RPSBLAST alignment of GI: 254781074 and MMDB domain: 2boo_A_

>2boo_A (A:) UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans}Length = 247
 Score =  295 bits (756), Expect = 4e-81
 Identities = 109/226 (48%), Positives = 147/226 (65%), Gaps = 3/226 (1%)

Query: 1   MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60
           +    + E W+  L   F + +   L +FL  E RK   I+P     F A   TP  +VK
Sbjct: 18  IIPANLPEDWQEALLPEFSAPYFHELTDFLRQE-RKEYTIYPPAPDVFNALRYTPLGEVK 76

Query: 61  VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHE 119
           V+ILGQDPYH   QAHGL FSV  G+R+PPSL N+YKEL ED+  F+ P HG+L  W  +
Sbjct: 77  VLILGQDPYHGPNQAHGLSFSVRPGVRVPPSLRNIYKELTEDIPGFVAPKHGYLRSWAEQ 136

Query: 120 GVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDH 179
           GVLLLNAVLTV  G+A SH+G+GWE FTD+VI  ++   + +VF+LWG+ A+KK+ ++  
Sbjct: 137 GVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITG 196

Query: 180 KRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           K H+V+++ HPSPLS    FFG R FSK N  L++ G+  V WQ+P
Sbjct: 197 KNHVVIESGHPSPLSE-QYFFGTRPFSKTNEALEKAGRGPVEWQLP 241