BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781077|ref|YP_003065490.1| hypothetical protein CLIBASIA_04895 [Candidatus Liberibacter asiaticus str. psy62] (111 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781077|ref|YP_003065490.1| hypothetical protein CLIBASIA_04895 [Candidatus Liberibacter asiaticus str. psy62] Length = 111 Score = 229 bits (585), Expect = 7e-63, Method: Compositional matrix adjust. Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MIILHCLSVISSMGINYNIPACYPDPLEDSSLFYHFHSTLNLMTLHLPLRLQEEGISQSN 60 MIILHCLSVISSMGINYNIPACYPDPLEDSSLFYHFHSTLNLMTLHLPLRLQEEGISQSN Sbjct: 1 MIILHCLSVISSMGINYNIPACYPDPLEDSSLFYHFHSTLNLMTLHLPLRLQEEGISQSN 60 Query: 61 LRTDHNVKQHVAITPILQMLDLTNCRHSRVNQWRQISNIIGYKKIKRINCG 111 LRTDHNVKQHVAITPILQMLDLTNCRHSRVNQWRQISNIIGYKKIKRINCG Sbjct: 61 LRTDHNVKQHVAITPILQMLDLTNCRHSRVNQWRQISNIIGYKKIKRINCG 111 >gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 2 IILHCLSVISSMGINYNI 19 I HCL ++S G+N+ + Sbjct: 217 IAAHCLKIMSKQGMNFQL 234 >gi|255764511|ref|YP_003065518.2| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.6 bits (44), Expect = 4.4, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 47 LPLRLQEEGISQSNLRTDHNVKQHVAITPIL 77 L +R+ GIS S++ NVK I IL Sbjct: 133 LDMRMSCSGISASDVVNQANVKDLTRILGIL 163 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.138 0.428 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,727 Number of Sequences: 1233 Number of extensions: 2657 Number of successful extensions: 5 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 3 length of query: 111 length of database: 328,796 effective HSP length: 63 effective length of query: 48 effective length of database: 251,117 effective search space: 12053616 effective search space used: 12053616 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)