PSIBLAST alignment of GI: 254781074 and protein with PDB id: 2zhx

>gi|188595925|pdb|2ZHX|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Mycobacterium Tuberculosis In Complex With A Proteinaceous Inhibitor Length = 238
>gi|188595927|pdb|2ZHX|C Chain C, Crystal Structure Of Uracil-Dna Glycosylase From Mycobacterium Tuberculosis In Complex With A Proteinaceous Inhibitor Length = 238
 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/221 (40%), Positives = 127/221 (57%), Gaps = 4/221 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W + LE    ++ + ++ +FL +E   G+R  P GS+  RAF   PF+ V+V+I+G
Sbjct: 21  VERGWAAALEP--VADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVG 77

Query: 66  QDPYHNYGQAHGLCFSV-PLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPY   G A GL FSV P     P SL N++ E   D+ +  P++G L  W   GVLLL
Sbjct: 78  QDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLL 137

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV     ASHRG+GWE  T+  I  ++     +V +LWG  A   + +L     + 
Sbjct: 138 NRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVA 197

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +++ HPSPLSAS GFFG R FS+AN  L   G   ++W++P
Sbjct: 198 IESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 238