RPSBLAST alignment of GI: 254781074 and protein with PDBid: 3a7n

>3a7n_A UDG, uracil-DNA glycosylase; UNG-UGI interactions, UNG-DNA complex, citrate AS protein LI ligand binding, inhibitor design; HET: FLC; 1.95A {Mycobacterium tuberculosis H37RV} PDB: 2zhx_A* Length = 238
 Score =  296 bits (758), Expect = 3e-81
 Identities = 89/221 (40%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W + LE    ++ + ++ +FL +E   G+R  P GS+  RAF   PF+ V+V+I+G
Sbjct: 21  VERGWAAALE--PVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFT-FPFDNVRVLIVG 77

Query: 66  QDPYHNYGQAHGLCFSVPLGIR-IPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPY   G A GL FSV   +R  P SL N++ E   D+ +  P++G L  W   GVLLL
Sbjct: 78  QDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLL 137

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV     ASHRG+GWE  T+  I  ++     +V +LWG  A   + +L     + 
Sbjct: 138 NRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVA 197

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +++ HPSPLSAS GFFG R FS+AN  L   G   ++W++P
Sbjct: 198 IESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 238