RPSBLAST alignment of GI: 254781074 and MMDB domain: 2owr_A_48-218

>2owr_A (A:48-218) UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_ALength = 171
 Score =  207 bits (528), Expect = 1e-54
 Identities = 33/180 (18%), Positives = 60/180 (33%), Gaps = 12/180 (6%)

Query: 48  FRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIP 107
           F      P    +V + G DPY       G+ F  P       S+  +   +      + 
Sbjct: 3   FIQLK-QPLRNKRVCVCGIDPYPK--DGTGVPFESPNFT--KKSIKEIASSISRLT-GVI 56

Query: 108 PTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWG 167
              G+  +    GV+  N  L+ + G   SH    W++ +  ++  I   H ++++ L  
Sbjct: 57  DYKGYNLNIID-GVIPWNYYLSCKLGETKSHA-IYWDKISKLLLQHI-TKHVSVLYCLGK 113

Query: 168 ASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227
                 +  L+     +       P +    F   R F   N  L+   K  +NW     
Sbjct: 114 TDFSNIRAKLESPVTTI---VGYHPAARDRQFEKDRSFEIINVLLELDNKAPINWAQGFI 170