RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781079|ref|YP_003065492.1| diguanylate cyclase [Candidatus Liberibacter asiaticus str. psy62] (266 letters) >d1w25a3 d.58.29.2 (A:294-455) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]} Length = 162 Score = 77.9 bits (190), Expect = 7e-16 Identities = 48/160 (30%), Positives = 76/160 (47%), Gaps = 9/160 (5%) Query: 109 LSGLLNHSAFISSLGS-------YNEKLSIVFFDIDYFKQINDNFGHPVGDKVIAFLSDQ 161 L+GL N L S + +S + DID+FK+IND FGH +GD+V+ + + Sbjct: 1 LTGLHNRRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALR 60 Query: 162 LVVVFGTPMFVGRLGGEEFAAAALGSSEQEAAILANDLRKIIENSQ-INISSGPSIHITI 220 L R GGEEF ++ +A +A +R + S +++TI Sbjct: 61 LASNVRAIDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTI 120 Query: 221 SAGIAE-RCHKEPISTIIYRADQALYVAKKSGRNRVVCFS 259 S G++ + ++ RAD+ +Y AK SGRN VV + Sbjct: 121 SIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKA 160 >d1b4ub_ c.56.6.1 (B:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis [TaxId: 13689]} Length = 298 Score = 26.9 bits (59), Expect = 1.8 Identities = 13/66 (19%), Positives = 21/66 (31%) Query: 145 NFGHPVGDKVIAFLSDQLVVVFGTPMFVGRLGGEEFAAAALGSSEQEAAILANDLRKIIE 204 G + V +F D V V+GT +L G L +D ++ + Sbjct: 166 ALGDSIRAAVESFPEDLNVHVWGTGGMSHQLQGPRAGLINKEFDLNFIDKLISDPEELSK 225 Query: 205 NSQINI 210 I Sbjct: 226 MPHIQY 231 >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Score = 26.2 bits (56), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 90 LKELFISYNRISQLSRIDCLSGL 112 L+ L IS N++S +S + L+ L Sbjct: 174 LERLDISSNKVSDISVLAKLTNL 196 >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Score = 25.7 bits (55), Expect = 4.0 Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 90 LKELFISYNRISQLSRIDCLSGL 112 L+ LF + N++S +S + L+ + Sbjct: 331 LQRLFFANNKVSDVSSLANLTNI 353 Score = 25.3 bits (54), Expect = 4.8 Identities = 15/117 (12%), Positives = 39/117 (33%), Gaps = 11/117 (9%) Query: 5 LKDFLSIWLCHEKNLESFSPHTFMIYFSIFFSIFIATVIFIANIFLFYIGLTPFYGLEYI 64 + + + + + I + + N ++ L+ + Sbjct: 275 ISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRL 334 Query: 65 LVENLSLVIISITISLLLGYISGSILKELFISYNRISQLSRIDCLSGL----LNHSA 117 N + +S +++ L + + L +N+IS L+ + L+ + LN A Sbjct: 335 FFANNKVSDVS-SLANL------TNINWLSAGHNQISDLTPLANLTRITQLGLNDQA 384 >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Score = 25.0 bits (53), Expect = 6.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 90 LKELFISYNRISQLSRIDCLSGL 112 L E+ + N+IS +S + S L Sbjct: 197 LIEVHLKNNQISDVSPLANTSNL 219 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.326 0.142 0.409 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 981,608 Number of extensions: 45832 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's gapped: 187 Number of HSP's successfully gapped: 15 Length of query: 266 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 182 Effective length of database: 1,254,276 Effective search space: 228278232 Effective search space used: 228278232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.0 bits)