PSIBLAST alignment of GI: 254781074 and protein with PDB id: 1flz

>gi|13096539|pdb|1FLZ|A Chain A, Uracil Dna Glycosylase With Uaap Length = 228
 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 115/215 (53%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  H  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 5   TWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 64

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 65  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 124

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 125 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 184

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
            HPSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 185 PHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 219