RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781077|ref|YP_003065490.1| hypothetical protein CLIBASIA_04895 [Candidatus Liberibacter asiaticus str. psy62] (111 letters) >gnl|CDD|33459 COG3661, AguA, Alpha-glucuronidase [Carbohydrate transport and metabolism]. Length = 684 Score = 31.2 bits (70), Expect = 0.061 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Query: 11 SSMGINYNIPACYPDPLEDSSLFYHFHSTLNLMTLHLPLRLQEEG 55 +GI PA D + +T + L LPL+L EEG Sbjct: 54 GLVGIT---PASASAGARDGVILLASGATPAITGLGLPLKLGEEG 95 >gnl|CDD|100024 cd06060, misato, Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria. It has a role in mitochondrial fusion and in mitochondrial distribution and morphology. Mutations in its Drosophila homolog (misato) lead to irregular chromosome segregation during mitosis. Deletion of the budding yeast homolog DML1 is lethal and unregulate expression of DML1 leads to mitochondrial dispersion and abnormalities in cell morphology. The Misato/DML1 protein family is conserved from yeast to human, but its exact function is still unknown.. Length = 493 Score = 29.6 bits (67), Expect = 0.18 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Query: 7 LSVISSMGINYNIPACYPDPLEDSSLFYHFHSTLN--LMTLHLPLRLQEEGISQSNLRTD 64 LS+ ++ P +P D+ L YH + L L TL LP RL+ S S L D Sbjct: 226 LSLSGTLWRKPGPPRTFPYLNYDAELPYHTSALLATALDTLTLPYRLKSSPSSLSGLCDD 285 >gnl|CDD|73318 cd02648, nuc_hydro_1, NH_1: A subgroup of nucleoside hydrolases. This group contains fungal proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. . Length = 367 Score = 28.1 bits (62), Expect = 0.54 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 18/80 (22%) Query: 10 ISSMGINYNIPA---------CYPDPLEDSSLFYHFHSTLNLMTLHLPLRLQEEGISQSN 60 + MG ++P C+ DP + + ST LPL++ I+ Sbjct: 181 VVVMGGAIDVPGNTSPVAEFNCFADPYAAAVVIDEPPSTAPEARRKLPLQVFPLDIT--- 237 Query: 61 LRTDHNVKQ----HVAITPI 76 T H + +TP Sbjct: 238 --TGHTLPYSSLFATYVTPR 255 >gnl|CDD|37371 KOG2160, KOG2160, KOG2160, Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]. Length = 342 Score = 28.0 bits (62), Expect = 0.62 Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Query: 56 ISQSNLRTDHNVKQHVAITPILQMLDLTNCRHSRVNQWRQISNII-----GYKKIKRIN 109 Q+N ++ V + A++ +L++L + R IS++I G + ++N Sbjct: 151 AVQNNPKSQEQVIELGALSKLLKILSSDDPNTVRTKALFAISSLIRNNKPGQDEFLKLN 209 >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Length = 351 Score = 25.6 bits (57), Expect = 3.3 Identities = 6/29 (20%), Positives = 10/29 (34%) Query: 63 TDHNVKQHVAITPILQMLDLTNCRHSRVN 91 T V V + P ++ C+ N Sbjct: 84 TGFKVGDRVVVEPTIKCGTCGACKRGLYN 112 >gnl|CDD|39604 KOG4403, KOG4403, KOG4403, Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]. Length = 575 Score = 25.1 bits (54), Expect = 4.3 Identities = 6/24 (25%), Positives = 16/24 (66%) Query: 79 MLDLTNCRHSRVNQWRQISNIIGY 102 + ++T R+++W+QI ++ G+ Sbjct: 406 LSEVTTLLRERLHRWQQIESLCGF 429 >gnl|CDD|37158 KOG1947, KOG1947, KOG1947, Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]. Length = 482 Score = 25.1 bits (53), Expect = 4.7 Identities = 16/61 (26%), Positives = 26/61 (42%) Query: 27 LEDSSLFYHFHSTLNLMTLHLPLRLQEEGISQSNLRTDHNVKQHVAITPILQMLDLTNCR 86 L L L L+ L + +L+ +S L TD + + P L+ L L+NC Sbjct: 221 LSGCCLLITLSPLLLLLLLSICRKLKSLDLSGCGLVTDIGLSALASRCPNLETLSLSNCS 280 Query: 87 H 87 + Sbjct: 281 N 281 >gnl|CDD|176074 cd08692, C2B_Tac2-N, C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus). Tac2-N contains two C2 domains and a short C-terminus including a WHXL motif, which are key in stabilizing transport vesicles to the plasma membrane by binding to a plasma membrane. However unlike the usual carboxyl-terminal-type (C-type) tandem C2 proteins, it lacks a transmembrane domain, a Slp-homology domain, and a Munc13-1-interacting domain. Homology search analysis indicate that no known protein motifs are located in its N-terminus, making Tac2-N a novel class of Ca2+-independent, C-type tandem C2 proteins. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 135 Score = 24.5 bits (53), Expect = 6.9 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 15/58 (25%) Query: 44 TLHLPLRLQEEGI-------SQSNLRTDHNVKQHVAITPILQMLDLTNCRHSRVNQWR 94 T+ P+ QE GI S+S++R H + Q + D ++ V QW+ Sbjct: 70 TMIFPVTQQEHGIQFLIKLYSRSSVRRKHFLGQ------VWISSDSSSSE--AVEQWK 119 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.138 0.428 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,345,029 Number of extensions: 58582 Number of successful extensions: 153 Number of sequences better than 10.0: 1 Number of HSP's gapped: 153 Number of HSP's successfully gapped: 12 Length of query: 111 Length of database: 6,263,737 Length adjustment: 77 Effective length of query: 34 Effective length of database: 4,599,844 Effective search space: 156394696 Effective search space used: 156394696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.6 bits)