA glycosylase [Dickeya dadantii Ech586]
 gi|270345187|gb|ACZ77952.1| uracil-DNA glycosylase [Dickeya dadantii Ech586]
          Length = 228

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  +  N   F+  E+  GK I+P     F AF  T F+ VKVVILGQDP
Sbjct: 6   TWHDVLAQEKEQPYFVNTLSFVHQERAAGKVIYPPQKDVFNAFRFTEFHDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P+HGFL+ W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNIYKELANDIPGFEIPSHGFLQSWAQQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI+ ++ + + IVF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVEAGKAHSHANLGWETFTDKVIENLNAHREGIVFLLWGSHAQKKGSIIDTQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFSK N+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCHHFSKTNQLLEQQGDSPIDW 220


>gi|189462995|ref|ZP_03011780.1| hypothetical protein BACCOP_03697 [Bacteroides coprocola DSM 17136]
 gi|189430277|gb|EDU99261.1| hypothetical protein BACCOP_03697 [Bacteroides coprocola DSM 17136]
          Length = 220

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESW+  L+  F   + R L +F+ SE    + + P GS  F  F++ PF KVKVVI
Sbjct: 3   VKIEESWRKRLQEEFDKPYFRQLTDFVRSEYAH-EHVLPHGSQIFHMFNVCPFEKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPY   GQ +G+CFSVP G  IP SL+N++KE+ +D+    P  G L+ W  +GV  
Sbjct: 62  LGQDPYPTPGQYYGVCFSVPEGTAIPASLMNIFKEIHQDLGKPIPESGNLDRWVEQGVFS 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +N+VLTV   +  SHR RGWE FTD+VI  +S+  +N+VFMLWG+ A+ K  ++D  +H 
Sbjct: 122 MNSVLTVRAHQTGSHRNRGWEIFTDAVIKKLSDERENLVFMLWGSYAKSKASLIDASKHC 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +L   HPSP SA +GFFGC+HFSKAN YL+  G   + W
Sbjct: 182 ILMTVHPSPRSADYGFFGCKHFSKANEYLKSKGLKEIEW 220


>gi|110803910|ref|YP_697582.1| uracil-DNA glycosylase [Clostridium perfringens SM101]
 gi|123047596|sp|Q0SWB8|UNG_CLOPS RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|110684411|gb|ABG87781.1| uracil-DNA glycosylase [Clostridium perfringens SM101]
          Length = 225

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 148/223 (66%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
             + +  W  LL++ F+ E+  NL++FL+ E  K ++I P     F A   TP+  VKVV
Sbjct: 2   AAEFNNDWDDLLKDEFEKEYYLNLRKFLIDE-YKTQKIHPSMYDIFNALKFTPYKDVKVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHG  FSV  G++ PPSL N++KEL  D+    P +GFLE W  +G+L
Sbjct: 61  ILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGIL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG+A SH+G+GWE FTD VI+L++   + IVF+LWG +A  K+ ++ +  H
Sbjct: 121 LLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKETLITNPIH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++K+ HPSPLSA+ GFFG + FSK N +L    K  ++WQIP
Sbjct: 181 KIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIP 223


>gi|218690696|ref|YP_002398908.1| uracil-DNA glycosylase [Escherichia coli ED1a]
 gi|254790579|sp|B7MYL3|UNG_ECO81 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|218428260|emb|CAR09179.2| uracil-DNA-glycosylase [Escherichia coli ED1a]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTALGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|296104253|ref|YP_003614399.1| uracil-DNA-glycosylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058712|gb|ADF63450.1| uracil-DNA-glycosylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 229

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N    + +E++ G+ I+P     F AF  T  + VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFINTLSTVAAERQSGQTIYPPQKDVFNAFRYTELSDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+ IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGVAIPPSLLNMYKELEGTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINEHREGVVFLLWGSHAQKKGAIIDRQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN +L++ G+T + W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANEWLEKRGETPIIW 220


>gi|257463925|ref|ZP_05628310.1| uracil-DNA glycosylase [Fusobacterium sp. D12]
 gi|317061451|ref|ZP_07925936.1| uracil-DNA glycosylase [Fusobacterium sp. D12]
 gi|313687127|gb|EFS23962.1| uracil-DNA glycosylase [Fusobacterium sp. D12]
          Length = 223

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 144/221 (65%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  +LE  FQ E+ + L++ L+ E R  KRIFP     F A   T +   KVV+
Sbjct: 2   VHIGNDWDKVLEGEFQQEYYQELRKILVREYR-SKRIFPPAEKIFNALKWTSYADCKVVL 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSVP G RIPPSL N+YKELQ+ +    P HG LE W  +GVLL
Sbjct: 61  LGQDPYHGLGQAHGLSFSVPKGQRIPPSLQNMYKELQDSLGLRVPHHGCLEKWAGQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV EG+A+SH   GWE FTD VI  ++   + ++F+LWG  A+ K+  +D ++H 
Sbjct: 121 LNTSLTVVEGQASSHSKIGWEIFTDHVIQKLNEREEPLIFILWGNHARSKKKWIDTRKHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+  HPSPLSAS GFFGC HF + N  L++ GK  ++WQI
Sbjct: 181 ILEGVHPSPLSASRGFFGCGHFRQVNEILRKLGKQEIDWQI 221


>gi|224112279|ref|XP_002316140.1| predicted protein [Populus trichocarpa]
 gi|222865180|gb|EEF02311.1| predicted protein [Populus trichocarpa]
          Length = 216

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGK-RIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           +W+ +L    +  + +NL +F+ SE   G   I+P     F A + TPFN +K VI+GQD
Sbjct: 1   TWREVLPGELEKPYFKNLCKFVESEISNGSVAIYPPQHLIFNALNSTPFNTLKAVIIGQD 60

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH  GQA GL FSVP G++ P SLVN++KEL++D+    P+HG LE W  +GVLLLN V
Sbjct: 61  PYHGPGQAMGLSFSVPQGVKAPSSLVNIFKELKQDLGCSIPSHGNLEKWAIQGVLLLNTV 120

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV   +A SH  +GWE FTD+VI  IS   + +VF+LWG SAQ+K  ++D  +H +LKA
Sbjct: 121 LTVRNHQANSHSKKGWEHFTDAVIKTISQKKEGVVFLLWGNSAQEKSKLIDQTKHHILKA 180

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           AHPS LSA+ GFFGCRHFS+ N+ L + G + + WQ
Sbjct: 181 AHPSGLSANRGFFGCRHFSRTNKLLAQMGISPIEWQ 216


>gi|212640588|ref|YP_002317108.1| uracil-DNA glycosylase [Anoxybacillus flavithermus WK1]
 gi|226725638|sp|B7GMM1|UNG_ANOFW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|212562068|gb|ACJ35123.1| Uracil DNA glycosylase [Anoxybacillus flavithermus WK1]
          Length = 225

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LL+  FQ  +   L++FL  E R  K I+P     F A   TP+  VKVVILG
Sbjct: 5   LKNDWAPLLQEEFQKPYYVKLRQFLKEEYRT-KTIYPDMHDIFNALHYTPYANVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+ +PPSL+N++KELQ+D+    P +G+L  W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVKPGVALPPSLLNIFKELQDDLGCYIPNNGYLLKWAKQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G A SH+G+GWE FTD VI+L++   + +VF+LWG  AQ K+ ++ ++ H ++
Sbjct: 124 TVLTVRRGEANSHKGKGWEYFTDRVIELVNEKREPVVFILWGRHAQAKKALITNEHHYII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FSK N +LQ+ G+  ++WQI
Sbjct: 184 EAPHPSPFSAARGFFGSRPFSKTNAFLQQTGREPIDWQI 222


>gi|168210540|ref|ZP_02636165.1| uracil-DNA glycosylase [Clostridium perfringens B str. ATCC 3626]
 gi|168217533|ref|ZP_02643158.1| uracil-DNA glycosylase [Clostridium perfringens NCTC 8239]
 gi|169343119|ref|ZP_02864144.1| uracil-DNA glycosylase [Clostridium perfringens C str. JGS1495]
 gi|182625210|ref|ZP_02952985.1| uracil-DNA glycosylase [Clostridium perfringens D str. JGS1721]
 gi|169298757|gb|EDS80832.1| uracil-DNA glycosylase [Clostridium perfringens C str. JGS1495]
 gi|170711329|gb|EDT23511.1| uracil-DNA glycosylase [Clostridium perfringens B str. ATCC 3626]
 gi|177909522|gb|EDT71962.1| uracil-DNA glycosylase [Clostridium perfringens D str. JGS1721]
 gi|182380405|gb|EDT77884.1| uracil-DNA glycosylase [Clostridium perfringens NCTC 8239]
          Length = 225

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 149/223 (66%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
             + +  W  LL++ F+ E+  NL++FL++E  K ++I P     F A   TP+  VKVV
Sbjct: 2   AAEFNNDWDDLLKDEFEKEYYLNLRKFLINE-YKTQKIHPSMYDIFNALKFTPYKDVKVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHG  FSV  G++ PPSL N++KEL  D+    P +GFLE W  +G+L
Sbjct: 61  ILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGIL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG+A SH+G+GWE FTD VI+L++   + IVF+LWG +A  K+ ++ +  H
Sbjct: 121 LLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNPIH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++K+ HPSPLSA+ GFFG + FSK N +L    K  ++WQIP
Sbjct: 181 KIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIP 223


>gi|261495069|ref|ZP_05991536.1| uracil-DNA glycosylase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309311|gb|EEY10547.1| uracil-DNA glycosylase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 239

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 144/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + + +++ +E+  GK I+P  +  F AF +T F+ VKVVILGQD
Sbjct: 12  KTWTEALGEEKQKAYFQQILQYVHNERLAGKVIYPPQNEVFSAFALTEFSDVKVVILGQD 71

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   +  PPSLVN+YKEL ED+  F  P HG+L  W  +GV +LN 
Sbjct: 72  PYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELSEDIEGFQIPPHGYLIDWAKQGVFMLNT 131

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTVE+GRA SH   GWE FTD VI  ++ +  N+VF+LWG+ AQ+K   +D  RH VL 
Sbjct: 132 SLTVEQGRAGSHSQIGWEIFTDKVIAQLNQHRDNLVFLLWGSHAQRKGQFIDRNRHCVLA 191

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFGC+HFSKAN YL   G + +NWQ+
Sbjct: 192 SPHPSPLSAYRGFFGCKHFSKANNYLISQGISPINWQL 229


>gi|282881895|ref|ZP_06290546.1| uracil-DNA glycosylase [Peptoniphilus lacrimalis 315-B]
 gi|281298304|gb|EFA90749.1| uracil-DNA glycosylase [Peptoniphilus lacrimalis 315-B]
          Length = 222

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W+ LL++ FQ ++ +NL+E L+ E  K  +I+P+ S  F AF+ T +  +KV+ILG
Sbjct: 4   LKNDWQELLKDEFQKDYYKNLRELLIKE-YKNYQIYPKASDIFNAFNYTSYKDLKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN  QAHGL FSV  G+++PPSLVN+YKEL +D+   P   G+L+ W  EG++LLN
Sbjct: 63  QDPYHNPNQAHGLAFSVNKGVKVPPSLVNIYKELHDDLGIGPFKDGYLKSWTQEGIMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
             LTV +    SH   GWE FTD VI++I    + +VF+LWGA A+ K+ ++ +K HLV+
Sbjct: 123 TTLTVRKNAPMSHSKIGWEIFTDRVIEIIDEKKEPVVFILWGAHARSKKKLIKNKNHLVI 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +  HPSPLSA  GFFG + FS+AN++L E G  + +W++
Sbjct: 183 EGPHPSPLSAHRGFFGSKPFSRANKFLMERGIDSPSWEV 221


>gi|254362903|ref|ZP_04978974.1| uracil-DNA glycosylase [Mannheimia haemolytica PHL213]
 gi|153094544|gb|EDN75370.1| uracil-DNA glycosylase [Mannheimia haemolytica PHL213]
          Length = 229

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 144/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W   L    Q  + + + +++ +E+  GK I+P  +  F AF +T F+ VKVVILGQD
Sbjct: 2   KTWTEALGEEKQKAYFQQILQYVHNERLAGKVIYPPQNEVFSAFALTEFSDVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   +  PPSLVN+YKEL ED+  F  P HG+L  W  +GV +LN 
Sbjct: 62  PYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELSEDIEGFQIPPHGYLIDWAKQGVFMLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTVE+GRA SH   GWE FTD VI  ++ +  N+VF+LWG+ AQ+K   +D  RH VL 
Sbjct: 122 SLTVEQGRAGSHSQIGWEIFTDKVIAQLNQHRDNLVFLLWGSHAQRKGQFIDRNRHCVLA 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + HPSPLSA  GFFGC+HFSKAN YL   G + +NWQ+
Sbjct: 182 SPHPSPLSAYRGFFGCKHFSKANNYLISQGISPINWQL 219


>gi|331684230|ref|ZP_08384826.1| uracil-DNA glycosylase [Escherichia coli H299]
 gi|331079182|gb|EGI50384.1| uracil-DNA glycosylase [Escherichia coli H299]
          Length = 229

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|312884381|ref|ZP_07744087.1| uracil-DNA glycosylase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367964|gb|EFP95510.1| uracil-DNA glycosylase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 225

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 142/217 (65%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ ++    Q  + + +  F+ +E+  GK +FP     F AF  T F+ +KVV+LGQDP
Sbjct: 6   TWQDVIGEEKQKGYFKEMMSFVEAERSSGKVVFPPKKDVFNAFKATKFSDIKVVMLGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSLVN+YKEL  D++ F  P HG+L+ W  +GVL+LN V
Sbjct: 66  YHGPNQAHGLCFSVKPGIKPPPSLVNIYKELASDIDGFEIPNHGYLQSWAEQGVLMLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD VI+ I   H   +F+LWG+ AQKK   ++  +H VL  
Sbjct: 126 LTVEQGKAHSHAKSGWEIFTDRVIEAIDQYHTGTIFVLWGSHAQKKGRFINRNKHQVLSG 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGCRHFSK N  L     + ++W++
Sbjct: 186 PHPSPLSAHRGFFGCRHFSKVNAILANKQASPIDWRL 222


>gi|238916820|ref|YP_002930337.1| uracil-DNA glycosylase [Eubacterium eligens ATCC 27750]
 gi|238872180|gb|ACR71890.1| uracil-DNA glycosylase [Eubacterium eligens ATCC 27750]
          Length = 226

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/224 (48%), Positives = 148/224 (66%), Gaps = 1/224 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           M+   I   W   ++  +   + + L  F+ +E  K   ++P     F AF  TP +KVK
Sbjct: 1   MDMSMIDNDWLPAIKEEYSKPYYKELFTFVKNEYSK-YVVYPPADDIFNAFHFTPLSKVK 59

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           V+ILGQDPYHN  QAHGL FSV  G   PPSL N+YKEL +D     P +G+L+ W  +G
Sbjct: 60  VLILGQDPYHNVHQAHGLSFSVLPGEEAPPSLKNIYKELHDDCGCYIPNNGYLKKWADQG 119

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV   +A SH+G GWEQFTD+VI+ ++   + IV+MLWG+ AQ+K  +L++ 
Sbjct: 120 VLLLNTVLTVRAHQANSHQGHGWEQFTDAVINAVNMQDRPIVYMLWGSPAQRKASMLNNP 179

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +HL+LKA HPSPLSA  GFFGCRHFS+ N +L+ +G   ++WQI
Sbjct: 180 KHLILKAPHPSPLSAYRGFFGCRHFSQCNEFLKANGVEPIDWQI 223


>gi|18309247|ref|NP_561181.1| uracil-DNA glycosylase [Clostridium perfringens str. 13]
 gi|25009528|sp|Q8XNR7|UNG_CLOPE RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|18143923|dbj|BAB79971.1| uracil-DNA glycosylase [Clostridium perfringens str. 13]
          Length = 225

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 149/223 (66%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
             + +  W  LL++ F+ E+  NL++FL++E  K ++I P     F A   TP+  VKVV
Sbjct: 2   AAEFNNDWDDLLKDEFKKEYYLNLRKFLINE-YKTQKIHPSMYDIFNALKFTPYKDVKVV 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QAHG  FSV  G++ PPSL N++KEL  D+    P +GFLE W  +G+L
Sbjct: 61  ILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGIL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV EG+A SH+G+GWE FTD VI+L++   + IVF+LWG +A  K+ ++ +  H
Sbjct: 121 LLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNPIH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++K+ HPSPLSA+ GFFG + FSK N +L    K  ++WQIP
Sbjct: 181 KIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIP 223


>gi|313906035|ref|ZP_07839388.1| uracil-DNA glycosylase [Eubacterium cellulosolvens 6]
 gi|313469148|gb|EFR64497.1| uracil-DNA glycosylase [Eubacterium cellulosolvens 6]
          Length = 224

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 146/215 (67%), Gaps = 1/215 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+  L   F  E+ R L   ++ ++    R +P     F AF  TP ++VKVVILGQDPY
Sbjct: 8   WEEELRGEFGKEYYRKLFT-IVKQEYDTHRCYPPSDDIFNAFHFTPLDQVKVVILGQDPY 66

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H  GQAHGL FSV  G+ IPPSLVN+Y+EL++D+    P +G+LE W  +GV++LN VLT
Sbjct: 67  HEEGQAHGLSFSVKPGVAIPPSLVNIYQELKDDLGCYVPDNGYLEKWARQGVMMLNTVLT 126

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           V    A SH+  GWE+FTD+ I  ++N  + +VF+LWG  AQKK+ ++ + +HLVLK+ H
Sbjct: 127 VRAHEANSHKNIGWEEFTDAAIRALANQDRPMVFILWGRPAQKKESMITNPKHLVLKSPH 186

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           PSPLSA  GFFG R FSKAN+YL+ +G   V+WQI
Sbjct: 187 PSPLSAYRGFFGSRPFSKANQYLEANGIAPVDWQI 221


>gi|257468651|ref|ZP_05632745.1| uracil-DNA glycosylase [Fusobacterium ulcerans ATCC 49185]
 gi|317062908|ref|ZP_07927393.1| uracil-DNA glycosylase [Fusobacterium ulcerans ATCC 49185]
 gi|313688584|gb|EFS25419.1| uracil-DNA glycosylase [Fusobacterium ulcerans ATCC 49185]
          Length = 224

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V ++  W  +L++ F+ E+ + L++FL++E  K + I+P+  + F A  +T +   KV+I
Sbjct: 2   VNLNNDWDEILKDEFEKEYYQKLRKFLITE-YKSETIYPKMENIFSALKLTSYKDCKVLI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV +GI+ PPSL N+YKEL++++    P +G+L  W  +G+LL
Sbjct: 61  LGQDPYHGPNQAHGLAFSVNIGIKTPPSLQNMYKELRDELGLYVPNNGYLVPWAEQGILL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV  G A SH   GWE FTDS+I  +++    ++F+LWG +A+KK+  ++  RH 
Sbjct: 121 LNTALTVRAGAANSHSKVGWEIFTDSIIKYLNDREDPVIFVLWGGNARKKKAFINTDRHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+AAHPSPLSA +GFFGC HF K N  L   GK  +NWQI
Sbjct: 181 ILEAAHPSPLSAHNGFFGCGHFKKINEILSSLGKKEINWQI 221


>gi|253689451|ref|YP_003018641.1| uracil-DNA glycosylase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259563559|sp|C6DC11|UNG_PECCP RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|251756029|gb|ACT14105.1| uracil-DNA glycosylase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 228

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  EF+  E+  GK I+P     F AF  T  ++VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQPYFINTLEFVGKERAAGKTIYPPQKDVFNAFRFTELHQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLANIYKELASDIPGFEIPRHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++   + +VF+LWG+ AQKK +++D +RH +LK+
Sbjct: 126 LTVEAGQAHSHANLGWETFTDRVIAALNEQREGLVFLLWGSHAQKKGNIIDQRRHHILKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLEQQGLSPIDW 220


>gi|160874187|ref|YP_001553503.1| uracil-DNA glycosylase [Shewanella baltica OS195]
 gi|160859709|gb|ABX48243.1| uracil-DNA glycosylase [Shewanella baltica OS195]
 gi|315266419|gb|ADT93272.1| uracil-DNA glycosylase [Shewanella baltica OS678]
          Length = 221

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ ++      + + L  F+ +E+R GK ++P  +  F AF +TP  KVKVV++GQDP
Sbjct: 5   TWQTFIDEQRALPYFQQLSAFVDNERRAGKVVYPPEADVFNAFTMTPLEKVKVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSL N+YKEL  D++ F  P+HG L  W  +G+L+LN V
Sbjct: 65  YHGPDQAHGLCFSVKRGIKPPPSLANMYKELATDIDGFTIPSHGDLSAWAEQGILMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FT + ++L++   Q I+F+LWG+ A KK  V++  +H VL  
Sbjct: 125 LTVEQGKAHSHAKAGWEVFTAAALELLNRQTQPIIFVLWGSHAIKKGQVINAPQHQVLTG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS+ N+ L E G+  + WQ+
Sbjct: 185 PHPSPLSAYRGFFGCGHFSQVNQLLLERGEAPIRWQV 221


>gi|152999568|ref|YP_001365249.1| uracil-DNA glycosylase [Shewanella baltica OS185]
 gi|151364186|gb|ABS07186.1| uracil-DNA glycosylase [Shewanella baltica OS185]
          Length = 221

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ ++      + + L  F+ +E+R GK ++P  +  F AF +TP  KVKVV++GQDP
Sbjct: 5   TWQTFIDEQKALPYFQQLSAFVDNERRAGKVVYPPEADVFNAFTMTPLEKVKVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSL N+YKEL  D++ F  P+HG L  W  +G+L+LN V
Sbjct: 65  YHGPDQAHGLCFSVKRGIKPPPSLANMYKELATDIDGFTIPSHGDLSAWAEQGILMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FT + ++L++   Q I+F+LWG+ A KK  V++  +H VL  
Sbjct: 125 LTVEQGKAHSHAKAGWEVFTAAALELLNRQTQPIIFVLWGSHAIKKGQVINAPQHQVLTG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS+ N+ L E G+  + WQ+
Sbjct: 185 PHPSPLSAYRGFFGCGHFSQVNQLLLERGEAPIRWQV 221


>gi|237734000|ref|ZP_04564481.1| uracil-DNA glycosylase [Mollicutes bacterium D7]
 gi|229382826|gb|EEO32917.1| uracil-DNA glycosylase [Coprobacillus sp. D7]
          Length = 225

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 150/215 (69%), Gaps = 1/215 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           +K ++E  FQ ++ + L +F+ +E    K IFP   + FRA ++  +  VKVVILGQDPY
Sbjct: 9   FKDIVEIEFQQDYYKQLHQFVENEYLH-KTIFPPKENIFRALNLCDYENVKVVILGQDPY 67

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H   QA+GL FSV  G+RIPPSLVN+YKELQ+D+  + P HG L  W  +GVLLLN VLT
Sbjct: 68  HELHQANGLAFSVYPGVRIPPSLVNIYKELQDDLGTMIPNHGDLTKWAKQGVLLLNNVLT 127

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           VEEGRA SH G+GWE FT +++  ++   + +VF+LWG +A+ K+  +D  RHLVL++AH
Sbjct: 128 VEEGRANSHSGKGWETFTLNIVKALNKRQKPLVFILWGNNARAKKQYIDTSRHLVLESAH 187

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           PSPLSA  GFFG   FSKAN +L  +G   ++WQI
Sbjct: 188 PSPLSAHRGFFGSHPFSKANEFLIRNGMPMIDWQI 222


>gi|194704478|gb|ACF86323.1| unknown [Zea mays]
          Length = 303

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 148/225 (65%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKR-IFPRGSHYFRAFDITPFNKV 59
           +E + + E+W   L    +  +   L  F+  E+  G   ++P     F A + TPF++V
Sbjct: 79  LEELLVEETWAEALRGELRKSYALELCRFVAHERLHGPLPVYPPPHLVFHALNATPFDRV 138

Query: 60  KVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHE 119
           K VI+GQDPYH  GQA GL FSVP GI+IP SL N++KEL++D+    P+HG LE W  +
Sbjct: 139 KAVIIGQDPYHGPGQAMGLSFSVPEGIKIPSSLGNIFKELKKDLGCTVPSHGNLERWAVQ 198

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GVL+LN VLTV E +A SH  +GWEQFTD VI  IS     +VF+LWG SAQ K  ++D 
Sbjct: 199 GVLMLNTVLTVREHQANSHAKKGWEQFTDEVIKTISQKKSGLVFLLWGNSAQSKTRLIDE 258

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +H +LK+AHPS LSA+ GFFGCRHFSK N  L++ G + ++WQ+
Sbjct: 259 TKHHILKSAHPSGLSANRGFFGCRHFSKTNEILEKLGLSAIDWQL 303


>gi|163789528|ref|ZP_02183966.1| uracil-DNA glycosylase [Carnobacterium sp. AT7]
 gi|159875060|gb|EDP69126.1| uracil-DNA glycosylase [Carnobacterium sp. AT7]
          Length = 227

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 151/222 (68%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +   W  +LE    +   ++LKEFL+ + ++   ++P   H ++AF+ TP+N+VKVVI
Sbjct: 3   LPVQNDWLPILEEQMNTPTYQSLKEFLVHDYQE-TTVYPEMHHIWQAFEWTPYNEVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV   ++ PPSLVN+YKEL+ D++     HG+LE W  +GVLL
Sbjct: 62  LGQDPYHGPDQAHGLSFSVLPNVKTPPSLVNIYKELETDLDIPRANHGYLESWAKQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV +G+A SH+G+GWE  TD+VI  +S   + +VF+LWG  + KK+ ++D  +H+
Sbjct: 122 LNTVLTVRKGQAHSHKGKGWEVLTDAVIKKLSEREKPMVFILWGNPSIKKRALIDETKHV 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           VL + HPSPLSA  GFFG + FSK N  L   G+  +NWQ+P
Sbjct: 182 VLTSVHPSPLSAYRGFFGSKPFSKTNEALINLGEEPINWQLP 223


>gi|149372840|ref|ZP_01891861.1| uracil-DNA glycosylase [unidentified eubacterium SCB49]
 gi|149354537|gb|EDM43102.1| uracil-DNA glycosylase [unidentified eubacterium SCB49]
          Length = 221

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 144/220 (65%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK  L + F  ++ ++L  F+     K    +P  S  F AF+ TPFN+ KVVI
Sbjct: 3   VKIDESWKEQLGSEFTKDYFKDLTSFV-QLAYKNSTCYPPASEIFAAFNYTPFNEAKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  GI  PPSL N++KELQE +    P  G LE W  +GVLL
Sbjct: 62  IGQDPYHGAGQANGLCFSVADGIAHPPSLKNIFKELQEQLGIDVPVSGNLERWAQQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTVE  +A SH+ +GWEQFTD+VI  IS   + +VF+LWG  A+KK   ++ ++HL
Sbjct: 122 LNDTLTVEAHQAGSHQKKGWEQFTDAVITKISEEREGLVFLLWGGYAKKKGRKINTEKHL 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA+ G+ FG  HF K N YL E GK  + W
Sbjct: 182 VLTSGHPSPLSANRGYWFGNEHFRKTNEYLLEKGKAPIKW 221


>gi|329118125|ref|ZP_08246837.1| uracil-DNA glycosylase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465785|gb|EGF12058.1| uracil-DNA glycosylase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 264

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 141/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L    Q  + R++ + + +E+  G+ I+P  +  F AF  T F  VK VILGQDP
Sbjct: 48  TWTQALAAEKQQPYFRHILDTVRAERAAGQTIYPPAADVFNAFKATEFAAVKAVILGQDP 107

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV   I +PPSL N+YKEL +D+  F  P HG L+HW  +GVLLLN V
Sbjct: 108 YHGAGQAHGLAFSVRPNIPVPPSLQNIYKELADDLPGFTIPAHGCLQHWAEQGVLLLNTV 167

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+  SH   GWE FTD+VI  ++   +++VF+LWG+ AQKK   +D  RHLVL +
Sbjct: 168 LTVRAGQTHSHAALGWETFTDTVIRRLAQEREHLVFILWGSHAQKKGAFIDRSRHLVLTS 227

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFG   FSK N YL  HG+T ++WQ+
Sbjct: 228 PHPSPLSAYRGFFGSHPFSKTNAYLAAHGQTPIDWQV 264


>gi|170767342|ref|ZP_02901795.1| uracil-DNA glycosylase [Escherichia albertii TW07627]
 gi|170123676|gb|EDS92607.1| uracil-DNA glycosylase [Escherichia albertii TW07627]
          Length = 229

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N  + + +E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFLNTLQTVAAERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPAHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLEQRGEKPIDW 220


>gi|222823170|ref|YP_002574743.1| uracil-DNA glycosylase [Campylobacter lari RM2100]
 gi|254790574|sp|B9KEK7|UNG_CAMLR RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|222538391|gb|ACM63492.1| uracil-DNA glycosylase [Campylobacter lari RM2100]
          Length = 229

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/226 (44%), Positives = 156/226 (69%), Gaps = 1/226 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E +KI ++WK  L++ F   +   +K   ++   +GK I+P  +  F AF++ P   +K
Sbjct: 5   LEKIKIEQTWKEFLKDEFLKPYFLEIKTHYINALNEGKTIYPPANLIFNAFNLAPLQDLK 64

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           +++LGQDPYHN  QA GL FSVP+G++IPPSL+N+YKELQ D+N     HG L  W  +G
Sbjct: 65  IILLGQDPYHNPHQAMGLSFSVPMGVKIPPSLLNIYKELQNDLNIPMAKHGDLSKWAKQG 124

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN++L+VE  + ASH   GW++FTD+VI  +S+  + +VF+LWG  A+ K+ +++ +
Sbjct: 125 VLLLNSILSVEANKPASHAHFGWQKFTDAVISKLSDEKEGLVFLLWGNYAKNKKVLINPQ 184

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           +H +L+AAHPSPL A + F GC+HFSK+N  L + GK+ ++W + L
Sbjct: 185 KHFILEAAHPSPL-ARNAFLGCKHFSKSNEILLKLGKSPIDWNLNL 229


>gi|171318016|ref|ZP_02907188.1| uracil-DNA glycosylase [Burkholderia ambifaria MEX-5]
 gi|171096802|gb|EDT41679.1| uracil-DNA glycosylase [Burkholderia ambifaria MEX-5]
          Length = 304

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 144/221 (65%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VK+VILGQDP
Sbjct: 79  AWRDVLKPFTDSDAYAPLCRFVDDERAAGKTVYP--TDVFRALRLTSPDDVKIVILGQDP 136

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLL
Sbjct: 137 YHGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLL 196

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H V
Sbjct: 197 NTVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCV 256

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL E G+  V+W++P
Sbjct: 257 LEAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPVDWRLP 297


>gi|108758158|ref|YP_629026.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
 gi|108462038|gb|ABF87223.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
          Length = 225

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + E WK  L     S     L+ F+ +E+R+   +FP     F AF +TP+  V+V++LG
Sbjct: 6   LPEDWKQELRAALASPSFHELERFVEAERREAT-VFPSEEDLFSAFRLTPYEDVRVLLLG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+  PPSLVN++KEL+ DV    P  G L  W  +GVLLLN
Sbjct: 65  QDPYHGPGQAHGLAFSVKPGVAPPPSLVNMFKELESDVGVPRPKDGSLIPWARQGVLLLN 124

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV + +  SH G GWE FTD+VI  +S     +VF+LWG  AQKK+ ++D KRH+V+
Sbjct: 125 AVLTVRQAKPNSHAGHGWEDFTDAVIRAVSAKDDPVVFLLWGRYAQKKKKLIDSKRHVVI 184

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +  HPSPLSAS+GFFG R FS  N  L+ HG+  ++W++
Sbjct: 185 EGTHPSPLSASNGFFGSRPFSAVNEALESHGRPPIDWRL 223


>gi|300361315|ref|ZP_07057492.1| uracil-DNA glycosylase [Lactobacillus gasseri JV-V03]
 gi|300353934|gb|EFJ69805.1| uracil-DNA glycosylase [Lactobacillus gasseri JV-V03]
          Length = 245

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F SE  + L +FL SE +  K+IFP   H F AF +T F   KVVILG
Sbjct: 19  IGNDWDEILAPAFDSEQYQKLHDFLKSEYQT-KQIFPDMYHIFTAFKLTSFADTKVVILG 77

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  IP  HG+L+ W  +GVLLLN
Sbjct: 78  QDPYHNPGQATGMSFSVNPGVALPPSLKNIYKELYDDVGAIPVNHGYLKKWADQGVLLLN 137

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  H+G+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D ++++++
Sbjct: 138 AVLTVPYGNANGHQGKGWEIVTDAAIKALSDRGK-VVFILWGRFAQNKIPLIDEEKNVII 196

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 197 KSAHPSPFSADRGFFGSRPFSRCNDALTKFGESPIDWQLP 236


>gi|167756015|ref|ZP_02428142.1| hypothetical protein CLORAM_01535 [Clostridium ramosum DSM 1402]
 gi|167704007|gb|EDS18586.1| hypothetical protein CLORAM_01535 [Clostridium ramosum DSM 1402]
          Length = 219

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 150/215 (69%), Gaps = 1/215 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           +K ++E  FQ ++ + L +F+ +E    K IFP   + FRA ++  +  VKVVILGQDPY
Sbjct: 3   FKDIVEIEFQQDYYKQLHQFVENEYLH-KTIFPPKENIFRALNLCDYENVKVVILGQDPY 61

Query: 70  HNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLT 129
           H   QA+GL FSV  G+RIPPSLVN+YKELQ+D+  + P HG L  W  +GVLLLN VLT
Sbjct: 62  HELHQANGLAFSVYPGVRIPPSLVNIYKELQDDLGTMIPNHGDLTKWAKQGVLLLNNVLT 121

Query: 130 VEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAH 189
           VEEGRA SH G+GWE FT +++  ++   + +VF+LWG +A+ K+  +D  RHLVL++AH
Sbjct: 122 VEEGRANSHSGKGWETFTLNIVKALNKRQKPLVFILWGNNARAKKQYIDTSRHLVLESAH 181

Query: 190 PSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           PSPLSA  GFFG   FSKAN +L  +G   ++WQI
Sbjct: 182 PSPLSAHRGFFGSHPFSKANEFLIRNGMPMIDWQI 216


>gi|88858222|ref|ZP_01132864.1| uracil-DNA-glycosylase [Pseudoalteromonas tunicata D2]
 gi|88819839|gb|EAR29652.1| uracil-DNA-glycosylase [Pseudoalteromonas tunicata D2]
          Length = 217

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 145/217 (66%), Gaps = 2/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   +    Q  ++ +   ++ +++R+   ++P  +  F AFD TP   VKVVILGQDP
Sbjct: 2   NWSEFIAQEQQHPYLADTLSYV-AKRREEVEVYPPENLVFSAFDSTPLADVKVVILGQDP 60

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGLCFSV  GI+ PPSLVN+YKEL  D+  F  P HG+L+ W  +GVL+LN V
Sbjct: 61  YHGAGQAHGLCFSVLPGIKPPPSLVNIYKELATDIEGFAIPEHGYLQKWAQQGVLMLNTV 120

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH+  GWEQFTD VI L++   Q I+F+LWGA AQKK   ++   H VL  
Sbjct: 121 LTVEQGQAHSHKHLGWEQFTDRVIALLNAQSQPIIFVLWGAHAQKKGKKINQGVHKVLSG 180

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLS   GF+GC+HFS  N+ LQE G   ++WQ+
Sbjct: 181 PHPSPLSVYRGFYGCKHFSTINQLLQELGNKPIDWQV 217


>gi|291443178|ref|ZP_06582568.1| uracil-DNA glycosylase 2 [Streptomyces roseosporus NRRL 15998]
 gi|291346125|gb|EFE73029.1| uracil-DNA glycosylase 2 [Streptomyces roseosporus NRRL 15998]
          Length = 227

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L    Q  +++ L +F+  E+ KG  ++P     F A D TP+++VKV++LG
Sbjct: 7   LPESWRGVLGEELQKPYVKELADFVEEERAKGP-VYPPREQVFAALDATPYDQVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+R PPSL N+YKE+Q+++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVRTPPSLRNIYKEMQQELGLPIPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+ +GWE+ TD+VI  +++     VF+LWG  AQKK  ++D +RH+V+
Sbjct: 126 AVLTVRGGEANSHKNKGWEKITDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEERHIVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHQPIDWRIP 224


>gi|217964707|ref|YP_002350385.1| uracil-DNA glycosylase [Listeria monocytogenes HCC23]
 gi|217333977|gb|ACK39771.1| uracil-DNA glycosylase [Listeria monocytogenes HCC23]
 gi|307570732|emb|CAR83911.1| uracil-DNA glycosylase [Listeria monocytogenes L99]
          Length = 224

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 148/222 (66%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           +K+   W  LL+N F   +   L++FL  E +  K++FP     F A   T    VKVVI
Sbjct: 2   IKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQT-KKVFPDMYDIFNALKHTACKDVKVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G++IPPSL N+Y EL  D+N   P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHRG+GWE  T+ +I++I+   + +VF+LWG +A++K  +L + +H 
Sbjct: 121 LNTVLTVRAGQANSHRGQGWEILTNRIIEIINQKEEPVVFLLWGNNAKEKLQLLTNPKHT 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
              + HPSPLSAS GF GC+HFSK N++L+++G   ++WQIP
Sbjct: 181 AFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIP 222


>gi|152977581|ref|YP_001377098.1| uracil-DNA glycosylase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189037434|sp|A7GVE5|UNG_BACCN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|152026333|gb|ABS24103.1| uracil-DNA glycosylase [Bacillus cytotoxicus NVH 391-98]
          Length = 225

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W+ +L   F+  + +NL++FL  E+   + I+P  +  F A   T +   KVVILG
Sbjct: 5   LKNDWEPILGPEFEKPYYQNLRQFL-KEEYSMRVIYPNANDIFNALHYTSYEDTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+R+PPSL N+YKEL+ D+    P HG+L  W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVQPGVRVPPSLQNMYKELKADIGCEIPNHGYLVKWAEQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV +G A SH+G+GWEQFTD VI+L++   + ++F+LWG  AQ K+  + +  H ++
Sbjct: 124 TVLTVRQGEANSHKGKGWEQFTDRVIELLNEREKPVIFILWGRHAQAKKKRITNPNHYII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++ HPSPLSAS GFFG + FSK NR+L   G+  ++WQIP
Sbjct: 184 ESVHPSPLSASRGFFGSKPFSKVNRFLSSIGEKEIDWQIP 223


>gi|16271993|ref|NP_438191.1| uracil-DNA glycosylase [Haemophilus influenzae Rd KW20]
 gi|260580678|ref|ZP_05848505.1| uracil-DNA glycosylase [Haemophilus influenzae RdAW]
 gi|1174879|sp|P43731|UNG_HAEIN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|1572962|gb|AAC21696.1| uracil DNA glycosylase (ung) [Haemophilus influenzae Rd KW20]
 gi|260092740|gb|EEW76676.1| uracil-DNA glycosylase [Haemophilus influenzae RdAW]
          Length = 219

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/192 (56%), Positives = 135/192 (70%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RASGKTIYPPQEDVFNAFKYTAFEDVKVVILGQDPYHGPNQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P++G+L  W  +GVLLLN VLTVE G A SH   GWE+FTD VI 
Sbjct: 88  NIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIA 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RHLVL A HPSPLSA  GFFGCRHFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQMIDRTRHLVLTAPHPSPLSAHRGFFGCRHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + HG   ++WQI
Sbjct: 208 ESHGIKPIDWQI 219


>gi|172059519|ref|YP_001807171.1| uracil-DNA glycosylase [Burkholderia ambifaria MC40-6]
 gi|171992036|gb|ACB62955.1| uracil-DNA glycosylase [Burkholderia ambifaria MC40-6]
          Length = 304

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 144/221 (65%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VK+VILGQDP
Sbjct: 79  AWRDVLKPFTDSDAYAPLCRFVDDERAAGKTVYP--TDVFRALRLTSPDDVKIVILGQDP 136

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLL
Sbjct: 137 YHGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLL 196

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H V
Sbjct: 197 NTVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCV 256

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL E G+  V+W++P
Sbjct: 257 LEAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPVDWRLP 297


>gi|239939749|ref|ZP_04691686.1| uracil-DNA glycosylase [Streptomyces roseosporus NRRL 15998]
 gi|239986232|ref|ZP_04706896.1| uracil-DNA glycosylase [Streptomyces roseosporus NRRL 11379]
          Length = 229

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L    Q  +++ L +F+  E+ KG  ++P     F A D TP+++VKV++LG
Sbjct: 9   LPESWRGVLGEELQKPYVKELADFVEEERAKGP-VYPPREQVFAALDATPYDQVKVLVLG 67

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+R PPSL N+YKE+Q+++    P +G+L  W  +GVLLLN
Sbjct: 68  QDPYHGEGQGHGLCFSVRPGVRTPPSLRNIYKEMQQELGLPIPDNGYLMPWAEQGVLLLN 127

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+ +GWE+ TD+VI  +++     VF+LWG  AQKK  ++D +RH+V+
Sbjct: 128 AVLTVRGGEANSHKNKGWEKITDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEERHIVV 187

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 188 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHQPIDWRIP 226


>gi|120556816|gb|ABM26900.1| Ung [Serratia marcescens]
          Length = 227

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +      F+ +E++ GK I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVIGKEKEQPYFVETLAFVAAERQAGKTIYPPQKDVFNAFRYTELADVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNMYKELATDIPGFERPDHGYLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE GRA SH   GWE FTD VI  ++ N + +VF+LWG+ AQKK + +D  RH VLKA
Sbjct: 126 LTVEGGRAHSHANLGWETFTDKVIAALNENREGVVFLLWGSHAQKKGNFIDRNRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GCRHFS+AN+ L++ G T ++W
Sbjct: 186 PHPSPLSAHRGFLGCRHFSQANQLLEQQGLTPIDW 220


>gi|62185553|ref|YP_220338.1| uracil-DNA glycosylase [Chlamydophila abortus S26/3]
 gi|73920171|sp|Q5L4Q4|UNG_CHLAB RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|62148620|emb|CAH64392.1| uracil-DNA glycosylase [Chlamydophila abortus S26/3]
          Length = 229

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 147/219 (67%), Gaps = 4/219 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW+  LEN +   +M  L+EFL SE  + K I+P   + F A   TPF+ V+VVILGQDP
Sbjct: 13  SWQEQLENEWSQPYMYKLREFLQSEYSQ-KTIYPAKDNIFTALKSTPFDSVRVVILGQDP 71

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           Y   GQAHGL FSVP G+R+PPSLVN++ EL  DV  +  T G L+ W  +G+LLLN VL
Sbjct: 72  YPGEGQAHGLSFSVPQGVRLPPSLVNIFSELHADVG-VKNTTGCLQSWADQGILLLNTVL 130

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL--DHKRHLVLK 186
           TV  G   SH G+GWEQFTD++I  +  N  +++F+LWG +A+K  D+L     +H +L 
Sbjct: 131 TVRAGSPFSHAGQGWEQFTDAIITKLIENRSHVIFVLWGNAARKTCDLLFRSTHKHAILA 190

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           AAHPSPL+A  GFFGC HFSK N  L++  K  +NW++P
Sbjct: 191 AAHPSPLAAHRGFFGCSHFSKINYLLKKLNKPMINWKLP 229


>gi|237732566|ref|ZP_04563047.1| uracil-DNA-glycosylase [Citrobacter sp. 30_2]
 gi|226908105|gb|EEH94023.1| uracil-DNA-glycosylase [Citrobacter sp. 30_2]
          Length = 229

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 140/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N    +  E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFVNTLHTVAGERQSGMTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  PTHG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELEATIPGFTRPTHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDTQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN +L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANEWLEQRGEKPIDW 220


>gi|307132130|ref|YP_003884146.1| uracil-DNA-glycosylase [Dickeya dadantii 3937]
 gi|306529659|gb|ADM99589.1| uracil-DNA-glycosylase [Dickeya dadantii 3937]
          Length = 228

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 144/220 (65%), Gaps = 1/220 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    +  +  N   F+  E+  GK I+P     F AF  T F+ VKVVILGQDP
Sbjct: 6   TWHDVLAQEKELPYFVNTLSFVHQERTAGKVIYPPQKDVFNAFRFTEFHAVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P+HGFL+ W  +GV+LLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNIYKELANDIPGFEIPSHGFLQSWAQQGVMLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE  +A SH   GWE FTD VI+ ++ + + IVF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVEASKAHSHANLGWETFTDKVIEKLNTHREGIVFLLWGSHAQKKGSIIDTQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
            HPSPLSA  GF GC HFS+ N+ L++ G T ++W   LS
Sbjct: 186 PHPSPLSAHRGFLGCHHFSRTNQLLEQQGDTPIDWTPRLS 225


>gi|284800038|ref|ZP_06390499.1| uracil-DNA glycosylase [Neisseria subflava NJ9703]
 gi|284796195|gb|EFC51542.1| uracil-DNA glycosylase [Neisseria subflava NJ9703]
          Length = 216

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 137/204 (67%), Gaps = 1/204 (0%)

Query: 22  HMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFS 81
           + + + E +  E++ G  ++P     F AF  T F  VKVVILGQDPYH  GQAHGL FS
Sbjct: 13  YFQTILEKVRHERQAGITVYPPERDVFNAFRTTEFGNVKVVILGQDPYHGAGQAHGLAFS 72

Query: 82  VPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRG 140
           V   I +PPSLVN+YKEL  D+  F  P HG+L+HW  +GVLLLN VLTV  G A SH  
Sbjct: 73  VQPEIAVPPSLVNIYKELATDIEGFQIPQHGYLQHWAEQGVLLLNTVLTVRAGSAHSHAT 132

Query: 141 RGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFF 200
            GWE FTD VI  +    +++VFMLWG+ AQKK   +D  RHLVL A HPSPLSA  GFF
Sbjct: 133 FGWEAFTDEVIRQLDKEREHLVFMLWGSHAQKKGAFIDRNRHLVLTAPHPSPLSAYRGFF 192

Query: 201 GCRHFSKANRYLQEHGKTTVNWQI 224
           GC+HFS+AN YLQ +G   ++WQ+
Sbjct: 193 GCKHFSQANAYLQANGLKPIDWQV 216


>gi|260816423|ref|XP_002602970.1| hypothetical protein BRAFLDRAFT_287444 [Branchiostoma floridae]
 gi|229288285|gb|EEN58982.1| hypothetical protein BRAFLDRAFT_287444 [Branchiostoma floridae]
          Length = 264

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/218 (49%), Positives = 149/218 (68%), Gaps = 2/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++WK  L+  F+ ++ + ++E L ++  KG+ IFP     F AF++TP +KVKVV+LGQD
Sbjct: 48  DTWKERLKEEFEKDYFKGIEESLSADYAKGEEIFPPKDLIFNAFNLTPIDKVKVVLLGQD 107

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH+  QAHGL FSV  G++IPPSL N+YKEL  D+  F  P HG LE W  EGVLLLNA
Sbjct: 108 PYHDVDQAHGLSFSVRPGVKIPPSLKNIYKELSSDIPGFTAPHHGCLEKWAKEGVLLLNA 167

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
            LTV+  +  SH   GW++FTD+ I  +S++ Q +VF+LWG  A KK+ ++D  +H V+K
Sbjct: 168 TLTVQAHKPNSHAKIGWQKFTDAAIKAVSDHTQGVVFLLWGGFAHKKEKLVDMTKHRVVK 227

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            AHPSPLSAS  F  C+ FS+ N  L+E GK  V+W +
Sbjct: 228 TAHPSPLSASK-FKDCKCFSRVNLALKELGKEEVDWSL 264


>gi|270265314|ref|ZP_06193575.1| uracil-DNA glycosylase [Serratia odorifera 4Rx13]
 gi|270040718|gb|EFA13821.1| uracil-DNA glycosylase [Serratia odorifera 4Rx13]
          Length = 227

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 146/220 (66%), Gaps = 3/220 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +      F+ +E++ GK I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVIGKEKEQPYFHETLAFVAAERQAGKTIYPPQKDVFNAFRYTELADVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P+HG L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVLPGVPAPPSLVNMYKELATDIPGFERPSHGCLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  +++N + +VF+LWG+ AQKK +++D KRH VLKA
Sbjct: 126 LTVERGQAHSHAKLGWETFTDRVIAALNDNREGVVFLLWGSHAQKKGNIIDRKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW--QIP 225
            HPSPLSA  GF GCRHFS+AN+ L++ G   ++W  Q+P
Sbjct: 186 PHPSPLSAHRGFLGCRHFSQANQLLEQQGLKPIDWLPQLP 225


>gi|115350488|ref|YP_772327.1| uracil-DNA glycosylase [Burkholderia ambifaria AMMD]
 gi|115280476|gb|ABI85993.1| Uracil-DNA glycosylase [Burkholderia ambifaria AMMD]
          Length = 304

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 144/221 (65%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VK+VILGQDP
Sbjct: 79  AWRDVLKPFTDSDAYAPLCRFVDDERAAGKTVYP--TDVFRALRLTSPDDVKIVILGQDP 136

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLL
Sbjct: 137 YHGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLL 196

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H V
Sbjct: 197 NTVLTVERGAAASHAKRGWEQCTDTLIHELANRHRGLVFMLWGAHAQAKRALFDASAHCV 256

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GCRHF+ AN YL E G+  V+W++P
Sbjct: 257 LEAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPVDWRLP 297


>gi|238793785|ref|ZP_04637406.1| Uracil-DNA glycosylase [Yersinia intermedia ATCC 29909]
 gi|238726849|gb|EEQ18382.1| Uracil-DNA glycosylase [Yersinia intermedia ATCC 29909]
          Length = 230

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 144/216 (66%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + ++   ++ + +  GK I+P     F AF +T  ++VKVVILGQDP
Sbjct: 8   TWHDVIGLEKEQPYFKDTLAYVAAARSAGKTIYPAQKDVFNAFRLTELDQVKVVILGQDP 67

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 68  YHGPNQAHGLSFSVLPGVPAPPSLVNMYKELATDIPGFERPNHGFLQSWAEQGVLLLNTV 127

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G A SH   GWE FTD VI  ++ +   ++F+LWGA AQKK  ++D +RH +LKA
Sbjct: 128 LTVEAGNAHSHANLGWETFTDKVIAALNEHRDGVIFLLWGAHAQKKGRIIDTRRHFILKA 187

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GC+HFS+AN+ L++ G+  ++WQ
Sbjct: 188 PHPSPLSAHRGFLGCKHFSQANQLLKQQGQQPIDWQ 223


>gi|332991892|gb|AEF01947.1| uracil-DNA glycosylase [Alteromonas sp. SN2]
          Length = 219

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 141/217 (64%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W   L +     + + L + + SE+  GK I+P     F A  +TP  KVKVVILGQDP
Sbjct: 3   TWAQALGSEEDKPYFKALMQKVESEREAGKVIYPPSEDVFNALTMTPLEKVKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV   I+ PPSLVN+YKEL  D+ +F  P HG L  W  +GVLLLN V
Sbjct: 63  YHGPHQAHGLCFSVLPNIKTPPSLVNIYKELANDITDFSIPNHGTLTSWAEQGVLLLNTV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE +TD++I+ I+ + +N+VF+LWG+ AQKK   +   +H VL A
Sbjct: 123 LTVEQGKANSHAKWGWETYTDALIEAINTHAENVVFLLWGSHAQKKGKHIKRTKHCVLHA 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS  N YL   G + + WQ+
Sbjct: 183 PHPSPLSAYRGFFGCHHFSDTNAYLASKGLSPILWQV 219


>gi|325496342|gb|EGC94201.1| uracil-DNA glycosylase [Escherichia fergusonii ECD227]
          Length = 229

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPGHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF   N++L++ G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLTNQWLEQRGEKPIDW 220


>gi|254520841|ref|ZP_05132897.1| uracil-DNA glycosylase [Clostridium sp. 7_2_43FAA]
 gi|226914590|gb|EEH99791.1| uracil-DNA glycosylase [Clostridium sp. 7_2_43FAA]
          Length = 225

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/219 (47%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           ++  W+ LL++ F+ ++ +NL+ FL+SE  K K I+P  +  F A   T +  VKVVILG
Sbjct: 5   LNNDWQQLLQDEFEKDYYQNLRRFLISE-YKSKTIYPDMNDIFNALKFTAYKDVKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGL FSV  G+++PPSL+N+YKEL +D+    P +GFL++W  +GVLLLN
Sbjct: 64  QDPYHGPNQAHGLSFSVNKGVKVPPSLINIYKELHDDLGCYIPNNGFLKNWTDQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SHR  GWE  TD +I L++     IVF+LWG  A  K  ++ +K+H ++
Sbjct: 124 TVLTVRAHEANSHRNMGWEMLTDQIISLLNKREDPIVFILWGNPAIAKSKLITNKKHFII 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            + HPSPLSA  GFFG + FSK N +L+   K  +NWQI
Sbjct: 184 TSPHPSPLSAYRGFFGSKPFSKTNEFLKSINKKPINWQI 222


>gi|219685396|ref|ZP_03540215.1| uracil-DNA glycosylase [Borrelia garinii Far04]
 gi|219673169|gb|EED30189.1| uracil-DNA glycosylase [Borrelia garinii Far04]
          Length = 223

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKYEYKTKKGKIFPPPKLIFNAFDSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLKIKTLPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  ++ K+ ++D ++H
Sbjct: 123 LINTILTVEEGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNLSRSKKKLIDPEKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HF  A  YL+ H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFIYALNYLKTHNKNKINFQ 223


>gi|332290130|ref|YP_004420982.1| uracil-DNA glycosylase [Gallibacterium anatis UMN179]
 gi|330433026|gb|AEC18085.1| uracil-DNA glycosylase [Gallibacterium anatis UMN179]
          Length = 222

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
            +W+ ++ +     + +++ + +  ++  GK I+P  +  F AF  T F++VKVVILGQD
Sbjct: 2   RTWRDMIGSEKAQPYFQHILQQVQQQRDSGKIIYPPKADVFNAFRYTEFDQVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   ++IPPSL N+YKEL +D+  F  P HG+L  W  +GVLLLN 
Sbjct: 62  PYHGPNQAHGLAFSVRPNVQIPPSLQNIYKELSQDIAGFQIPNHGYLVDWAQQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE+G+A SH   GWE FTD VI  ++ + Q +VF+LWG+ AQKK   +D ++H VL 
Sbjct: 122 VLTVEQGKAHSHANFGWETFTDHVIATLNQHTQGLVFLLWGSHAQKKGQFIDRQKHCVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPLSA  GFFGC HFS  N+YL + GKT +NW +P
Sbjct: 182 APHPSPLSAHRGFFGCHHFSSTNQYLIKQGKTPINWSLP 220


>gi|170700442|ref|ZP_02891449.1| uracil-DNA glycosylase [Burkholderia ambifaria IOP40-10]
 gi|170134654|gb|EDT02975.1| uracil-DNA glycosylase [Burkholderia ambifaria IOP40-10]
          Length = 304

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 143/220 (65%), Gaps = 6/220 (2%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VK+VILGQDPY
Sbjct: 80  WRDVLKPFTDSDAYAPLCRFVDDERAAGKTVYP--TDVFRALRLTSPDDVKIVILGQDPY 137

Query: 70  HN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           H       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLLN
Sbjct: 138 HGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLLN 197

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H VL
Sbjct: 198 TVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDASAHCVL 257

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GF GCRHF+ AN YL E G+  V+W++P
Sbjct: 258 EAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPVDWRLP 297


>gi|319779655|ref|YP_004130568.1| Uracil-DNA glycosylase, family 1 [Taylorella equigenitalis MCE9]
 gi|317109679|gb|ADU92425.1| Uracil-DNA glycosylase, family 1 [Taylorella equigenitalis MCE9]
          Length = 225

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           IH SWKS  ++  +  +  +L    +   R    ++P     F AF +TP  ++KVVILG
Sbjct: 6   IHPSWKSFFDSQIELAYFDSLVS-KIDNARSSTTVYPPEDMVFSAFKLTPLTEIKVVILG 64

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLL 124
           QDPY+N GQAHGL FSV  G+ +PPSL N++ EL+  V NF  P+HG LE W  +GV+LL
Sbjct: 65  QDPYYNEGQAHGLAFSVQHGVALPPSLKNIFTELKNSVDNFKIPSHGCLESWAKQGVMLL 124

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE+G+  SH+  GWE FT + I  I+ + QN+VF+LWG +A+ K  ++D  +HL+
Sbjct: 125 NDVLTVEQGKPNSHKNWGWEIFTTNAISQINFSCQNVVFLLWGGNAKTKSKLIDKSKHLI 184

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L++ HPSPLSA  GFFGC HF+KAN YL  HG + + W++
Sbjct: 185 LESPHPSPLSAYRGFFGCNHFTKANNYLISHGMSPILWEL 224


>gi|126700098|ref|YP_001088995.1| uracil-DNA glycosylase [Clostridium difficile 630]
 gi|254976076|ref|ZP_05272548.1| uracil-DNA glycosylase [Clostridium difficile QCD-66c26]
 gi|255093467|ref|ZP_05322945.1| uracil-DNA glycosylase [Clostridium difficile CIP 107932]
 gi|255101642|ref|ZP_05330619.1| uracil-DNA glycosylase [Clostridium difficile QCD-63q42]
 gi|255307511|ref|ZP_05351682.1| uracil-DNA glycosylase [Clostridium difficile ATCC 43255]
 gi|255315209|ref|ZP_05356792.1| uracil-DNA glycosylase [Clostridium difficile QCD-76w55]
 gi|255517878|ref|ZP_05385554.1| uracil-DNA glycosylase [Clostridium difficile QCD-97b34]
 gi|255650994|ref|ZP_05397896.1| uracil-DNA glycosylase [Clostridium difficile QCD-37x79]
 gi|255656464|ref|ZP_05401873.1| uracil-DNA glycosylase [Clostridium difficile QCD-23m63]
 gi|260684062|ref|YP_003215347.1| uracil-DNA glycosylase [Clostridium difficile CD196]
 gi|260687721|ref|YP_003218855.1| uracil-DNA glycosylase [Clostridium difficile R20291]
 gi|296450090|ref|ZP_06891852.1| uracil-DNA glycosylase [Clostridium difficile NAP08]
 gi|296878471|ref|ZP_06902477.1| uracil-DNA glycosylase [Clostridium difficile NAP07]
 gi|306520864|ref|ZP_07407211.1| uracil-DNA glycosylase [Clostridium difficile QCD-32g58]
 gi|122973612|sp|Q182G9|UNG_CLOD6 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|115251535|emb|CAJ69368.1| Uracil-DNA glycosylase (UDG) [Clostridium difficile]
 gi|260210225|emb|CBA64460.1| uracil-DNA glycosylase [Clostridium difficile CD196]
 gi|260213738|emb|CBE05647.1| uracil-DNA glycosylase [Clostridium difficile R20291]
 gi|296261098|gb|EFH07931.1| uracil-DNA glycosylase [Clostridium difficile NAP08]
 gi|296430555|gb|EFH16396.1| uracil-DNA glycosylase [Clostridium difficile NAP07]
          Length = 224

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 150/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V +   W  LL+  F+ ++  NL++FL+ E+ K ++IFP   + + A   T +   KV+I
Sbjct: 2   VNLGNDWDELLKEEFEKDYYLNLRKFLI-EEYKTRQIFPNMHNIYEALKHTSYKDTKVLI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV   ++ PPSL+N+YKEL++D+    P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHGDNQAHGLAFSVQPQVKTPPSLLNMYKELKDDLGCFIPNNGYLMPWADQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV    A SH+ +GWE FTD VI ++S     ++F+LWG++A+KK +++D  +H 
Sbjct: 121 LNTALTVRAHEANSHKNKGWEIFTDRVISILSEREDPVIFVLWGSNARKKVELIDTSKHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+A HPSPLSAS GFFGC+HFSK N  L++ GK  +NWQI
Sbjct: 181 ILEAPHPSPLSASKGFFGCKHFSKINEILKKLGKEPINWQI 221


>gi|50122211|ref|YP_051378.1| uracil-DNA glycosylase [Pectobacterium atrosepticum SCRI1043]
 gi|73920172|sp|Q6D208|UNG_ERWCT RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|49612737|emb|CAG76187.1| uracil-DNA glycosylase [Pectobacterium atrosepticum SCRI1043]
          Length = 228

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  EF+  E+  GK I+P     F AF  T  ++VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQSYFINTLEFVGKERSAGKTIYPPQKDVFNAFRFTELHQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLGNIYKELASDIPGFEIPRHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++   + +VF+LWG+ AQKK +++D +RH VLK+
Sbjct: 126 LTVEAGQAHSHANLGWETFTDRVIAALNEQREGLVFLLWGSHAQKKGNIIDPQRHHVLKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLEQQGLSAIDW 220


>gi|320333217|ref|YP_004169928.1| Uracil-DNA glycosylase [Deinococcus maricopensis DSM 21211]
 gi|319754506|gb|ADV66263.1| Uracil-DNA glycosylase [Deinococcus maricopensis DSM 21211]
          Length = 239

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 143/217 (65%), Gaps = 2/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW ++L +   S   R L +F++ E R    ++P  +  F A  +TP   VKV+ILGQDP
Sbjct: 19  SWAAVLVDELHSPRFRALMDFVVQE-RAEHAVYPPEADVFNALRLTPLEDVKVLILGQDP 77

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV  G+R+PPSL N+YKELQ DV F+PP HG L  W   GVLLLNAVL
Sbjct: 78  YHGAGQAHGLAFSVQPGVRVPPSLKNIYKELQADVGFVPPKHGHLTAWARRGVLLLNAVL 137

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV  G   SH GRGWE  TD+VI  ++   + +VF+LWGA A+KK  ++   +H+++++A
Sbjct: 138 TVRAGEPNSHAGRGWEHVTDAVIRALNAREERVVFVLWGAYARKKAKLITAPQHVIIESA 197

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLS +  F G + FS+ N  L E G+  ++WQ+P
Sbjct: 198 HPSPLSVAK-FLGTKPFSQVNAALDEAGRGAIDWQLP 233


>gi|260598961|ref|YP_003211532.1| uracil-DNA glycosylase [Cronobacter turicensis z3032]
 gi|260218138|emb|CBA32947.1| Uracil-DNA glycosylase [Cronobacter turicensis z3032]
          Length = 248

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  +  + + +   + +E+  G  I+P     F AF  T    VKVVILGQDP
Sbjct: 25  TWHDVLADEKEKPYFQKILTTVAAERDAGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 84

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+  PPSLVN+YKEL++ V  F  P+HG+LE W  +GV+LLN V
Sbjct: 85  YHGPGQAHGLAFSVRPGVAPPPSLVNMYKELEQSVPGFTRPSHGYLESWARQGVMLLNTV 144

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV+ G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D  RH VL+A
Sbjct: 145 LTVQAGKAHSHANLGWETFTDKVIALINEHREGVVFLLWGSHAQKKGAIIDRDRHHVLQA 204

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
            HPSPLSA  GFFGC HF K N YL+  G+  ++W   L
Sbjct: 205 PHPSPLSAHRGFFGCGHFVKTNAYLESRGEAPIDWMPAL 243


>gi|298243326|ref|ZP_06967133.1| uracil-DNA glycosylase [Ktedonobacter racemifer DSM 44963]
 gi|297556380|gb|EFH90244.1| uracil-DNA glycosylase [Ktedonobacter racemifer DSM 44963]
          Length = 225

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 149/222 (67%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + I ESW  +L    + ++ + L+ F+ +E R    +FP     F A  +TP++KV V++
Sbjct: 3   INIPESWHEVLNGELEKDYFKKLEAFVDNE-RAHYEVFPPEEDLFSALRLTPYDKVNVLL 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH+  QAHGLCFSV  GI+ PPSLVN++KEL+ DV F  P +G+L  W  +G+L+
Sbjct: 62  LGQDPYHDNNQAHGLCFSVRPGIKPPPSLVNMFKELRNDVGFQIPNNGYLVPWAEQGILM 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV      SH+  GWE+FTD +I  ++     +VF+LWG  AQKK+ ++D  +H 
Sbjct: 122 LNAVLTVRAHEPNSHKNHGWEKFTDEIIRRVNAKDDQVVFVLWGGYAQKKKALIDTTKHR 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++++AHPSPLSA +GFFG R FS  N  L+E GK  +NWQ+P
Sbjct: 182 IIESAHPSPLSARNGFFGSRPFSAINAALREAGKPEINWQLP 223


>gi|71892316|ref|YP_278050.1| uracil-DNA glycosylase [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
 gi|71796422|gb|AAZ41173.1| uracil-DNA glycosylase [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
          Length = 230

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 142/216 (65%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+ LL       + +N+   +   K+KG  I+P+    F AF  T F  +KVVI+GQDP
Sbjct: 6   NWRFLLSKEKTLPYFQNILFAIEERKKKGITIYPKKKDVFNAFRFTSFESIKVVIIGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHG  FSV  G+  PPSL N+YKEL  D+ +F+ P HG LE W  EGVLLLN++
Sbjct: 66  YHGPNQAHGFAFSVLPGVLPPPSLKNIYKELASDMPDFVIPEHGCLESWAQEGVLLLNSI 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVEEGR+ SH   GWE+FTD +I +++ + + I+F+LWG  AQ K ++++HK+H +  A
Sbjct: 126 LTVEEGRSCSHADIGWERFTDKIISILNTHKEKIIFLLWGKYAQNKGNIINHKKHYIFTA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           +HPSP+SA  GF GC HFSK N  L +  K  +NWQ
Sbjct: 186 SHPSPISAQRGFLGCHHFSKVNILLAQQNKQIINWQ 221


>gi|227889647|ref|ZP_04007452.1| uracil-DNA glycosylase [Lactobacillus johnsonii ATCC 33200]
 gi|227849790|gb|EEJ59876.1| uracil-DNA glycosylase [Lactobacillus johnsonii ATCC 33200]
          Length = 245

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+SE  + L++FL  E+ + K+IFP   H F AF +T F   KVVILG
Sbjct: 19  IGNDWDEVLAPAFESEKYQELRDFL-KEEYQTKQIFPDMYHIFTAFKLTSFADTKVVILG 77

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  +P  HG+L+ W  +GVLLLN
Sbjct: 78  QDPYHNPGQATGMSFSVNPGVPLPPSLKNIYKELYDDVGAVPVNHGYLKKWADQGVLLLN 137

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  HRG+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D  +++++
Sbjct: 138 AVLTVPYGNANGHRGKGWELITDTAIKALSDRGK-VVFILWGKFAQNKIPLIDEGKNVII 196

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 197 KSPHPSPFSADRGFFGSRPFSRCNDALIKFGESPIDWQLP 236


>gi|307244310|ref|ZP_07526425.1| uracil-DNA glycosylase [Peptostreptococcus stomatis DSM 17678]
 gi|306492460|gb|EFM64498.1| uracil-DNA glycosylase [Peptostreptococcus stomatis DSM 17678]
          Length = 224

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  +L + F+ E+   L+EFL SE R  +++FP     F A   T +   KV+I
Sbjct: 2   VNIGNDWDQVLVDEFKKEYYLKLREFLKSEYR-SQQVFPDMYDIFNALKYTSYKGTKVLI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH+ GQAHGL FSV  GI+ PPSL+N+YKEL+E++    P +G+L  W  +GVLL
Sbjct: 61  LGQDPYHDDGQAHGLAFSVKPGIKTPPSLLNMYKELREELGLYIPNNGYLVPWAKQGVLL 120

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN  LTV   +A SH+G GWE FTD+VI  ++   + ++F+LWG++A+ K+ ++D  RH 
Sbjct: 121 LNTALTVRAHQANSHKGMGWETFTDNVISYLNKREEPVIFVLWGSNARSKKKLIDVDRHY 180

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +L+A HPSPLSA  GFFGC HF++ N+ L+  G+  ++WQI
Sbjct: 181 ILEAPHPSPLSAHRGFFGCGHFARVNQILESMGQEPIDWQI 221


>gi|304410434|ref|ZP_07392052.1| uracil-DNA glycosylase [Shewanella baltica OS183]
 gi|307304526|ref|ZP_07584276.1| uracil-DNA glycosylase [Shewanella baltica BA175]
 gi|304350918|gb|EFM15318.1| uracil-DNA glycosylase [Shewanella baltica OS183]
 gi|306911928|gb|EFN42352.1| uracil-DNA glycosylase [Shewanella baltica BA175]
          Length = 221

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ ++      + + L  F+ +E+R GK ++P  +  F AF +TP  KVKVV++GQDP
Sbjct: 5   TWQTFIDEQRALPYFQQLSAFVDNERRAGKVVYPPEADVFNAFTMTPLEKVKVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSL N+YKEL  D++ F  P+HG L  W  + +L+LN V
Sbjct: 65  YHGPDQAHGLCFSVKRGIKPPPSLANMYKELATDIDGFTIPSHGDLSAWAEQEILMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FT +V++L++   Q I+F+LWG+ A KK  V++  +H VL  
Sbjct: 125 LTVEQGKAHSHAKAGWEVFTTAVLELLNRQTQPIIFVLWGSHAIKKGQVINAPQHQVLTG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS+ N+ L E G+  + WQ+
Sbjct: 185 PHPSPLSAYRGFFGCGHFSQVNQLLLERGEAPIRWQV 221


>gi|145352599|ref|XP_001420628.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580863|gb|ABO98921.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 244

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 146/218 (66%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           E W+ +L   F   +   L++FL SE++   +IFP   H FRAFD      VKVVI+GQD
Sbjct: 21  EQWRKVLAQEFTKPYWDKLEKFLESEEKARAKIFPPKQHVFRAFDSCAMEDVKVVIIGQD 80

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           PYH+ GQA GLCFSVP G+++P SL N+YKEL+ D+N   P HG L+ W  +GV LLN  
Sbjct: 81  PYHDDGQAMGLCFSVPRGVKVPSSLHNIYKELKSDLNCKIPMHGDLDKWAKQGVFLLNVS 140

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK-RHLVLK 186
           LTV   +A SH  +GWE FTD+ I  I+ N + +VF+LWG +AQ+K+ ++  +  HL+LK
Sbjct: 141 LTVRAHQANSHSKKGWENFTDAAIREIAKNRKGLVFLLWGKNAQEKEKLISKQNNHLILK 200

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
             HPS LSA  GFFG +HFS+ N++++ +G   ++WQI
Sbjct: 201 CPHPSGLSAHRGFFGSKHFSQCNKFIESNGGEPIDWQI 238


>gi|159901060|ref|YP_001547307.1| uracil-DNA glycosylase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159894099|gb|ABX07179.1| uracil-DNA glycosylase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 225

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/223 (45%), Positives = 154/223 (69%), Gaps = 1/223 (0%)

Query: 3   GVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
            + I   W+ +L +     +  +L+ F+ +E R  +++FP     F A ++T   + KV+
Sbjct: 2   ALTIPALWQPVLADETSKPYWNDLEAFVAAE-RAEQQVFPPEDQVFSALELTSPEQTKVL 60

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           +LGQDPYH  GQAHGLCFSV  GI+ PPSL N++KEL+ D+  + P +G+L  W  +G+L
Sbjct: 61  LLGQDPYHGPGQAHGLCFSVLPGIKAPPSLKNMFKELKTDLGCVVPNNGYLLPWAKQGML 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           ++NAV+TV    A SH+ RGWE+FTD+VI  ++   +++VF+LWGA AQKK  ++D+ RH
Sbjct: 121 MINAVMTVRAHTANSHKNRGWEKFTDAVIRQVNAKPEHVVFVLWGAYAQKKASLIDNSRH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
            ++++AHPSPLSA +GFFG R FSK N  L+ HG++ ++WQIP
Sbjct: 181 TIIQSAHPSPLSADNGFFGSRPFSKINAALEAHGQSQIDWQIP 223


>gi|145641845|ref|ZP_01797420.1| uracil-DNA glycosylase [Haemophilus influenzae R3021]
 gi|145273467|gb|EDK13338.1| uracil-DNA glycosylase [Haemophilus influenzae 22.4-21]
          Length = 219

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 135/192 (70%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RANGKTIYPPQKEVFNAFKYTAFEDVKVVILGQDPYHGANQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P++G+L  W  +GVLLLN VLTVE G A SH   GWE+FTD VI 
Sbjct: 88  NIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIA 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RHLVL A HPSPLSA  GFFGCRHFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQMIDRTRHLVLTAPHPSPLSAHRGFFGCRHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + +G   ++WQI
Sbjct: 208 ESNGMKPIDWQI 219


>gi|307731103|ref|YP_003908327.1| uracil-DNA glycosylase [Burkholderia sp. CCGE1003]
 gi|307585638|gb|ADN59036.1| uracil-DNA glycosylase [Burkholderia sp. CCGE1003]
          Length = 282

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 146/221 (66%), Gaps = 6/221 (2%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ L+   +S+    L  F+  E+  GK I+P  +  FRA  +T  +KVKVVILGQDP
Sbjct: 57  AWRAHLKPFIESDAYAPLCRFVDGERAAGKTIYP--ADVFRALRLTSPDKVKVVILGQDP 114

Query: 69  YHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           YH       QAHGL FSV   +R PPSL N++KE+   +   PP HG L+ W  +GVLLL
Sbjct: 115 YHGEDRGTPQAHGLAFSVAPNVRTPPSLRNIFKEIAASLGHEPPPHGCLDTWAKQGVLLL 174

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTVE   AASH  RGWE+ TD++I  ++  H  +VFMLWGA AQ K+ +L  K H V
Sbjct: 175 NTVLTVERNSAASHAKRGWEKCTDTLIHELAMRHDGLVFMLWGAHAQAKRALLGGKSHYV 234

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           L+A HPSPLSA  GF GC HF+KAN YL EHG+T ++W++P
Sbjct: 235 LEAPHPSPLSAHRGFLGCGHFAKANEYLVEHGRTPIDWRLP 275


>gi|154493762|ref|ZP_02033082.1| hypothetical protein PARMER_03103 [Parabacteroides merdae ATCC
           43184]
 gi|154086512|gb|EDN85557.1| hypothetical protein PARMER_03103 [Parabacteroides merdae ATCC
           43184]
          Length = 220

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 142/219 (64%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESW+  L+  F   +   L  F+ +E R    + P G   F  F+  PF KVKVVI
Sbjct: 3   VKIEESWRKRLQEEFDKPYFEQLVTFVKNEYRSA-HVLPPGHQIFHIFNACPFEKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPY N GQ +G+CFSVP G+ IP SL N++KE+ +D+    PT G L+ W  +GV  
Sbjct: 62  LGQDPYPNPGQYYGVCFSVPQGVPIPGSLANIFKEIHQDLGKPIPTSGNLDRWVEQGVFP 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +N+VLTV      SHR  GWE FTD+VI  +S+  +N+VFMLWG+ A++K  ++D  +HL
Sbjct: 122 MNSVLTVRAHETGSHRNMGWETFTDAVIKKLSDGRENLVFMLWGSYAKEKIALIDTHKHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL   HPSP SA HGFFGC+HFSKAN +LQ  G   ++W
Sbjct: 182 VLTTVHPSPRSADHGFFGCKHFSKANTFLQSKGIQKIDW 220


>gi|42518808|ref|NP_964738.1| uracil-DNA glycosylase [Lactobacillus johnsonii NCC 533]
 gi|73920177|sp|Q74K70|UNG_LACJO RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|41583094|gb|AAS08704.1| uracil-DNA glycosylase [Lactobacillus johnsonii NCC 533]
 gi|329667643|gb|AEB93591.1| uracil-DNA glycosylase [Lactobacillus johnsonii DPC 6026]
          Length = 231

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+SE  + L++FL  E+ + K+IFP   H F AF +T F   KVVILG
Sbjct: 5   IGNDWDEVLAPAFESEKYQELRDFL-KEEYQTKQIFPDMYHIFTAFKLTSFADTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA G+ FSV  G+ +PPSL N+YKEL +DV  +P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHNPGQATGMSFSVNPGVPLPPSLKNIYKELYDDVGAVPVNHGYLKKWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A  HRG+GWE  TD+ I  +S+  + +VF+LWG  AQ K  ++D  +++++
Sbjct: 124 AVLTVPYGNANGHRGKGWELITDTAIKALSDRGK-VVFILWGKFAQNKIPLIDEGKNVII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+ HPSP SA  GFFG R FS+ N  L + G++ ++WQ+P
Sbjct: 183 KSPHPSPFSADRGFFGSRPFSRCNDALIKFGESPIDWQLP 222


>gi|29840739|ref|NP_829845.1| uracil-DNA glycosylase [Chlamydophila caviae GPIC]
 gi|33301679|sp|Q821F7|UNG_CHLCV RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|29835089|gb|AAP05723.1| uracil-DNA glycosylase [Chlamydophila caviae GPIC]
          Length = 229

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 148/219 (67%), Gaps = 4/219 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW+  L+  +   +M  L+EFL SE  +   +FP   + F A   TPF+ V+VVILGQDP
Sbjct: 13  SWQEQLKTEWSQPYMHKLREFLQSEYSQ-TTVFPAKDNIFTALKSTPFDSVRVVILGQDP 71

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           Y   GQAHGL FSVP G+R+PPSL+N+++ELQ D+  I  T G L+ W  +GVLLLN VL
Sbjct: 72  YPGEGQAHGLSFSVPQGVRLPPSLINIFRELQTDLG-IENTTGCLQSWADQGVLLLNTVL 130

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK--RHLVLK 186
           TV  G   SH G+GWEQFTD+++  +  N  +++F+LWG +A+KK D+L H   +H +L 
Sbjct: 131 TVRAGTPFSHAGQGWEQFTDAIVTKLIENRSHVIFVLWGNAARKKCDLLFHSSHKHAILT 190

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           A HPSPL+A  GFFGC HFSK N  L++  K  +NW++P
Sbjct: 191 APHPSPLAAHRGFFGCSHFSKINYLLKKLNKPMINWKLP 229


>gi|32488054|emb|CAE03228.1| OSJNBa0018M05.3 [Oryza sativa Japonica Group]
 gi|222629761|gb|EEE61893.1| hypothetical protein OsJ_16593 [Oryza sativa Japonica Group]
          Length = 303

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 146/225 (64%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGK-RIFPRGSHYFRAFDITPFNKV 59
           +E + + E+W   L       +   L  F+  E+      ++P     F A   TPF++V
Sbjct: 79  LEELLVEETWLEALPGELHKPYALELCRFVAHERLHSPVPVYPPPHLVFHALHATPFDRV 138

Query: 60  KVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHE 119
           K VI+GQDPYH  GQA GL FSVP GI+IP SL N++KELQ+D+    P+HG LE W  +
Sbjct: 139 KAVIIGQDPYHGPGQAMGLSFSVPEGIKIPSSLANIFKELQKDLGCTVPSHGNLERWAVQ 198

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GVL+LN VLTV E +A SH  +GWEQFTD+VI  IS     IVF+LWG SAQ K  ++D 
Sbjct: 199 GVLMLNTVLTVREHQANSHAKKGWEQFTDAVIKTISLKKSGIVFILWGNSAQAKTRLIDE 258

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +H +LK+AHPS LSAS GFFGCRHFSK N+ L+  G + ++WQ+
Sbjct: 259 TKHHILKSAHPSGLSASRGFFGCRHFSKTNQILERLGLSAIDWQL 303


>gi|183599792|ref|ZP_02961285.1| hypothetical protein PROSTU_03300 [Providencia stuartii ATCC 25827]
 gi|188022056|gb|EDU60096.1| hypothetical protein PROSTU_03300 [Providencia stuartii ATCC 25827]
          Length = 226

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ +     + ++   ++ +E++KGK I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVIGSEKTQAYFKDTLAYVANERQKGKIIYPPQQDVFNAFRYTELADVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI+ PPSLVN+YKEL+ D+  F  P HG+L  W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLSFSVLPGIKPPPSLVNMYKELENDIPGFKRPNHGYLLSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VI  I+ + + +VF+LWG+ AQKK  ++D KRH VLKA
Sbjct: 126 LTVEQGNAHSHAHLGWETFTDKVIAAINEHREGVVFLLWGSHAQKKGRIIDTKRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC HFS+ N+ LQ+ G   ++W
Sbjct: 186 PHPSPLSAHRGFLGCGHFSQTNQLLQQQGLEAIDW 220


>gi|227328590|ref|ZP_03832614.1| uracil-DNA glycosylase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 228

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  EF+  E+  GK I+P     F AF  T  ++VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQPYFINTLEFVGKERAAGKTIYPPQKDVFNAFRFTELHQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLGNIYKELASDIPGFEIPRHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++   + ++F+LWG+ AQKK +++D +RH +LK+
Sbjct: 126 LTVEAGQAHSHANLGWETFTDRVIAALNEQREGLIFLLWGSHAQKKGNIIDQQRHHILKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLEQQGMSPIDW 220


>gi|297582946|ref|YP_003698726.1| uracil-DNA glycosylase [Bacillus selenitireducens MLS10]
 gi|297141403|gb|ADH98160.1| uracil-DNA glycosylase [Bacillus selenitireducens MLS10]
          Length = 230

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 148/225 (65%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +E   + E W+  +       + R L  FL SE+ +   +FP  +  F AF  T + +VK
Sbjct: 2   IERTMLPERWQEAVGEEVDQPYFRELARFL-SEEYRENTVFPPATDIFNAFQWTDYQEVK 60

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120
           VVILGQDPYH   QAHG+ FSV  G+ +PPSL N+YKEL+ D+      HG+L  W  EG
Sbjct: 61  VVILGQDPYHGPNQAHGMSFSVRPGVPVPPSLRNMYKELEADLGCPAVDHGYLAPWAEEG 120

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLN VLTV EG   SH+ +GWE+FT+ VI+ ++     +VF+LWGA A+KK  ++DH 
Sbjct: 121 VLLLNTVLTVREGEPKSHQKQGWERFTNRVIESLNEKESPVVFILWGADARKKAAMIDHH 180

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           RHL+L+A HPSPLSA  GFFG R FS+AN +L+++G+  VNW +P
Sbjct: 181 RHLILEAPHPSPLSAYRGFFGSRPFSEANAFLKKNGRGPVNWCLP 225


>gi|145635208|ref|ZP_01790912.1| uracil-DNA glycosylase [Haemophilus influenzae PittAA]
 gi|145267487|gb|EDK07487.1| uracil-DNA glycosylase [Haemophilus influenzae PittAA]
          Length = 219

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 134/192 (69%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RASGKTIYPPQEEVFNAFKYTAFEDVKVVILGQDPYHGANQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P+HG+L  W  +GVLLLN VLTVE G A SH   GWE+FTD VI 
Sbjct: 88  NMYKELTQDISGFQMPSHGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIA 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RHLVL A HPSPLSA  GFFGC HFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQIIDRTRHLVLTAPHPSPLSAHRGFFGCHHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + +G   ++WQI
Sbjct: 208 ESNGMKPIDWQI 219


>gi|261820508|ref|YP_003258614.1| uracil-DNA glycosylase [Pectobacterium wasabiae WPP163]
 gi|261604521|gb|ACX87007.1| uracil-DNA glycosylase [Pectobacterium wasabiae WPP163]
          Length = 228

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  EF+  E+  GK I+P     F AF  T  ++VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQPYFINTLEFVGKERAAGKTIYPPQKDVFNAFRFTELHQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLGNIYKELASDIPGFEIPRHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++   + +VF+LWG+ AQKK +++D +RH +LK+
Sbjct: 126 LTVEAGQAHSHANLGWETFTDRVIAALNEQREGLVFLLWGSHAQKKGNIIDQQRHHILKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLEQQGLSPIDW 220


>gi|299822569|ref|ZP_07054455.1| uracil-DNA glycosylase [Listeria grayi DSM 20601]
 gi|299816098|gb|EFI83336.1| uracil-DNA glycosylase [Listeria grayi DSM 20601]
          Length = 228

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 147/222 (66%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I   W  +L   F+ E+ + L++FL  E    K I+P     F A   T +  VKVVI
Sbjct: 5   VNIGNDWDDVLAEEFEKEYYQELRQFLKYE-YGTKTIYPDMYDIFNALKYTAYKDVKVVI 63

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH   QAHGL FSV  GI  PPSL N+YKEL++D+  + P +G+L  W  +GVL+
Sbjct: 64  LGQDPYHGPNQAHGLSFSVQKGIPTPPSLQNIYKELRDDLTCVIPDNGYLVPWAEQGVLM 123

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN VLTV  G+A SHR +GWE FT+ +I+L++     +V++LWG +A++KQ  L +++  
Sbjct: 124 LNTVLTVRAGQANSHRHKGWETFTNRIIELLNEKEGPVVYLLWGNNAKEKQAFLTNEQQY 183

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +L + HPSPLSA  GF GCRHFS+AN +L +HG+  ++WQIP
Sbjct: 184 ILTSVHPSPLSAHRGFLGCRHFSRANAFLVQHGEQAIDWQIP 225


>gi|226493972|ref|NP_001150773.1| LOC100284406 [Zea mays]
 gi|195641730|gb|ACG40333.1| uracil-DNA glycosylase [Zea mays]
          Length = 303

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 149/225 (66%), Gaps = 1/225 (0%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKR-IFPRGSHYFRAFDITPFNKV 59
           +E + + ++W   L    +  +   L  F+  E+  G   ++P     F A + TPF++V
Sbjct: 79  LEELLVEDTWAEALRGELRKSYALELCRFVAHERLHGPLPVYPPPHLVFHALNATPFDRV 138

Query: 60  KVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHE 119
           K VI+GQDPYH  GQA GL FSVP GI+IP SL N++KEL++D+    P+HG LE W  +
Sbjct: 139 KAVIIGQDPYHGPGQAMGLSFSVPEGIKIPSSLGNIFKELKKDLGCTVPSHGNLERWAVQ 198

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GVL+LN VLTV E +A SH  +GWEQFTD VI  +S     +VF+LWG SAQ K  ++D 
Sbjct: 199 GVLMLNTVLTVREHQANSHAKKGWEQFTDEVIKTVSQKKSGLVFLLWGNSAQSKTRLIDE 258

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +H +LK+AHPS LSA+ GFFGCRHFSK N+ L++ G + ++WQ+
Sbjct: 259 TKHHILKSAHPSGLSANRGFFGCRHFSKTNQILEKLGLSAIDWQL 303


>gi|15805716|ref|NP_294412.1| uracil-DNA glycosylase [Deinococcus radiodurans R1]
 gi|25009544|sp|Q9RWH9|UNG_DEIRA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|73536274|pdb|2BOO|A Chain A, The Crystal Structure Of Uracil-Dna N-Glycosylase (Ung)
           From Deinococcus Radiodurans.
 gi|6458396|gb|AAF10269.1|AE001926_1 uracil-DNA N-glycosylase [Deinococcus radiodurans R1]
          Length = 247

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/223 (48%), Positives = 148/223 (66%), Gaps = 3/223 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + E W+  L   F + +   L +FL  E RK   I+P     F A   TP  +VKV+ILG
Sbjct: 23  LPEDWQEALLPEFSAPYFHELTDFLRQE-RKEYTIYPPAPDVFNALRYTPLGEVKVLILG 81

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLL 124
           QDPYH   QAHGL FSV  G+R+PPSL N+YKEL ED+  F+ P HG+L  W  +GVLLL
Sbjct: 82  QDPYHGPNQAHGLSFSVRPGVRVPPSLRNIYKELTEDIPGFVAPKHGYLRSWAEQGVLLL 141

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV  G+A SH+G+GWE FTD+VI  ++   + +VF+LWG+ A+KK+ ++  K H+V
Sbjct: 142 NAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVV 201

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
           +++ HPSPLS  + FFG R FSK N  L++ G+  V WQ+P +
Sbjct: 202 IESGHPSPLSEQY-FFGTRPFSKTNEALEKAGRGPVEWQLPAT 243


>gi|308069757|ref|YP_003871362.1| Uracil-DNA glycosylase (UDG) [Paenibacillus polymyxa E681]
 gi|305859036|gb|ADM70824.1| Uracil-DNA glycosylase (UDG) [Paenibacillus polymyxa E681]
          Length = 222

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 144/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W  +L    +  +   L+ + L+ + K  +++P     F A  +TPF+  K VILGQDP
Sbjct: 5   DWDDVLREEVEKPYFNELR-YTLAREYKLHKVYPPKEDLFSALKLTPFHLTKAVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV  G+R PPSL+N+YKEL++D+    P  G+L  W  +GVLLLN VL
Sbjct: 64  YHGEGQAHGLSFSVRPGVRTPPSLLNIYKELRDDIGTPIPNQGYLVPWAEQGVLLLNNVL 123

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG+  SH+G GWE+FTD+VI+ I+   Q  VF+LWG+ AQKK   ++  +HLVLK+ 
Sbjct: 124 TVREGQPQSHQGIGWERFTDAVIEAINEREQPAVFILWGSHAQKKASFVNTSKHLVLKSV 183

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPL+A  GFFG + FS+ N +LQEHG   + W+IP
Sbjct: 184 HPSPLAAHRGFFGSKPFSRTNAFLQEHGMEPIRWEIP 220


>gi|227112918|ref|ZP_03826574.1| uracil-DNA glycosylase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 228

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  EF+  E+  GK I+P     F AF  T  ++VKVVILGQDP
Sbjct: 6   TWHDVLAQEKQQPYFINTLEFVGKERAAGKTIYPPQKDVFNAFRFTELHQVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSL N+YKEL  D+  F  P HGFL+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLGNIYKELANDIPGFEIPRHGFLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++   + +VF+LWG+ AQKK +++D +RH +LK+
Sbjct: 126 LTVEAGQAHSHANLGWETFTDRVIAALNEQREGLVFLLWGSHAQKKGNIIDQQRHHILKS 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN+ L++ G + ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANQLLEQQGLSPIDW 220


>gi|261340879|ref|ZP_05968737.1| uracil-DNA glycosylase [Enterobacter cancerogenus ATCC 35316]
 gi|288317310|gb|EFC56248.1| uracil-DNA glycosylase [Enterobacter cancerogenus ATCC 35316]
          Length = 229

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N    + +E++ G+ I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFINTLSTVAAERQAGQTIYPPQKDVFNAFRYTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+ IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGVAIPPSLLNMYKELEATIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINEHREGVVFLLWGSHAQKKGAIIDRQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFG  HF  AN +L++ G+T ++W
Sbjct: 186 PHPSPLSAHRGFFGSNHFVLANEWLEKRGETPIDW 220


>gi|19704561|ref|NP_604123.1| uracil-DNA glycosylase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|25009524|sp|Q8R634|UNG_FUSNN RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|19714849|gb|AAL95422.1| Uracil-DNA glycosylase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 226

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 150/220 (68%), Gaps = 1/220 (0%)

Query: 5   KIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVIL 64
           KI+  WK +LE  F+ E+   LKE  L E+ K   ++P       AF +TP+++VKVV+L
Sbjct: 3   KINNDWKEILEEEFEKEYFIKLKE-TLEEEYKNYTVYPPKRDILNAFFLTPYSEVKVVLL 61

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSV   I+ PPSLVN+YKELQ+D+    P +GFLE W  +GVLLL
Sbjct: 62  GQDPYHQRGQAHGLAFSVNYEIKTPPSLVNMYKELQDDLGLYIPNNGFLEKWSKQGVLLL 121

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N  LTV +  A SH   GW+ FTD+VI  ++   + ++F+LWG +A+ K+  +D  +H +
Sbjct: 122 NTTLTVRDSEANSHSKIGWQTFTDNVIKSLNEREKPVIFILWGNNAKSKEKFIDTNKHYI 181

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LK  HPSPLSA+ GFFGC+HFS+ANR L+  G+  ++WQI
Sbjct: 182 LKGVHPSPLSANKGFFGCKHFSEANRILKNLGEKEIDWQI 221


>gi|206579867|ref|YP_002237078.1| uracil-DNA glycosylase [Klebsiella pneumoniae 342]
 gi|288934041|ref|YP_003438100.1| uracil-DNA glycosylase [Klebsiella variicola At-22]
 gi|238058166|sp|B5XNF8|UNG_KLEP3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|206568925|gb|ACI10701.1| uracil-DNA glycosylase [Klebsiella pneumoniae 342]
 gi|288888770|gb|ADC57088.1| uracil-DNA glycosylase [Klebsiella variicola At-22]
          Length = 229

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N  + +  E++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFLNTLKTVAEERQSGITIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  G+ IPPSL+N+YKEL+  +  F  PTHG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGVAIPPSLLNMYKELEATIPGFTRPTHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVIALINEHCEGVVFLLWGSHAQKKGAIIDRQRHCVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFG  HF + N++L + G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGSNHFVQTNQWLADRGEAPIDW 220


>gi|310642823|ref|YP_003947581.1| uracil-DNA glycosylase [Paenibacillus polymyxa SC2]
 gi|309247773|gb|ADO57340.1| Uracil-DNA glycosylase [Paenibacillus polymyxa SC2]
          Length = 222

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 144/217 (66%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W  +L    +  +   L+ + L+ + K  +++P     F A  +TP++  K VILGQDP
Sbjct: 5   DWDDVLREEVEKPYFNELR-YTLAREYKLHKVYPPKEDLFSALKLTPYHLTKAVILGQDP 63

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV  G+R PPSL N+YKEL++DV    P  G+L  W  +GVLLLN VL
Sbjct: 64  YHGEGQAHGLSFSVRPGVRTPPSLQNIYKELRDDVGTPIPNQGYLVPWAEQGVLLLNNVL 123

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG+  SH+G GWE+FTD+VI+ I+   Q +VF+LWG+ AQKK   ++  +HLVLK+ 
Sbjct: 124 TVREGQPQSHQGIGWERFTDAVIEAINEREQPVVFILWGSHAQKKASFVNTSKHLVLKSV 183

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPL+A  GFFG + FS+ N +LQEHG   + W+IP
Sbjct: 184 HPSPLAAHRGFFGSKPFSRTNAFLQEHGMEPIQWEIP 220


>gi|161502250|ref|YP_001569362.1| uracil-DNA glycosylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189037444|sp|A9MGV9|UNG_SALAR RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|160863597|gb|ABX20220.1| hypothetical protein SARI_00278 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 229

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L +  Q  +  N    +  E++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSLVN+YKEL+  +  F+ P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFVRPPHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+   + +VF+LWG+ AQKK  ++D  RH +LKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQYREGVVFLLWGSHAQKKGAIIDPLRHHILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF+  N++L++HG+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFALTNQWLEQHGEKPIDW 220


>gi|333028485|ref|ZP_08456549.1| putative uracil-DNA glycosylase [Streptomyces sp. Tu6071]
 gi|332748337|gb|EGJ78778.1| putative uracil-DNA glycosylase [Streptomyces sp. Tu6071]
          Length = 269

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 142/220 (64%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +  SW  +L    +  +   L  F+ +E+  G  ++P     F A D TPF  VKV++LG
Sbjct: 49  LPASWSGVLGEELEQPYFAELMAFVAAEREAGP-VYPPQEQVFAALDATPFEDVKVLVLG 107

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G+R+PPSL N+YKE+  ++    P +G+L  W  +GVLLLN
Sbjct: 108 QDPYHGAGQGHGLCFSVRPGVRVPPSLRNIYKEMHAELGIPVPDNGYLMPWAEQGVLLLN 167

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV EG A SH+ +GWE+FTD+VI  +S      VF+LWGA AQKK  ++D +RH+V+
Sbjct: 168 AVLTVREGEANSHKNKGWERFTDAVIRAVSARRDPAVFVLWGAYAQKKLPLIDTERHVVV 227

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ +  L   G   ++W+IP
Sbjct: 228 KGAHPSPLSAKK-FFGSRPFTQIDEALAAQGHKAIDWRIP 266


>gi|254253360|ref|ZP_04946678.1| Uracil DNA glycosylase [Burkholderia dolosa AUO158]
 gi|124895969|gb|EAY69849.1| Uracil DNA glycosylase [Burkholderia dolosa AUO158]
          Length = 303

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 109/224 (48%), Positives = 144/224 (64%), Gaps = 6/224 (2%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +  +W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VKVVILG
Sbjct: 75  LPAAWRDVLKPFIDSDAYAPLCRFVDDERAAGKTVYP--ADVFRALRLTSPDDVKVVILG 132

Query: 66  QDPYHN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGV 121
           QDPYH       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GV
Sbjct: 133 QDPYHGDDRGTPQAHGLAFSVPPAVRPPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGV 192

Query: 122 LLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKR 181
           LLLN VLTVE G AASH  RGWEQ TD++I  ++  H+ +VFMLWGA AQ K+ + D   
Sbjct: 193 LLLNTVLTVERGAAASHAKRGWEQCTDTLIRELAGRHRGLVFMLWGAHAQAKRALFDASE 252

Query: 182 HLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           H VL+A HPSPLSA  GF GCRHF+ AN YL E G+  ++W++P
Sbjct: 253 HCVLEAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPIDWRLP 296


>gi|317050867|ref|YP_004111983.1| uracil-DNA glycosylase [Desulfurispirillum indicum S5]
 gi|316945951|gb|ADU65427.1| uracil-DNA glycosylase [Desulfurispirillum indicum S5]
          Length = 233

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 143/217 (65%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + +SWK+ L    Q    + L ++L    ++   ++P     FRAF +TP+++VKVVI+G
Sbjct: 7   LPDSWKAHLAPLLQEPQCQRLSQYLAQRCQQNIPMYPPREDIFRAFRLTPWDQVKVVIVG 66

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQA+GL FSV  G+ +PPSL N+YKE+Q D    PP  G L+ W  +GVLLLN
Sbjct: 67  QDPYHGPGQANGLAFSVSSGVALPPSLRNIYKEIQADTGSEPPVDGDLQWWARQGVLLLN 126

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G+A SHR +GWE+F++ V+  +S   Q ++F+LWG  AQ+ Q  +D  RH +L
Sbjct: 127 RVLTVEAGKANSHRNKGWERFSEGVLRALSTQKQGVIFVLWGQPAQQLQASIDQDRHHIL 186

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            A HPSPLSA  GF GC HFS+ N  LQ+ G+  ++W
Sbjct: 187 TAPHPSPLSAYRGFLGCGHFSRINAILQQQGQQPIDW 223


>gi|217974481|ref|YP_002359232.1| uracil-DNA glycosylase [Shewanella baltica OS223]
 gi|217499616|gb|ACK47809.1| uracil-DNA glycosylase [Shewanella baltica OS223]
          Length = 221

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++ ++      + + L  F+ +E+R GK ++P  +  F AF +TP  KVKVV++GQDP
Sbjct: 5   TWQTFIDEQKALPYFQQLSAFVDNERRAGKVVYPPEADVFNAFTMTPLEKVKVVLIGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  GI+ PPSL N+YKEL  D+  F  P+HG L  W  +G+L+LN V
Sbjct: 65  YHGPDQAHGLCFSVKRGIKPPPSLANMYKELATDIEGFTIPSHGDLSAWAEQGLLMLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FT + ++L++   Q I+F+LWG+ A KK  V++  +H VL  
Sbjct: 125 LTVEQGKAHSHAKAGWEVFTAAALELLNRQTQPIIFVLWGSHAIKKGQVINAPQHQVLTG 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GFFGC HFS+ N+ L E G+  ++WQ+
Sbjct: 185 PHPSPLSAYRGFFGCGHFSQVNQLLLERGEAPIHWQV 221


>gi|311278487|ref|YP_003940718.1| uracil-DNA glycosylase [Enterobacter cloacae SCF1]
 gi|308747682|gb|ADO47434.1| uracil-DNA glycosylase [Enterobacter cloacae SCF1]
          Length = 229

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 140/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N    + +E++ G  ++P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAGEKQQPYFLNTLTTVANERQSGITVYPPQKDVFNAFRYTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI  PPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIATPPSLLNMYKELEGTIPGFSRPPHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + Q +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINEHRQGVVFLLWGSHAQKKGAIIDRQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L E G+  ++W
Sbjct: 186 PHPSPLSAHRGFFGCNHFVLANQWLAEQGEAPIDW 220


>gi|51598314|ref|YP_072502.1| uracil-DNA glycosylase [Borrelia garinii PBi]
 gi|73920169|sp|Q662W1|UNG_BORGA RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|51572885|gb|AAU06910.1| uracil DNA glycosylase [Borrelia garinii PBi]
          Length = 223

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F   + + L +F+  E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKGYFKKLVKFIKHEYKTKKGKIFPPPKLIFNAFDSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLKIKTLPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+  GWE FTD VI +IS N +NIVFMLWG  A+ K+ +++  +H
Sbjct: 123 LINTILTVEEGKPSSHKDIGWEIFTDEVIKIISKNLENIVFMLWGNLARSKKKLINPTKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA++GF G  HFS A  YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSANNGFLGSNHFSDALNYLKQHNKNKINFQ 223


>gi|194290859|ref|YP_002006766.1| uracil-DNA glycosylase [Cupriavidus taiwanensis LMG 19424]
 gi|193224694|emb|CAQ70705.1| uracil-DNA-glycosylase [Cupriavidus taiwanensis LMG 19424]
          Length = 257

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (64%), Gaps = 15/226 (6%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W++LLE        R L  F+  E+  GK +FP   H F A  +TP + VKVVILGQDP
Sbjct: 32  AWRALLEPCIAVPAWRELAAFVDGERAAGKPVFPH--HVFHALHLTPPDAVKVVILGQDP 89

Query: 69  YHNYG--------QAHGLCFSVPLGIRIPPSLVNVYKELQE----DVNFIPPTHGFLEHW 116
           YH  G        QAHGL FSVP GI++PPSL N++KE+      D N  P T G LE W
Sbjct: 90  YHGTGTVGGVELPQAHGLAFSVPEGIKVPPSLRNIFKEIAAEFGADGNCPPRTSGNLEGW 149

Query: 117 GHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDV 176
             +GVLLLN VLTVE+G+AASH  RGWE  TD +I  ++ +  N+VFMLWG+ AQ K+ +
Sbjct: 150 ARQGVLLLNTVLTVEQGQAASHARRGWEAVTDCLIQHLAASRPNLVFMLWGSHAQAKKPL 209

Query: 177 LDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           L    H VLKA HPSPLSA  GF GC HF +ANR+LQ HG+T V+W
Sbjct: 210 LG-AGHCVLKAPHPSPLSAHRGFLGCGHFREANRWLQAHGRTPVDW 254


>gi|315651648|ref|ZP_07904659.1| uracil-DNA glycosylase [Eubacterium saburreum DSM 3986]
 gi|315486102|gb|EFU76473.1| uracil-DNA glycosylase [Eubacterium saburreum DSM 3986]
          Length = 225

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 107/216 (49%), Positives = 145/216 (67%), Gaps = 2/216 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           WK +LE  F+  + ++L  F+  E      I+P     F A  +TP +++KVVILGQDPY
Sbjct: 8   WKKVLEPEFKKPYYKDLYNFVRQE-YATHIIYPPADKLFEALHLTPLSEIKVVILGQDPY 66

Query: 70  HNYGQAHGLCFSVPLGIR-IPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           H   QAHGL FSVP   R IPPSLVN+YKEL +D+    P +G L  W  +GVL+LN +L
Sbjct: 67  HGENQAHGLSFSVPPSQRRIPPSLVNIYKELADDIGTYIPNNGNLVKWSKQGVLMLNTIL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV      SH+G+GWEQFTD++I +I+   + IVFMLWG++A  K+ +LD+ +HL+L   
Sbjct: 127 TVRAHSPFSHQGKGWEQFTDAIIKIINATDRPIVFMLWGSAAIAKKKMLDNPKHLILTTV 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGC+HFSKAN +L ++    ++WQI
Sbjct: 187 HPSPLSAYKGFFGCKHFSKANEFLSKNNIVPIDWQI 222


>gi|323144431|ref|ZP_08079036.1| uracil-DNA glycosylase [Succinatimonas hippei YIT 12066]
 gi|322415794|gb|EFY06523.1| uracil-DNA glycosylase [Succinatimonas hippei YIT 12066]
          Length = 229

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 118/219 (53%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  L+    ++E  +++  F+   +  G  I+P     F AF  T  +K+KVVILGQDP
Sbjct: 3   TWHDLIGPLKKTESFQHVMSFVAQRRAAGDVIYPADCDIFNAFKYTSPDKLKVVILGQDP 62

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQA GL FSVP+G+ +PPSL N+Y+EL++D+  F  P HG L  W  +GVLLLNAV
Sbjct: 63  YHEPGQAMGLSFSVPVGVPVPPSLRNIYRELKDDMPGFSIPDHGCLIPWARQGVLLLNAV 122

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV+ G A SH  +GWE FTD VI  I++N +N+VFMLWGA+A+ K   +D ++HLVL+ 
Sbjct: 123 LTVKAGEAFSHHNQGWEIFTDGVIKAINDNCENVVFMLWGAAARAKCAHVDRRKHLVLEC 182

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           AHPSPLSA+ GFFGC HFS+AN YL  H KTTVNWQ+PL
Sbjct: 183 AHPSPLSANRGFFGCHHFSRANAYLHAHNKTTVNWQLPL 221


>gi|216263872|ref|ZP_03435866.1| uracil-DNA glycosylase [Borrelia afzelii ACA-1]
 gi|215979916|gb|EEC20738.1| uracil-DNA glycosylase [Borrelia afzelii ACA-1]
          Length = 223

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 148/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLKIKTIPNGNLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+G GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKGIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKKLIDPSKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP S ++GF G  HF     YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSVNNGFLGSNHFINTLDYLKKHNKNKINFQ 223


>gi|187917932|ref|YP_001883495.1| uracil-DNA glycosylase [Borrelia hermsii DAH]
 gi|238689306|sp|B2S1N8|UNG_BORHD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|119860780|gb|AAX16575.1| uracil-DNA glycosylase [Borrelia hermsii DAH]
          Length = 223

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 149/221 (67%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L+  F   + + L  F+ +E K K  +IFP     F AFD  PF  +KVV
Sbjct: 3   VKIEESWKEILKAEFCKGYFKRLVNFIKNEYKTKKGKIFPPPKLIFNAFDSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           ILGQDPYH   QA+GL FSV   I+IPPSL N++KE++  +      +G L  W  +GV 
Sbjct: 63  ILGQDPYHGKRQANGLAFSVNSDIKIPPSLQNIFKEIERSLKIQTIPNGDLTRWATQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN++LTVEE R +SH+  GWE FT+ VI +IS N  NIVFMLWG  A+ K++++D  RH
Sbjct: 123 LLNSILTVEESRPSSHKDIGWEIFTNEVIKIISKNLNNIVFMLWGNFARGKKELIDASRH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP SA +GF G  HFS+A RYL+EH K+ +++Q
Sbjct: 183 LILETSHPSPYSAHNGFLGSNHFSQALRYLKEHNKSPIDFQ 223


>gi|318077580|ref|ZP_07984912.1| uracil-DNA glycosylase [Streptomyces sp. SA3_actF]
          Length = 230

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 141/217 (64%), Gaps = 2/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW  +L    +  +   L  F+ +E+  G  ++P     F A D TPF  VKV++LGQDP
Sbjct: 13  SWSGVLGEELEQPYFAELMAFVAAEREAGP-VYPPQEQVFAALDATPFEDVKVLVLGQDP 71

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQ HGLCFSV  G+R+PPSL N+YKE+  ++    P +G+L  W  +GVLLLNAVL
Sbjct: 72  YHGAGQGHGLCFSVRPGVRVPPSLRNIYKEMHAELGIPVPDNGYLMPWAEQGVLLLNAVL 131

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG A SH+ +GWE+FTD+VI  +S      VF+LWGA AQKK  ++D +RH+V+K A
Sbjct: 132 TVREGEANSHKNKGWERFTDAVIRAVSARRDPAVFVLWGAYAQKKLPLIDTERHVVVKGA 191

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA   FFG R F++ +  L   G   ++W+IP
Sbjct: 192 HPSPLSAKK-FFGSRPFTQIDEALAAQGHKAIDWRIP 227


>gi|111114874|ref|YP_709492.1| uracil-DNA glycosylase [Borrelia afzelii PKo]
 gi|123047080|sp|Q0SPB2|UNG_BORAP RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|110890148|gb|ABH01316.1| uracil DNA glycosylase [Borrelia afzelii PKo]
          Length = 223

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 148/221 (66%), Gaps = 1/221 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSE-KRKGKRIFPRGSHYFRAFDITPFNKVKVV 62
           VKI ESWK +L N F  E+ + L +F+  E K K  +IFP     F AF+  PF  +KVV
Sbjct: 3   VKIEESWKEVLNNEFNKEYFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVV 62

Query: 63  ILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           I+GQDPYH   QA+GL FSV   I+IPPSL N++KE+++ +      +G L+ W  +GV 
Sbjct: 63  IIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLKIKTIPNGDLKRWAIQGVF 122

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           L+N +LTVEEG+ +SH+G GWE FTD VI +IS N +NIVFMLWG  A+ K+ ++D  +H
Sbjct: 123 LINTILTVEEGKPSSHKGIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKKLIDPSKH 182

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+L+ +HPSP S ++GF G  HF     YL++H K  +N+Q
Sbjct: 183 LILETSHPSPYSVNNGFLGSNHFINTLDYLKKHNKNKINFQ 223


>gi|260582068|ref|ZP_05849863.1| uracil-DNA glycosylase [Haemophilus influenzae NT127]
 gi|260094958|gb|EEW78851.1| uracil-DNA glycosylase [Haemophilus influenzae NT127]
          Length = 219

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 107/192 (55%), Positives = 134/192 (69%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RASGKTIYPPQEDVFNAFKYTAFEDVKVVILGQDPYHGANQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P++G+L  W  +GVLLLN VLTVE G A SH   GWE+FTD VI+
Sbjct: 88  NIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIE 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RH VL A HPSPLSA  GFFGC HFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQIIDRTRHFVLTAPHPSPLSAHRGFFGCHHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + HG   ++WQI
Sbjct: 208 ESHGIKPIDWQI 219


>gi|318059873|ref|ZP_07978596.1| uracil-DNA glycosylase [Streptomyces sp. SA3_actG]
          Length = 229

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 141/217 (64%), Gaps = 2/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW  +L    +  +   L  F+ +E+  G  ++P     F A D TPF  VKV++LGQDP
Sbjct: 12  SWSGVLGEELEQPYFAELMAFVAAEREAGP-VYPPQEQVFAALDATPFEDVKVLVLGQDP 70

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQ HGLCFSV  G+R+PPSL N+YKE+  ++    P +G+L  W  +GVLLLNAVL
Sbjct: 71  YHGAGQGHGLCFSVRPGVRVPPSLRNIYKEMHAELGIPVPDNGYLMPWAEQGVLLLNAVL 130

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG A SH+ +GWE+FTD+VI  +S      VF+LWGA AQKK  ++D +RH+V+K A
Sbjct: 131 TVREGEANSHKNKGWERFTDAVIRAVSARRDPAVFVLWGAYAQKKLPLIDTERHVVVKGA 190

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA   FFG R F++ +  L   G   ++W+IP
Sbjct: 191 HPSPLSAKK-FFGSRPFTQIDEALAAQGHKAIDWRIP 226


>gi|297162175|gb|ADI11887.1| uracil-DNA glycosylase [Streptomyces bingchenggensis BCW-1]
          Length = 229

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L       + + L EF+  E+ KG  ++P     F A + TP+++VKV+ILG
Sbjct: 5   LPESWRGVLGEELDKPYFKELTEFVEEERAKGP-VYPPREEVFAALEATPYDQVKVLILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE+Q ++    P +G+L  W  +GVLLLN
Sbjct: 64  QDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMQAELGHPIPDNGYLMPWARQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+G+GWE+FTD+VI  +++     VF+LWG  AQKK  ++D +RH V+
Sbjct: 124 AVLTVRAGEANSHKGKGWEKFTDAVIRAVASRPDPAVFVLWGNYAQKKLPLIDEERHAVV 183

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ +  ++  G   V+W+IP
Sbjct: 184 KGAHPSPLSAKK-FFGSRPFTQIDEAIKAQGHAPVDWRIP 222


>gi|326780680|ref|ZP_08239945.1| Uracil-DNA glycosylase [Streptomyces cf. griseus XylebKG-1]
 gi|326661013|gb|EGE45859.1| Uracil-DNA glycosylase [Streptomyces cf. griseus XylebKG-1]
          Length = 227

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/220 (46%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+++L    Q  +++ L +F+  E+ KG  ++P     F A D TP+ +VKV++LG
Sbjct: 7   LPESWRAVLGEELQKPYVKELADFVEEERAKGP-VYPPREQVFAALDATPYEEVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE+Q+++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMQQELGLPIPDNGYLMPWAEQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+ +GWE+ TD+VI  +++     VF+LWG  AQKK  ++D +RH+V+
Sbjct: 126 AVLTVRGGEANSHKNKGWEKITDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEERHVVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG R F++ N  +   G   ++W+IP
Sbjct: 186 KGAHPSPLSAKK-FFGSRPFTQINEAVAAQGHQPIDWRIP 224


>gi|325281504|ref|YP_004254046.1| Uracil-DNA glycosylase [Odoribacter splanchnicus DSM 20712]
 gi|324313313|gb|ADY33866.1| Uracil-DNA glycosylase [Odoribacter splanchnicus DSM 20712]
          Length = 221

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK+LL+  F   +   L  F+ +E  +  RIFP G   F AF+    +  KVVI
Sbjct: 3   VKIEESWKALLQEEFDKPYFAELIAFVKNEYAQ-TRIFPPGKLIFNAFNHCTVDNTKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSVP GI  PPSL N++KE+ +D+    P  G LE W  +GVLL
Sbjct: 62  LGQDPYHGPGQAHGLCFSVPEGIEQPPSLQNIFKEIHDDLGTPVPRSGNLERWSDQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+ +GWE FTD+VI  I+   +++VF+LWG+ AQ+K   +D  RHL
Sbjct: 122 LNATLTVRAHQAGSHQNKGWETFTDAVIRKIAEKKEHLVFLLWGSYAQRKGAFIDTDRHL 181

Query: 184 VLKAAHPSPLSASH-GFFGCRHFSKANRYLQEHGKTTVNW 222
           VLK  HPSPLSA+  G+FG   FS+ N+YL+EHG   + W
Sbjct: 182 VLKCVHPSPLSANRGGWFGNHQFSRTNQYLREHGLKEIEW 221


>gi|302517837|ref|ZP_07270179.1| uracil-DNA glycosylase [Streptomyces sp. SPB78]
 gi|302426732|gb|EFK98547.1| uracil-DNA glycosylase [Streptomyces sp. SPB78]
          Length = 227

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 141/217 (64%), Gaps = 2/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           SW  +L    +  +   L  F+ +E+  G  ++P     F A D TPF  VKV++LGQDP
Sbjct: 10  SWSGVLGEELEQPYFAELMAFVAAEREAGP-VYPPQEQVFAALDATPFEDVKVLVLGQDP 68

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQ HGLCFSV  G+R+PPSL N+YKE+  ++    P +G+L  W  +GVLLLNAVL
Sbjct: 69  YHGAGQGHGLCFSVRPGVRVPPSLRNIYKEMHAELGIPVPDNGYLMPWAEQGVLLLNAVL 128

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG A SH+ +GWE+FTD+VI  +S      VF+LWGA AQKK  ++D +RH+V+K A
Sbjct: 129 TVREGEANSHKNKGWERFTDAVIRAVSARRDPAVFVLWGAYAQKKLPLIDTERHVVVKGA 188

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA   FFG R F++ +  L   G   ++W+IP
Sbjct: 189 HPSPLSAKK-FFGSRPFTQIDEALAAQGHKAIDWRIP 224


>gi|290961984|ref|YP_003493166.1| uracil-DNA glycosylase [Streptomyces scabiei 87.22]
 gi|260651510|emb|CBG74632.1| uracil-DNA glycosylase (EC 3.2.2.-) [Streptomyces scabiei 87.22]
          Length = 227

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           + ESW+ +L +  Q  + + L EF+  E+ KG  + P     F A D TP+  VKV++LG
Sbjct: 7   LPESWRGVLGDELQQPYFKELTEFVEEERAKGP-VHPPREQVFAALDATPYESVKVLVLG 65

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQ HGLCFSV  G++ PPSL N+YKE+Q ++    P +G+L  W  +GVLLLN
Sbjct: 66  QDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMQAELGTPIPDNGYLMPWAQQGVLLLN 125

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G A SH+G+GWE+FTD+VI  +++     VF+LWG  AQKK  ++D +RH+V+
Sbjct: 126 AVLTVRSGEANSHKGKGWEKFTDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEERHIVV 185

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K AHPSPLSA   FFG + F++ N  +   G   ++W IP
Sbjct: 186 KGAHPSPLSAKK-FFGSQPFTQINEAVARQGHEPIDWTIP 224


>gi|145636778|ref|ZP_01792444.1| uracil-DNA glycosylase [Haemophilus influenzae PittHH]
 gi|145270076|gb|EDK10013.1| uracil-DNA glycosylase [Haemophilus influenzae PittHH]
          Length = 219

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 133/192 (69%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RANGKTIYPPQKEVFNAFKYTAFEDVKVVILGQDPYHGANQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P++G+L  W  +GVLLLN VLTVE G A SH   GWE+FTD VI 
Sbjct: 88  NIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIA 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RH VL A HPSPLSA  GFFGC HFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQMIDRTRHFVLTAPHPSPLSAHRGFFGCHHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + HG   +NWQI
Sbjct: 208 ESHGIKPINWQI 219


>gi|301311454|ref|ZP_07217381.1| uracil-DNA glycosylase [Bacteroides sp. 20_3]
 gi|300830540|gb|EFK61183.1| uracil-DNA glycosylase [Bacteroides sp. 20_3]
          Length = 220

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 105/219 (47%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I ESW+  L+  F   +   L  F+ +E ++   + P GS  F  F+  PF KVKVVI
Sbjct: 3   VRIDESWRKRLQEEFDKPYFEQLVTFVKNEYKQA-HVLPPGSQIFHIFNACPFEKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPY N GQ +G+CFSVP G+ IP SL+N++KE+ +D+    P+ G L+ W  +GV  
Sbjct: 62  LGQDPYPNPGQYYGVCFSVPDGVAIPSSLMNIFKEIYDDLGKPIPSSGNLDRWVSQGVFP 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +N+VLTV   +  SHR RGWE FTD+VI  +S+  +N+VFMLWG+ A+ K  ++D  +HL
Sbjct: 122 MNSVLTVRAHQTGSHRNRGWETFTDAVIKKLSDERENLVFMLWGSYAKAKISLIDTSQHL 181

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL   HPSP SA +GFFGC+HFSKAN +L+  G   ++W
Sbjct: 182 VLTTVHPSPRSAEYGFFGCKHFSKANDFLRGKGIPEIDW 220


>gi|227356268|ref|ZP_03840656.1| uracil-DNA glycosylase [Proteus mirabilis ATCC 29906]
 gi|227163378|gb|EEI48299.1| uracil-DNA glycosylase [Proteus mirabilis ATCC 29906]
          Length = 244

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 142/217 (65%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + + +   +  +++ GK I+P     F AF  TPF  V VVILGQDP
Sbjct: 24  TWHDVIGAEKEKPYFQQILSQVAQQRQAGKIIYPPQEDVFNAFRFTPFENVNVVILGQDP 83

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKEL-QEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL QE  +F  P HG+LE W  +GVLLLN V
Sbjct: 84  YHGPNQAHGLSFSVRPGVPAPPSLVNMYKELEQEYPDFKRPNHGYLESWAQQGVLLLNTV 143

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD+VI+ I+   + ++F+LWGA AQKK   +D  +H +LKA
Sbjct: 144 LTVEKGQAHSHANYGWEVFTDAVIEQINQRREGVIFLLWGAHAQKKGRFIDTNKHFILKA 203

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF + N  L + G+T +NWQ+
Sbjct: 204 PHPSPLSAHRGFLGCGHFKQTNNLLAQQGRTPINWQL 240


>gi|239828653|ref|YP_002951277.1| uracil-DNA glycosylase [Geobacillus sp. WCH70]
 gi|259563558|sp|C5D9T3|UNG_GEOSW RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|239808946|gb|ACS26011.1| uracil-DNA glycosylase [Geobacillus sp. WCH70]
          Length = 224

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W  LLE  F   +   L+EFL  E R  + I+P     F A   TP+ +VKVVILG
Sbjct: 4   LKNDWAPLLEEEFHKPYYIKLREFLKEEYRT-RTIYPDMYDIFNALHYTPYAQVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV  G+ IPPSL N++KEL +D+    P +G+L  W  +GVLLLN
Sbjct: 63  QDPYHGPGQAHGLSFSVKPGVPIPPSLANIFKELHDDLGCYIPNNGYLVKWAKQGVLLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV  G A SH+G+GWE FTD VI+L++     +VF+LWG  AQ K++++ + RH ++
Sbjct: 123 TVLTVRRGEANSHKGKGWEFFTDRVIELVNEKEDPVVFLLWGRHAQAKKELITNPRHHII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSP SA+ GFFG R FS+ N +LQ+ G+  ++WQI
Sbjct: 183 EAPHPSPFSAARGFFGHRPFSRTNAFLQKVGREPIDWQI 221


>gi|288929785|ref|ZP_06423628.1| uracil-DNA glycosylase [Prevotella sp. oral taxon 317 str. F0108]
 gi|288328886|gb|EFC67474.1| uracil-DNA glycosylase [Prevotella sp. oral taxon 317 str. F0108]
          Length = 221

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 148/220 (67%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V+I  SWK  L + F+  + + L EF+  E ++ K  FP     F AF++ PF+KVKVVI
Sbjct: 3   VEIESSWKEQLADEFEKPYFKELSEFVDGEYKQNK-CFPLEKDLFNAFNLCPFHKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPY   GQAHGL FSV  G+  PPSL N++KE+ ED     PT G L  W  +GVLL
Sbjct: 62  IGQDPYPGEGQAHGLSFSVNDGVPFPPSLNNIFKEISEDFKTPIPTSGNLTRWAEQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN +LTV  G + SH+G+GWEQFT++VI  +++  + +VFMLWG  A+KK   +D  +HL
Sbjct: 122 LNTILTVSPGDSNSHKGKGWEQFTNAVIKRLNDECEGLVFMLWGVEARKKGRCIDSNKHL 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           VL +AHPSP + + G  FG +HFS+AN YL+E GK+ +NW
Sbjct: 182 VLTSAHPSPRAVNFGCSFGKKHFSQANEYLRERGKSPINW 221


>gi|197285754|ref|YP_002151626.1| uracil-DNA glycosylase [Proteus mirabilis HI4320]
 gi|259563560|sp|B4F058|UNG_PROMH RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|194683241|emb|CAR43942.1| uracil-DNA glycosylase [Proteus mirabilis HI4320]
          Length = 226

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 142/217 (65%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  + + +   +  +++ GK I+P     F AF  TPF  V VVILGQDP
Sbjct: 6   TWHDVIGAEKEKPYFQQILSQVAQQRQAGKIIYPPQEDVFNAFRFTPFENVNVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKEL-QEDVNFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+  PPSLVN+YKEL QE  +F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGVPAPPSLVNMYKELEQEYPDFKRPNHGYLESWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G+A SH   GWE FTD+VI+ I+   + ++F+LWGA AQKK   +D  +H +LKA
Sbjct: 126 LTVEKGQAHSHANYGWEVFTDAVIEQINQRREGVIFLLWGAHAQKKGRFIDTNKHFILKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            HPSPLSA  GF GC HF + N  L + G+T +NWQ+
Sbjct: 186 PHPSPLSAHRGFLGCGHFKQTNNLLAQQGRTPINWQL 222


>gi|325568808|ref|ZP_08145101.1| uracil-DNA glycosylase [Enterococcus casseliflavus ATCC 12755]
 gi|325157846|gb|EGC70002.1| uracil-DNA glycosylase [Enterococcus casseliflavus ATCC 12755]
          Length = 229

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+  L+  F+  + + L+ FL  E  + ++I P   H + A  +TP++ VKVVILGQDP
Sbjct: 8   DWQEQLQESFEQPYYQQLRAFLKQEYAQ-QKIHPAMDHIYEALKLTPYHDVKVVILGQDP 66

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH   QAHGL FSV  G++IPPSL N+YKEL +D+   P +HG+L  W  +GVLLLN VL
Sbjct: 67  YHGPHQAHGLSFSVQPGVKIPPSLRNIYKELADDLGIAPVSHGYLVPWAQQGVLLLNTVL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV EG+A SH G GWEQ TD++I+ ++   + ++F+LWG  AQKK  +LD  +H+++ A 
Sbjct: 127 TVREGQAYSHHGHGWEQLTDTIIEKLNQREKPVIFVLWGKPAQKKAALLDTSKHIIITAP 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           HPSPLSA  GFFG + FSK N+ L   G+  ++W +P
Sbjct: 187 HPSPLSAHRGFFGSKPFSKINQALLALGEEPISWALP 223


>gi|293394816|ref|ZP_06639106.1| uracil-DNA glycosylase [Serratia odorifera DSM 4582]
 gi|291422567|gb|EFE95806.1| uracil-DNA glycosylase [Serratia odorifera DSM 4582]
          Length = 231

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 144/220 (65%), Gaps = 3/220 (1%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +      F+ +E++ GK I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVIGKEKEQPYFVETLAFVAAERQAGKTIYPPQKDVFNAFRFTELADVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  G+ +PPSLVN+YKEL  D+  F  P+HG L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLAFSVRPGVAVPPSLVNIYKELTSDIAGFERPSHGCLQSWAEQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++ N Q ++F+LWG+ AQKK + +D +RH VLKA
Sbjct: 126 LTVEAGQAHSHARLGWETFTDKVIAALNENRQGVIFLLWGSHAQKKGNFIDRQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW--QIP 225
            HPSPLSA  GF GC+HFS+ N+ L++ G   ++W  Q+P
Sbjct: 186 PHPSPLSAHRGFLGCQHFSQTNQLLEQQGLAPIDWTPQLP 225


>gi|322834139|ref|YP_004214166.1| uracil-DNA glycosylase [Rahnella sp. Y9602]
 gi|321169340|gb|ADW75039.1| uracil-DNA glycosylase [Rahnella sp. Y9602]
          Length = 226

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 140/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++    +  +  +  +F+ +E+  GK I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVIGQEKEQPYFVDTLKFVAAERAAGKTIYPPQQDVFNAFRSTELADVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGL FSV  GI  PPSLVN+YKEL  D+  F  PTHG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLSFSVRPGIPAPPSLVNMYKELATDIPGFERPTHGYLQSWADQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FTD VI  ++ N   IVF+LWG+ AQKK +++D  RH VLKA
Sbjct: 126 LTVEGGQAHSHAKLGWETFTDKVIAALNENRDGIVFLLWGSHAQKKGNIIDRNRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GF GC+HFS+AN  L + G   ++W
Sbjct: 186 PHPSPLSAHRGFLGCKHFSQANALLMQQGLAPIDW 220


>gi|160892956|ref|ZP_02073745.1| hypothetical protein CLOL250_00488 [Clostridium sp. L2-50]
 gi|156865515|gb|EDO58946.1| hypothetical protein CLOL250_00488 [Clostridium sp. L2-50]
          Length = 224

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L+  ++ E+ + L  F+  E    + IFP     F AF +TP +KVK VI+G
Sbjct: 4   ISNDWAPELKPEYKKEYYKELFNFVGHE-YATREIFPPADDIFNAFHLTPLSKVKCVIIG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQAHGL FSV  G+ IPPSL N+Y+EL +D+    P +G+L  W  +GVL+LN
Sbjct: 63  QDPYHNVGQAHGLSFSVKPGVDIPPSLANIYQELHDDLGCYIPNNGYLVKWAEQGVLMLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV   +A SH+G GWEQFTD+ +++++   + IVF+LWG+ AQ+K  +L++  HL+L
Sbjct: 123 AVLTVRAHQANSHQGHGWEQFTDACMEILNRQDRPIVFILWGSYAQRKASMLNNPNHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLS   GF+G + FSK N +L EHG   ++WQI
Sbjct: 183 KAPHPSPLSVYRGFWGSKPFSKTNDFLIEHGVEPIDWQI 221


>gi|260438324|ref|ZP_05792140.1| uracil-DNA glycosylase [Butyrivibrio crossotus DSM 2876]
 gi|292808911|gb|EFF68116.1| uracil-DNA glycosylase [Butyrivibrio crossotus DSM 2876]
          Length = 226

 Score =  224 bits (570), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 144/220 (65%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  ++   F   + + L  F+  E  K   I+P     F AF +TP N VKV+ILG
Sbjct: 4   ISNDWLEVVTPEFTKSYYKKLFNFVKDEYSK-HIIYPPSEDIFNAFHLTPLNSVKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPYHN  QAHGL FSV P    IPPSL N+YKEL  D+    P +G+L  W  +GVLLL
Sbjct: 63  QDPYHNEHQAHGLSFSVLPDQKEIPPSLQNIYKELNSDLGCYIPDNGYLIKWAKQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV    A SHRG GWEQFTD+VI  ++   + IV+MLWG+ AQKK ++LD+ + LV
Sbjct: 123 NTVLTVRAHSANSHRGMGWEQFTDAVIRGLNKLDKPIVYMLWGSPAQKKAEMLDNPKQLV 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           LKA HPSPLSA  GFFGC+HFSKAN +L ++G   ++WQI
Sbjct: 183 LKAPHPSPLSAYRGFFGCKHFSKANEFLLKNGIEPIDWQI 222


>gi|163748539|ref|ZP_02155793.1| uracil-DNA glycosylase [Shewanella benthica KT99]
 gi|161332117|gb|EDQ02794.1| uracil-DNA glycosylase [Shewanella benthica KT99]
          Length = 222

 Score =  224 bits (570), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 144/222 (64%), Gaps = 1/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           + +H +W + +E   + ++ + L++F+  E+  GK IFP     F AF+ TP +KV+VVI
Sbjct: 1   MTVHFNWNTFIEAEKRLDYYQKLQQFVQGERNTGKAIFPPQEEVFTAFEKTPLDKVRVVI 60

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVL 122
           +GQDPYH   QAHGLCFSV  G++ PPSLVN+YKEL  D+  F  P HG L  W  +GVL
Sbjct: 61  IGQDPYHGPNQAHGLCFSVKHGVKTPPSLVNMYKELLTDIAGFQTPDHGHLSSWAEQGVL 120

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           +LN VLTVE+G+A SH   GWE FT  V+  ++     +VF+LWGA A KK  V+  + H
Sbjct: 121 MLNTVLTVEQGKAHSHAKSGWETFTAHVLKQLNEQEMPMVFILWGAHAIKKGKVITSEHH 180

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            +L   HPSPLSA  GFFGC+HFSK N  L   G   ++WQ+
Sbjct: 181 HILSGPHPSPLSAYRGFFGCQHFSKTNALLASLGTKPIDWQV 222


>gi|238923841|ref|YP_002937357.1| uracil-DNA glycosylase [Eubacterium rectale ATCC 33656]
 gi|259563557|sp|C4Z8Z2|UNG_EUBR3 RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|238875516|gb|ACR75223.1| uracil-DNA glycosylase [Eubacterium rectale ATCC 33656]
          Length = 225

 Score =  224 bits (570), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 144/216 (66%), Gaps = 2/216 (0%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W   +   F+  + R+L  F+  E      ++P     F A   TP +KVKV+ILGQDPY
Sbjct: 8   WAKAVGAEFKKPYYRDLYNFVRDE-YATHVVYPPADDIFNAMHFTPLDKVKVLILGQDPY 66

Query: 70  HNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           HN  QAHGL FSV P    IPPSL N+YKEL +D+    P +G+L+ W  +GVLLLN VL
Sbjct: 67  HNVNQAHGLSFSVLPSQKDIPPSLQNIYKELHDDLGCDIPNNGYLKKWADQGVLLLNTVL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV   +A SH+G GWE+FTD++I+ ++   + IV+MLWG  AQ K  +L + +HL+LKA 
Sbjct: 127 TVRAHQANSHQGHGWEKFTDAIIEAVNEQDRPIVYMLWGRPAQSKIPMLTNPKHLILKAP 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSPLSA  GFFGC+HFSKAN +L+EHG   V+WQI
Sbjct: 187 HPSPLSAYRGFFGCKHFSKANEFLKEHGVEPVDWQI 222


>gi|283798916|ref|ZP_06348069.1| uracil-DNA glycosylase [Clostridium sp. M62/1]
 gi|291073379|gb|EFE10743.1| uracil-DNA glycosylase [Clostridium sp. M62/1]
 gi|295092670|emb|CBK78777.1| Uracil-DNA glycosylase [Clostridium cf. saccharolyticum K10]
 gi|295115908|emb|CBL36755.1| Uracil-DNA glycosylase [butyrate-producing bacterium SM4/1]
          Length = 224

 Score =  224 bits (570), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W + L   F+  + + L E +  E  + + I+P     F AF  TP ++VKVVILG
Sbjct: 4   ISNDWLAPLSAEFRKPYYKKLYETVKHE-YETRVIYPDADDIFNAFAFTPLSRVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGLCFSV  G+  PPSLVN+Y+EL +D+    P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHGRGQAHGLCFSVKPGVETPPSLVNIYQELHDDLGCYIPNNGYLKKWADQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV   +A SHRG GWE+FTD+ I  ++   + +VF+LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHQANSHRGIGWEEFTDAAIRALNEQDRPMVFILWGRPAQMKKPMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +A HPSPLSA  GFFG R FS+ N YL+E+G   ++WQI
Sbjct: 183 EAPHPSPLSAFRGFFGSRPFSRTNEYLKENGIEPIDWQI 221


>gi|218264160|ref|ZP_03478044.1| hypothetical protein PRABACTJOHN_03734 [Parabacteroides johnsonii
           DSM 18315]
 gi|218222206|gb|EEC94856.1| hypothetical protein PRABACTJOHN_03734 [Parabacteroides johnsonii
           DSM 18315]
          Length = 224

 Score =  224 bits (570), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 142/219 (64%), Gaps = 1/219 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESW+  L+  F   +   L  F+ +E +K   + P G   F  F+  PF KVKVVI
Sbjct: 7   VKIEESWRKRLQEEFDKPYFEQLVTFVKNEYKKA-HVLPPGHQIFHIFNTCPFEKVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPY N GQ +G+CFSVP GI IP SL N+++E+ +D+    PT G L+ W  +GV  
Sbjct: 66  LGQDPYPNPGQYYGVCFSVPQGIPIPGSLANIFREIHQDLGKPIPTSGNLDRWVEQGVFS 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           +N+VLTV      SHR  GWE FTD+VI  +S+  +N+VFMLWG+ A++K  ++D  +HL
Sbjct: 126 MNSVLTVRAHETGSHRNMGWETFTDAVIKKLSDERENLVFMLWGSYAKEKIALIDTHKHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           VL   HPSP SA HGFFGC+HFSK N +LQ  G   ++W
Sbjct: 186 VLTTVHPSPRSADHGFFGCKHFSKTNAFLQSKGIQGIDW 224


>gi|163756889|ref|ZP_02163997.1| uracil-DNA glycosylase [Kordia algicida OT-1]
 gi|161323125|gb|EDP94466.1| uracil-DNA glycosylase [Kordia algicida OT-1]
          Length = 221

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           VKI ESWK  L+  F+  + + L  F+ SE ++  + FP+G   F AFD  PF+++KVVI
Sbjct: 3   VKIEESWKFHLQEEFEKPYFKELSTFVKSEYQQF-QCFPKGKDIFAAFDHCPFHRLKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+  PPSLVN++KE++ D+   PP  G LE W  +GVLL
Sbjct: 62  IGQDPYHGVGQANGLCFSVNDGVAHPPSLVNIFKEIKRDIGIDPPVSGNLERWAKQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV   +A SH+G+GWE FTD+VI  +S   +N+VF+LWG  A+KK   +D  +H 
Sbjct: 122 LNATLTVRAHQAGSHQGKGWETFTDAVIKTVSEKKENVVFLLWGGFAKKKGAKVDKNKHC 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           VL + HPSPLSA+ G+ F  +HFS+ N YL       + W
Sbjct: 182 VLTSGHPSPLSANRGYWFDNKHFSRCNDYLVSQRIEGIRW 221


>gi|319896440|ref|YP_004134633.1| uracil-DNA-glycosylase [Haemophilus influenzae F3031]
 gi|317431942|emb|CBY80290.1| uracil-DNA-glycosylase [Haemophilus influenzae F3031]
          Length = 219

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 143/218 (65%), Gaps = 1/218 (0%)

Query: 8   ESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQD 67
           ++W  ++    +  + ++  + +   +  GK I+P     F AF  T F  VKVVILGQD
Sbjct: 2   KTWTDVIGKEKEQPYFQHTLQQVHLARASGKTIYPPKEDVFNAFKYTAFEDVKVVILGQD 61

Query: 68  PYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNA 126
           PYH   QAHGL FSV   + IPPSL+N+YKEL +D++ F  P+HG+L  W  +GVLLLN 
Sbjct: 62  PYHGANQAHGLAFSVKPEVAIPPSLLNMYKELTQDISGFQMPSHGYLVKWAEQGVLLLNT 121

Query: 127 VLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLK 186
           VLTVE G A SH   GWE FTD VI  ++ + + +VF+LWG+ AQKK  ++D  RHLVL 
Sbjct: 122 VLTVERGMAHSHANLGWETFTDRVIAALNKHREKLVFLLWGSHAQKKGQIIDRTRHLVLT 181

Query: 187 AAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           A HPSPLSA  GFFGC HFSK N YL+ +G   ++WQI
Sbjct: 182 APHPSPLSAHRGFFGCHHFSKTNSYLESNGMKPIDWQI 219


>gi|288559476|ref|YP_003422962.1| uracil-DNA glycosylase Ung [Methanobrevibacter ruminantium M1]
 gi|288542186|gb|ADC46070.1| uracil-DNA glycosylase Ung [Methanobrevibacter ruminantium M1]
          Length = 227

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W + LE+ F  ++   +KEF+ +E  K K I+P     F AF + P + VKVVILG
Sbjct: 2   IGNDWDNALEDEFNKDYFIKIKEFVEAE-YKTKTIYPPKEEVFNAFKLCPLDNVKVVILG 60

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FS P G  IP SL N++KE++E+ N+  P  G LE W  +GV LLN
Sbjct: 61  QDPYHEKGQAHGLAFSTPEGHPIPRSLKNIFKEIKEEYNYPIPDSGCLESWAKQGVFLLN 120

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVEEG A SH   GW+ FTD+VI +++     IVF+LWG  A+ K++++ +  HLVL
Sbjct: 121 TVLTVEEGNANSHSKCGWQTFTDNVIKILNQQDSPIVFLLWGKQAELKKELITNPNHLVL 180

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
            ++HPSP SA  GFFGC HF  AN +L++ G   ++WQI
Sbjct: 181 ISSHPSPFSARRGFFGCNHFKLANEFLKDKGLEEIDWQI 219


>gi|291562833|emb|CBL41649.1| Uracil-DNA glycosylase [butyrate-producing bacterium SS3/4]
          Length = 225

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 144/219 (65%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   +   F+  + R L E + SE  + K ++P     F AF  TP +KVKVVILG
Sbjct: 4   IANDWLVPMSGEFKKPYYRKLYETVKSE-YETKEVYPAPDDIFNAFAFTPLSKVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH  GQAHGL FSV   + IPPSLVN+YKEL ED     P +G+L+ W  +GV+LLN
Sbjct: 63  QDPYHEPGQAHGLSFSVKPSVEIPPSLVNIYKELHEDCGCYIPNNGYLKKWADQGVMLLN 122

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SH+  GWE+FTD+ I +++   + +VF+LWG  AQ K+ +L + +HL+L
Sbjct: 123 TVLTVRAHAANSHKNIGWEEFTDAAIRVLNEQDRPMVFILWGRPAQMKKPMLTNPKHLIL 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           ++ HPSPLSA  GFFG R FSK N+YL+E+G   ++WQI
Sbjct: 183 ESPHPSPLSAYRGFFGSRPFSKTNKYLKENGIEPIDWQI 221


>gi|46447646|ref|YP_009011.1| uracil-DNA glycosylase [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46401287|emb|CAF24736.1| probable uracil-DNA glycosylase [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 236

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 147/224 (65%), Gaps = 5/224 (2%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKR-IFPRGSHYFRAFDITPFNKVKVVIL 64
           +  SW+ +L+   +  ++ NL  F+ +E       I+P     F AF  TP+ KV+VVI+
Sbjct: 11  LEPSWQKVLKQELEQPYIFNLATFIENEYTSSPSPIYPPHDLIFNAFYNTPYEKVQVVIM 70

Query: 65  GQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           GQDPYH  GQAHGL FSVP GIR PPSL N++KELQ D+    P+HG L  W  +GVLLL
Sbjct: 71  GQDPYHGPGQAHGLSFSVPKGIRPPPSLQNIFKELQTDILLPIPSHGCLLKWAKQGVLLL 130

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKK----QDVLDHK 180
           NA LTV++    SH GRGWE+FTD+ I  +      I+F+LWG SAQ K    ++ ++ K
Sbjct: 131 NATLTVKKSEPLSHHGRGWERFTDAAILQLIERQDPIIFVLWGKSAQDKCRFLKESVNIK 190

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           RH +L AAHPSP SA++GFFGCRHFSK N  L++ GK  ++W +
Sbjct: 191 RHYILTAAHPSPYSAANGFFGCRHFSKINALLEQQGKCPIDWSL 234


>gi|227872077|ref|ZP_03990452.1| uracil-DNA glycosylase [Oribacterium sinus F0268]
 gi|227842078|gb|EEJ52333.1| uracil-DNA glycosylase [Oribacterium sinus F0268]
          Length = 221

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W S L+  FQ  + + L E  + E+ K   IFP     FRA+ + P+ K+KVVILG
Sbjct: 2   IEGQWLSKLQGEFQKPYYKKLYE-TVREEYKHHTIFPPKEKLFRAYSLCPYEKLKVVILG 60

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN+GQA GL FSV  GI  PPSL N++KELQED+    P  G L+ W  +GVLLLN
Sbjct: 61  QDPYHNFGQAQGLSFSVGKGIPFPPSLQNIFKELQEDIGCKIPKSGELDAWAKQGVLLLN 120

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTV    A SHRG GWE+FTD+ I  I    + +V++LWG+SAQ K  ++  KR L+L
Sbjct: 121 TVLTVRAHEANSHRGIGWEEFTDATIRAIEEKAEPVVYILWGSSAQSKAKMIHQKRRLIL 180

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           KA HPSPLS+  GFFG + FS+ N YL++ G+  ++W +
Sbjct: 181 KAPHPSPLSSYRGFFGSKPFSQCNAYLRKEGQEEIDWAL 219


>gi|319650955|ref|ZP_08005090.1| uracil-DNA glycosylase [Bacillus sp. 2_A_57_CT2]
 gi|317397311|gb|EFV78014.1| uracil-DNA glycosylase [Bacillus sp. 2_A_57_CT2]
          Length = 225

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/216 (47%), Positives = 145/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
            W+ +L   F+  +  +L+EFL  E  + + I+PR    F A   T +   K VILGQDP
Sbjct: 8   DWQEILAEEFEKPYYLHLREFLKKEYEE-QTIYPRQEDIFNALQYTAYKDAKAVILGQDP 66

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVL 128
           YH  GQAHGL FSV   +++PPSL N++KE+Q+D+ F  P +G+L  W  EGVLLLN VL
Sbjct: 67  YHGPGQAHGLSFSVQPDVKLPPSLKNIFKEMQDDLGFEVPNNGYLLKWAREGVLLLNTVL 126

Query: 129 TVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAA 188
           TV +G+A SH+G+GWE FTD+VI  ++   + +VF+LWG  AQ+K+ ++D  +H ++K+ 
Sbjct: 127 TVRKGQAHSHKGKGWETFTDTVIQKLNEREKPVVFILWGKPAQEKEVLIDASKHYIVKSP 186

Query: 189 HPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           HPSP SA  GFFG R FS+ N  LQE G+  ++WQI
Sbjct: 187 HPSPFSARKGFFGSRPFSRTNEILQELGEEPIDWQI 222


>gi|258543924|ref|ZP_05704158.1| uracil-DNA glycosylase [Cardiobacterium hominis ATCC 15826]
 gi|258520863|gb|EEV89722.1| uracil-DNA glycosylase [Cardiobacterium hominis ATCC 15826]
          Length = 232

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 107/224 (47%), Positives = 146/224 (65%), Gaps = 2/224 (0%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKV 61
           + V+I   WK+ L + F   +   +K+ L+  K     I+P G   F AF+ TP+++V+V
Sbjct: 10  DDVQIETGWKTALYDEFTKPYFARIKQILIDAKDAHIPIYPPGKLIFNAFNRTPYDRVRV 69

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEG 120
           VILGQDPYH  GQA GL FSVP G+RIPPSL N+YKEL   +  F  P HG L  W  +G
Sbjct: 70  VILGQDPYHQPGQAMGLSFSVPQGVRIPPSLQNIYKELARSIPGFTIPNHGDLSAWADQG 129

Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180
           VLLLNA LTVE G+A SH   GW+ FT++VI+ +S    +++FMLWG  A++K  ++D  
Sbjct: 130 VLLLNASLTVERGKAGSHSRIGWQLFTNAVIEQLSRERSDLIFMLWGNFAKEKIRLIDAD 189

Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           +H +L + HPSPL A +GF GC HF  AN+ L+  G+  +NWQI
Sbjct: 190 KHYILTSVHPSPL-AGNGFIGCSHFLSANQILEARGEAPINWQI 232


>gi|206558800|ref|YP_002229560.1| uracil-DNA glycosylase [Burkholderia cenocepacia J2315]
 gi|198034837|emb|CAR50705.1| uracil-DNA glycosylase [Burkholderia cenocepacia J2315]
          Length = 286

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 143/220 (65%), Gaps = 6/220 (2%)

Query: 10  WKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPY 69
           W+ +L+    S+    L  F+  E+  GK ++P  +  FRA  +T  + VKVVILGQDPY
Sbjct: 62  WRDVLKPFIDSDAYAPLCRFVDDERAAGKTVYP--TDVFRALRLTHPDDVKVVILGQDPY 119

Query: 70  HN----YGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           H       QAHGL FSVP  +R PPSL N++KE+  +     P HG L+ W  +GVLLLN
Sbjct: 120 HGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLLN 179

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
            VLTVE G AASH  RGWEQ TD++I  ++N H+ +VFMLWGA AQ K+ + D   H VL
Sbjct: 180 TVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGAHAQAKRALFDPSEHCVL 239

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +A HPSPLSA  GF GCRHF+ AN YL + G+  ++W++P
Sbjct: 240 EAPHPSPLSAHRGFLGCRHFALANDYLVDAGRAPIDWRLP 279


>gi|302670603|ref|YP_003830563.1| uracil-DNA glycosylase Ung1 [Butyrivibrio proteoclasticus B316]
 gi|302395076|gb|ADL33981.1| uracil-DNA glycosylase Ung1 [Butyrivibrio proteoclasticus B316]
          Length = 226

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   L   F  ++ + L EF+  E+     ++P     F A  +TP   VKV+ILG
Sbjct: 4   ISNDWLPALSGEFHKDYYKKLFEFV-KEEYATHVVYPPSDDIFNALHLTPLKDVKVLILG 62

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPYH  GQAHGL FSV P     PPSLVN+YKEL +D+    P +G+L+ W  +GVL+L
Sbjct: 63  QDPYHEPGQAHGLSFSVLPGKADTPPSLVNIYKELNDDLGCYIPDNGYLKKWADQGVLML 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV   +A SH+GRGWE FTD++I  ++   + IV+MLWG  AQ K+ +L++ +HL+
Sbjct: 123 NTVLTVRAHQANSHKGRGWENFTDAIIRAVNEQDRPIVYMLWGKPAQMKKSMLNNPKHLI 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L+A HPSPLSA  GFFGC+HFS+AN +LQ++G   ++WQI
Sbjct: 183 LEAPHPSPLSAYRGFFGCKHFSQANDFLQKNGLKPIDWQI 222


>gi|94676676|ref|YP_589039.1| uracil-DNA glycosylase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94219826|gb|ABF13985.1| uracil-DNA glycosylase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 222

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W+  +    +  + + +  FL  E+  G  I+P     F AF +T    VKVVI+GQDP
Sbjct: 2   TWQLTIAQEKKQPYFQQILCFLNKERAAGVTIYPPQKDIFNAFSLTELCAVKVVIIGQDP 61

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QA GL FSV  G+ IPPSL+N+YKEL  D++ FI P HG L  W  +G++LLN V
Sbjct: 62  YHGPNQADGLSFSVRPGLPIPPSLMNIYKELANDISSFIIPQHGCLWSWAEQGIMLLNTV 121

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE G+A SH   GWE FT+ VI LI+N  + I+F+LWG  AQKK  ++D KRH +L A
Sbjct: 122 LTVEAGKAYSHANLGWEIFTNKVITLINNLSEGIIFLLWGTKAQKKAQIIDVKRHHILMA 181

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
           +HPSPLSA   FFGCRHFSK N  L++ GKT ++W
Sbjct: 182 SHPSPLSAYLSFFGCRHFSKVNILLKQQGKTPIDW 216


>gi|323435892|ref|ZP_01048777.2| uracil-DNA glycosylase [Dokdonia donghaensis MED134]
 gi|321496207|gb|EAQ40011.2| uracil-DNA glycosylase [Dokdonia donghaensis MED134]
          Length = 221

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 143/220 (65%), Gaps = 2/220 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V I +SWK  L   F+  + ++L  F+  E+    + +P     F AFD  PF+KVKVVI
Sbjct: 3   VNIEDSWKQELTTEFEKPYFKSLTTFV-KEEYATHKCYPPAGEIFSAFDHCPFDKVKVVI 61

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           +GQDPYH  GQA+GLCFSV  G+  PPSL N++KEL+ D+    P  G L+ W  +GVLL
Sbjct: 62  IGQDPYHGAGQANGLCFSVQDGVAHPPSLKNIFKELETDMGLPAPVSGNLDRWAAQGVLL 121

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNA LTV  G A SH+ +GWEQFTD VID +S   +NI+F+LWG  A+KK   +D  +H 
Sbjct: 122 LNATLTVRAGEAGSHQKQGWEQFTDVVIDTLSRKRENIIFLLWGGFAKKKGRKIDASKHF 181

Query: 184 VLKAAHPSPLSASHGF-FGCRHFSKANRYLQEHGKTTVNW 222
           +L + HPSPLSA+ G+ FG +HFSK N  L   G+  +NW
Sbjct: 182 ILLSGHPSPLSANRGYWFGNKHFSKVNEILLSKGEAPINW 221


>gi|94986158|ref|YP_605522.1| uracil-DNA glycosylase [Deinococcus geothermalis DSM 11300]
 gi|254790575|sp|Q1IWN1|UNG_DEIGD RecName: Full=Uracil-DNA glycosylase; Short=UDG
 gi|94556439|gb|ABF46353.1| uracil-DNA glycosylase [Deinococcus geothermalis DSM 11300]
          Length = 245

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 144/222 (64%), Gaps = 2/222 (0%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V +   W  +L       + R L  F+  E+  G  ++P     F A  +TP+  VKV+I
Sbjct: 20  VHLPGDWDEVLRGETSQPYFRELWAFVQREREAGP-VYPAPEDLFSALRLTPYRDVKVLI 78

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGL FSV  G+R+PPSL N+YKEL++DV F PP HG L  W  +GVLL
Sbjct: 79  LGQDPYHGAGQAHGLSFSVRPGVRVPPSLQNIYKELRDDVGFKPPRHGSLVSWARQGVLL 138

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LNAVLTV EG   SH G+GWE FTD++I  ++     +VF+LWGA A+KK  ++   +H+
Sbjct: 139 LNAVLTVREGEPNSHAGKGWESFTDAIIRAVNEKPTRVVFVLWGAYARKKAKLVTQPQHV 198

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           ++++AHPSPLS +  F G R FS+ N  L+  G+T ++WQ+P
Sbjct: 199 IIESAHPSPLSVAK-FLGTRPFSRINAALEAAGETPIDWQLP 239


>gi|225376293|ref|ZP_03753514.1| hypothetical protein ROSEINA2194_01931 [Roseburia inulinivorans DSM
           16841]
 gi|225211939|gb|EEG94293.1| hypothetical protein ROSEINA2194_01931 [Roseburia inulinivorans DSM
           16841]
          Length = 238

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 144/220 (65%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W   ++  F+  + + L +F+  E  K   I+P     F A   TP +KVKV++LG
Sbjct: 17  ITNDWLDEIQGEFKKPYYKALYQFVRDEYSK-TVIYPPADDIFNAMHFTPLSKVKVLLLG 75

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPYHN  QAHGL FSV P    IPPSL N+YKEL +D+    P +G+L+ W  +GVLLL
Sbjct: 76  QDPYHNVNQAHGLSFSVLPEQKEIPPSLQNIYKELHDDLGCYIPNNGYLKKWADQGVLLL 135

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV   +A SH+G GWEQFTD++I  ++   + IV+MLWG  AQ K  +L + +HL+
Sbjct: 136 NTVLTVRAHQANSHQGHGWEQFTDAIIQAVNAQDRPIVYMLWGRPAQSKIPMLTNPKHLI 195

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L A HPSPLSA  GFFGCRHFSKAN +LQ +G   ++WQI
Sbjct: 196 LTAPHPSPLSAYRGFFGCRHFSKANEFLQANGVEPIDWQI 235


>gi|319774970|ref|YP_004137458.1| uracil-DNA-glycosylase [Haemophilus influenzae F3047]
 gi|329123128|ref|ZP_08251698.1| uracil-DNA glycosylase [Haemophilus aegyptius ATCC 11116]
 gi|317449561|emb|CBY85766.1| uracil-DNA-glycosylase [Haemophilus influenzae F3047]
 gi|327471683|gb|EGF17125.1| uracil-DNA glycosylase [Haemophilus aegyptius ATCC 11116]
          Length = 219

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/192 (55%), Positives = 134/192 (69%), Gaps = 1/192 (0%)

Query: 34  KRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLV 93
           +  GK I+P     F AF  T F  VKVVILGQDPYH   QAHGL FSV   + IPPSL+
Sbjct: 28  RANGKTIYPPQEEVFNAFKYTAFEDVKVVILGQDPYHGPNQAHGLAFSVKPEVAIPPSLL 87

Query: 94  NVYKELQEDVN-FIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVID 152
           N+YKEL +D++ F  P++G+L  W  +GVLLLN VLTVE+G A SH   GWE+FTD VI 
Sbjct: 88  NIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVEQGMAHSHANLGWERFTDKVIA 147

Query: 153 LISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYL 212
           +++ + + +VF+LWG+ AQKK  ++D  RH VL A HPSPLSA  GFFGC HFSK N YL
Sbjct: 148 VLNEHREKLVFLLWGSHAQKKGQIIDRTRHFVLTAPHPSPLSAHRGFFGCHHFSKTNSYL 207

Query: 213 QEHGKTTVNWQI 224
           + HG   ++WQI
Sbjct: 208 ESHGIKPIDWQI 219


>gi|313123343|ref|YP_004033602.1| uracil-DNA glycosylase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312279906|gb|ADQ60625.1| Uracil-DNA glycosylase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
          Length = 227

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           I   W  +L   F+S+    L +FL  E +  ++I+P   H F AF +TPF   KVVILG
Sbjct: 5   IGNDWDQVLTPVFESDEYHKLHDFLKKEYQT-RQIYPDMYHIFTAFKLTPFKDTKVVILG 63

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYHN GQA+G+ FSV  G  +PPSL NVYKEL +DV   P  HG+L+ W  +GVLLLN
Sbjct: 64  QDPYHNPGQANGMSFSVMPGTPLPPSLRNVYKELYDDVGAQPVNHGYLKRWADQGVLLLN 123

Query: 126 AVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVL 185
           AVLTV  G+A  H+G+GWE  TD+ I  +S   Q +VF+LWG  AQ K  ++D  +++++
Sbjct: 124 AVLTVPYGQANGHQGKGWEMVTDAAIKALSERGQ-VVFILWGRFAQDKIPLIDQDKNVII 182

Query: 186 KAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K+AHPSP SA+ GFFG R FS+ N  L+E G+  V+WQ+P
Sbjct: 183 KSAHPSPFSANRGFFGSRPFSRCNAALKEFGRAPVDWQLP 222


>gi|126641612|ref|YP_001084596.1| uracil-DNA glycosylase [Acinetobacter baumannii ATCC 17978]
          Length = 205

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 146/203 (71%), Gaps = 1/203 (0%)

Query: 23  MRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSV 82
           M +L++FL  +K+  K I+P     F A +ITP + VKVVILGQDPYH   QA+GL FSV
Sbjct: 1   MDSLRDFLFQQKQAQKTIYPPSKQIFNALNITPLDHVKVVILGQDPYHGPNQANGLSFSV 60

Query: 83  PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRG 142
             G+ +PPSL N++ EL  D+      HG L  W  +GVLLLN+VLTVE G+  SH+ +G
Sbjct: 61  QRGVALPPSLRNIFHELHTDLGVPVSRHGDLTKWAEQGVLLLNSVLTVEAGQPTSHQKQG 120

Query: 143 WEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASH-GFFG 201
           WE+FTD+VID+++   ++IVF+LWGA AQ+K   ++ ++HLVL AAHPSPL+A+  GFFG
Sbjct: 121 WEEFTDAVIDVLNEQREHIVFILWGAYAQRKGQRINREKHLVLTAAHPSPLAANRGGFFG 180

Query: 202 CRHFSKANRYLQEHGKTTVNWQI 224
           C+ FSK N+YL++HG   ++WQ+
Sbjct: 181 CKVFSKTNQYLKQHGIEPIDWQL 203


>gi|325182830|emb|CCA17285.1| uracilDNA glycosylase putative [Albugo laibachii Nc14]
          Length = 284

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 145/222 (65%), Gaps = 4/222 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +H +W +LLE+  Q ++ + L EFL SE  K   ++P     F +    PF+ +KVVI+G
Sbjct: 63  MHPTWYALLESECQKDYFQKLLEFLRSETVK-HTLYPLACDVFSSLRDCPFDALKVVIIG 121

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLN 125
           QDPYH   QAHGLCFS+  G+++PPSL N+  E  EDV+   PTHG L  W  +G+LLLN
Sbjct: 122 QDPYHGPNQAHGLCFSIQNGVQVPPSLRNIINEAIEDVHITKPTHGCLISWCQQGILLLN 181

Query: 126 AVLTVE