HHsearch alignment for GI: 254781079 and conserved domain: COG2199

>COG2199 c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms].
Probab=99.97  E-value=8e-30  Score=246.92  Aligned_cols=164  Identities=39%  Similarity=0.570  Sum_probs=144.7

Q ss_pred             HHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHHC-------CCCEEEEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCC
Q ss_conf             999999999996104010502048999888770-------8972575544221000114688654443110000000111
Q gi|254781079|r   93 LFISYNRISQLSRIDCLSGLLNHSAFISSLGSY-------NEKLSIVFFDIDYFKQINDNFGHPVGDKVIAFLSDQLVVV  165 (266)
Q Consensus        93 l~~~~~~l~~~a~~D~LTgL~NR~~f~~~l~~~-------~~~~~l~~idid~fk~iNd~~G~~~gD~~L~~va~~l~~~  165 (266)
T Consensus         9 ~~~~~~~l~~~a~~D~LTgl~NR~~~~~~l~~~~~~~~~~~~~~~l~liDiD~Fk~iND~~Gh~~GD~vL~~va~~L~~~   88 (181)
T COG2199           9 LRKAEERLERLALHDPLTGLPNRRAFEERLERALARARRHGEPLALLLLDLDHFKQINDTYGHAAGDEVLREVARRLRSN   88 (181)
T ss_pred             HHHHHHHHHHHHHHCHHCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHCHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998625423187268999999999999734338856999996641025575457687999999999999986


Q ss_pred             CCCCHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEEEECCCC-CCH-HHHHHHHHHH
Q ss_conf             11000000133430365016861012344458999998631540679956899999999877998-998-9999999999
Q gi|254781079|r  166 FGTPMFVGRLGGEEFAAAALGSSEQEAAILANDLRKIIENSQINISSGPSIHITISAGIAERCHK-EPI-STIIYRADQA  243 (266)
Q Consensus       166 ~~~~~~~~R~~gdeF~ill~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~t~s~Gia~~~~~-~~~-~~ll~~Ad~A  243 (266)
T Consensus        89 ~~~~~~~~R~gGdEF~i~l~~~~~~~~~~~a~~i~~~i~~~~~--~~~~~~~~t~siGia~~~~~~~~~~~~l~~~Ad~a  166 (181)
T COG2199          89 LREGDLVARLGGDEFAVLLPGTSLEEAARLAERIRAALEEPFF--LGGEELRVTVSIGVALYPEDGSDDAELLLRRADLA  166 (181)
T ss_pred             CCCCCEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC--CCCCCEEEEEEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             4988789998775489997899989999999999999845344--57873368998999980688876099999999999


Q ss_pred             HHHHHHCCCCEEEEC
Q ss_conf             999997099689994
Q gi|254781079|r  244 LYVAKKSGRNRVVCF  258 (266)
Q Consensus       244 l~~AK~~gkn~~~~~  258 (266)
T Consensus       167 l~~ak~~G~~~~~~~  181 (181)
T COG2199         167 LYRAKRAGRNRVVVF  181 (181)
T ss_pred             HHHHHHHCCCCEEEC
T ss_conf             999998389936649