RPSBLAST alignment of GI: 254781074 and MMDB domain: 2zhx_A_

>2zhx_A (A:) UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI complex, UNG-DNA interactions, cytoplasm, DNA damage; 3.10A {Mycobacterium tuberculosis}Length = 238
 Score =  292 bits (749), Expect = 3e-80
 Identities = 89/223 (39%), Positives = 128/223 (57%), Gaps = 4/223 (1%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
             +   W + LE    ++ + ++ +FL +E   G+R  P GS+  RAF   PF+ V+V+I
Sbjct: 19  ELVERGWAAALE--PVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFT-FPFDNVRVLI 75

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIR-IPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVL 122
           +GQDPY   G A GL FSV   +R  P SL N++ E   D+ +  P++G L  W   GVL
Sbjct: 76  VGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVL 135

Query: 123 LLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRH 182
           LLN VLTV     ASHRG+GWE  T+  I  ++     +V +LWG  A   + +L     
Sbjct: 136 LLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNC 195

Query: 183 LVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           + +++ HPSPLSAS GFFG R FS+AN  L   G   ++W++P
Sbjct: 196 VAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 238