PSIBLAST alignment of GI: 254781074 and protein with PDB id: 2j8x

>gi|122920847|pdb|2J8X|A Chain A, Epstein-Barr Virus Uracil-Dna Glycosylase In Complex With Ugi From Pbs-2 Length = 231
>gi|122920849|pdb|2J8X|C Chain C, Epstein-Barr Virus Uracil-Dna Glycosylase In Complex With Ugi From Pbs-2 Length = 231
 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 93/234 (39%), Positives = 127/234 (54%), Gaps = 15/234 (6%)

Query: 2   EGVKIHESWKSLLENHFQSEHMRNLKEFL---LSEKRKGKRIFPRGSHYFRAFDITPFNK 58
           E + + + W   L+    S   +     +   +   R    ++P              + 
Sbjct: 2   ENLLLPDLWLDFLQ---LSPIFQRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPSD 58

Query: 59  VKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWG 117
           +KVVILGQDPYH  GQA+GL FSV  G  +PPSL N+Y EL   +  F PP HG L+ W 
Sbjct: 59  IKVVILGQDPYHG-GQANGLAFSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWA 117

Query: 118 HEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL 177
            +GVLLLN +LTV++G+  SH   GW  FTD VI L+S   +  VFMLWGA A  K  ++
Sbjct: 118 SQGVLLLNTILTVQKGKPGSHADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLI 177

Query: 178 DHKRHLVLKAAHPSPL-------SASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           + K+HLVL + HPSPL       SA   F G  HF  AN +L+E G   ++W++
Sbjct: 178 NSKKHLVLTSQHPSPLAQNSTRKSAQQKFLGNNHFVLANNFLREKGLGEIDWRL 231