RPSBLAST alignment for GI: 254781074 and conserved domain: PHA03201

>gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional. Length = 318
 Score =  160 bits (405), Expect = 4e-40
 Identities = 93/227 (40%), Positives = 122/227 (53%), Gaps = 18/227 (7%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKR----IFPRGSHYFRAFDITPFNKVKV 61
           + ++W+ LLE     E    L   L++E  +  R    + PR   +      TP ++V+V
Sbjct: 102 VGDAWRPLLE----PELANPLTARLMAEYERRCRTEEVLPPREDVFSWTRYCTP-DEVRV 156

Query: 62  VILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPT----HGFLEHWG 117
           VI+GQDPYH  GQAHGL FSV  G   PPSL N+   ++   N  P      HG LE W 
Sbjct: 157 VIIGQDPYHQPGQAHGLAFSVRPGTPAPPSLRNILAAVR---NCCPDARMSGHGCLEKWA 213

Query: 118 HEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVL 177
             GVLLLN  LTV  G  ASH   GW++F  SV+  ++ +   +VFMLWGA AQ      
Sbjct: 214 RGGVLLLNTTLTVRRGEPASHAKIGWDRFVGSVVRRLAASRPGLVFMLWGAHAQNAIRP- 272

Query: 178 DHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           D + H VL  +HPSPLS    F  CRHF  AN+YL+E     ++W  
Sbjct: 273 DPRVHRVLTYSHPSPLSKV-PFGSCRHFCLANQYLRERSLAPIDWST 318