BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] (227 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 471 bits (1212), Expect = e-135, Method: Compositional matrix adjust. Identities = 227/227 (100%), Positives = 227/227 (100%) Query: 1 MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60 MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK Sbjct: 1 MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVK 60 Query: 61 VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120 VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG Sbjct: 61 VVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEG 120 Query: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK Sbjct: 121 VLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHK 180 Query: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS Sbjct: 181 RHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS 227 >gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Score = 25.0 bits (53), Expect = 1.2, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 149 SVIDLISNNHQNIVFMLWGASAQKKQDVL 177 SV+D + Q+ + ML G S +KK VL Sbjct: 811 SVMDALQKKIQSGIIMLVGISKEKKASVL 839 >gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 180 KRHLVLKAAHPSPLSASHGFFGCR 203 KR +V A H L ++ GF+G R Sbjct: 5 KRGVVSSAKHKKVLKSAKGFYGRR 28 >gi|254780960|ref|YP_003065373.1| phosphoserine phosphatase SerB [Candidatus Liberibacter asiaticus str. psy62] Length = 297 Score = 22.7 bits (47), Expect = 5.2, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 132 EGRAASHRGRGWEQFTDSVIDLISNNHQN 160 EG HR + D IDLI + H+N Sbjct: 49 EGMIDHHRSKILSIIADKPIDLIIHRHEN 77 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 22.3 bits (46), Expect = 6.8, Method: Compositional matrix adjust. Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 11/82 (13%) Query: 27 KEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYH-----NYGQAHGLCFS 81 KE LL KGKR + D P + GQ + Y A + S Sbjct: 186 KELLL----KGKRALVTSGPTYEPLD--PMRYIANRSSGQQGHAIAKSLAYFGAEVILIS 239 Query: 82 VPLGIRIPPSLVNVYKELQEDV 103 P+ I PP+++ ++ E ED+ Sbjct: 240 GPVSIADPPNVMTIHVERAEDM 261 >gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Score = 21.9 bits (45), Expect = 9.0, Method: Compositional matrix adjust. Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Query: 2 EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGS 45 EG K+ S + F H +L ++ GKR FP G+ Sbjct: 620 EGYKVRLSGQDCERGTFSHRHA------ILCDQETGKRYFPLGN 657 >gi|254780391|ref|YP_003064804.1| DNA polymerase III subunit chi [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 21.9 bits (45), Expect = 9.5, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 11 KSLLENHFQSEHMRNLKEFLLSEKRKGKRI 40 ++LL F+++ NL L E KGKR+ Sbjct: 2 RTLLFYRFKNDWEYNLLVLLQDEYEKGKRV 31 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.138 0.436 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 158,352 Number of Sequences: 1233 Number of extensions: 6521 Number of successful extensions: 17 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 8 length of query: 227 length of database: 328,796 effective HSP length: 71 effective length of query: 156 effective length of database: 241,253 effective search space: 37635468 effective search space used: 37635468 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)