PSIBLAST alignment of GI: 254781074 and protein with PDB id: 4eug

>gi|5822568|pdb|4EUG|A Chain A, Crystallographic And Enzymatic Studies Of An Active Site Variant H187q Of Escherichia Coli Uracil Dna Glycosylase: Crystal Structures Of Mutant H187q And Its Uracil Complex Length = 229
>gi|5822576|pdb|5EUG|A Chain A, Crystallographic And Enzymatic Studies Of An Active Site Variant H187q Of Escherichia Coli Uracil Dna Glycosylase: Crystal Structures Of Mutant H187q And Its Uracil Complex Length = 229
 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 113/215 (52%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  +L    Q  +  N  + + SE++ G  I+P     F AF  T    VKVVILGQDP
Sbjct: 6   TWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH  GQAHGL FSV  GI IPPSL+N+YKEL+  +  F  P HG+LE W  +GVLLLN V
Sbjct: 66  YHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTV  G+A SH   GWE FTD VI LI+ + + +VF+LWG+ AQKK  ++D +RH VLKA
Sbjct: 126 LTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW 222
             PSPLSA  GFFGC HF  AN++L++HG+T ++W
Sbjct: 186 PQPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW 220